current user: public

Query: 2vim_A mol:protein length:104 THIOREDOXIN, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
41 -57.3001m7t_A mol:protein length:107 Chimera of Human and E. coli thioredoxin  ali model follow..  30  2VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDAQDVAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDAN. 105
60 -43.7003gnj_A mol:protein length:111 Thioredoxin domain protein  ali model follow..  23  10.....DTNTFEQLIYDE-GKACLVMFSRKNCHVCQKVTPVLEELRLNYEEFGFYYVDVEEEKTLFQRFSLKGVPQILYFKDGEYKGKMAGDEDDEVEQMIADV. 108
65 -43.3002dj0_A mol:protein length:137 Thioredoxin-related transmembrane protein 2  ali model follow..  25  13.....NDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNGLNFGKVDVGRYTDVSTRYKVSTLPTLILFQGGKEAMRRPQIDKKG......... 110
70 -43.0002puk_C mol:protein length:106 Thioredoxin M-type, chloroplast (TRX-M)  ali model follow..  29  6.....NDSSWKEFVLES-EVPVMVDFWAPWCGPSKLIAPVIDELAKEYSKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAPKSTLTDSIEKY. 104

FFAS is supported by the NIH grant R01-GM087218-01
8 5 8 4 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zmasek CM, Zhang Q, Ye Y, Godzik A. Surprising complexity of the ancestral apoptosis network. Genome Biol. 2007 Oct 24;8(10):R226 [Epub ahead of print]