current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

2vimA
Query: 2vim_A mol:protein length:104 THIOREDOXIN, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst MRVLATAADLEKLINENKGRLIVVDFFAQWCGPCRNIAPKVEALAKEIPEVEFAKVDVDQNEEAAAKYSVTAMPTFVFIKDGKEVDRFSGANETKLRETITRHKLast
1 -71.0002vim_A mol:protein length:104 THIOREDOXIN  ali model  100  1MRVLATAADLEKLINENKGRLIVVDFFAQWCGPCRNIAPKVEALAKEIPEVEFAKVDVDQNEEAAAKYSVTAMPTFVFIKDGKEVDRFSGANETKLRETITRHK 104
2 -70.0003ZZX Entity 1(prereleased)  ali follow..  43  2VYQVKDQEDFTKQLNEAGNKLVVIDFYATWCGPCKMIAPKLEELSQSMSDVVFLKVDVDECEDIAQDNQIACMPTFLFMKNGQKLDSLSGANYDKLLELVEKNK 105
3 -67.9003qfa_C mol:protein length:116 Thioredoxin  ali model follow..  36  7VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPSKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINEL. 109
4 -67.5001gh2_A mol:protein length:107 THIOREDOXIN-LIKE PROTEIN  ali model follow..  32  3VKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFQFFRNKVRIDQYQGADAVGLEEKIKQH. 105
5 -67.5003kd0_A mol:protein length:105 Thioredoxin  ali model follow..  36  2VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPSKMIKPFFHSLSEKYSNVIFLEVDVDDSQDVASESEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINEL. 104
6 -67.4001aiu_A mol:protein length:105 THIOREDOXIN  ali model follow..  36  2VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINEL. 104
7 -67.3003e3e_A mol:protein length:105 Thioredoxin  ali model follow..  36  2VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPSKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKRMPTFQFFKKGQKVGEFSGANKEKLEATINEL. 104
8 -67.3001erv_A mol:protein length:105 THIOREDOXIN  ali model follow..  37  2VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINEL. 104
9 -67.2001cqg_A mol:protein length:105 THIOREDOXIN  ali model follow..  36  2VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPAKMIKPFFHSLSEKYSNVIFLEVDVDDAQDVASEAEVKATPTFQFFKKGQKVGEFSGANKEKLEATINEL. 104
10 -67.1003trx_A mol:protein length:105 THIOREDOXIN  ali model follow..  36  2VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCTPTFQFFKKGQKVGEFSGANKEKLEATINEL. 104
11 -67.1001erw_A mol:protein length:105 THIOREDOXIN  ali model follow..  35  2VKQIESKTAFQEALDAAGDKLVVVDFSATWSGPSKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINEL. 104
12 -66.9001xwa_A mol:protein length:111 thioredoxin  ali model follow..  41  7VYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFDNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKAN. 110
13 -66.3002xbi_A mol:protein length:108 THIOREDOXIN  ali model follow..  45  6LIELKQDGDLESLLEQHKNKLVVVDFFATWCGPCKTIAPLFKELSEKY-DAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIAKVEDMIKKF. 107
14 -65.9002xbq_A mol:protein length:117 THIOREDOXIN  ali model follow..  45  15LIELKQDGDLESLLEQHKNKLVVVDFFATWCGPCKTIAPLFKELSEKY-DAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIAKVEDMIKKF. 116
15 -64.9003f3q_A mol:protein length:109 Thioredoxin-1  ali model follow..  39  2VTQFKTASEFDSAI--AQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAIAAN. 102
16 -64.7002diy_A mol:protein length:130 Thioredoxin-like protein 2  ali model follow..  32  20VEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRH. 122
17 -64.6002vm1_A mol:protein length:118 THIOREDOXIN H ISOFORM 1.  ali model follow..  39  8VIACHTKQEFDTHMANGTGKLVIIDFTASWCGPCRVIAPVFAEYAKKFPGAIFLKVDVDELKDVAEAYNVEAMPTFLFIKDGEKVDSVVGGRKDDIHTKIVAL. 112
18 -64.5001ep7_A mol:protein length:112 THIOREDOXIN CH1, H-TYPE  ali model follow..  39  4VIVIDSKAAWDAQLAKGEHKPIVVDFTATWCGPCKMIAPLFETLSNDYGKVIFLKVDVDAVAAVAEAAGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH. 109
19 -64.5001faa_A mol:protein length:124 THIOREDOXIN F  ali model follow..  32  20.VTEVNKDTFWPIVKAAGDKPVVLDMFTQWCGPCKAMAPKYEKLAEEYLDVIFLKLDCNENKTLAKELGIRVVPTFKILKENSVVGEVTGAKYDKLLEAIQAAR 123
20 -64.0002fa4_A mol:protein length:111 Thioredoxin II  ali model follow..  40  3VTQLKSASEYDSALASG-DKLVVVDFFATWCGPCKMIAPMIEKFAEQYSDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAIASN. 104
21 -63.9001ti3_A mol:protein length:113 thioredoxin H  ali model follow..  42  6VIACHTVDTWKEHFEKGSQKLIVVDFTASWCPPCKMIAPIFAELAKKFPNVTFLKVDVDELKAVAEEWNVEAMPTFIFLKDGKLVDKTVGADKDGLPTLVAKH. 110
22 -63.7001syr_A mol:protein length:112 thioredoxin  ali model follow..  39  4VKIVTSQAEFDSII--SQNELVIVDFFAEWCGPCKRIAPFYEECSKTYTKMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGANDSALKQLIEKY. 104
23 -63.4001xfl_A mol:protein length:124 Thioredoxin h1  ali model follow..  41  12VIACHTVETWNEQLQKESKTLVVVDFTASWCGPCRFIAPFFADLAKKLPNVLFLKVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAKH. 116
24 -63.1002wz9_A mol:protein length:153 GLUTAREDOXIN-3  ali model follow..  32  14VEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRH. 116
25 -62.9001m7t_A mol:protein length:107 Chimera of Human and E. coli thioredoxin  ali model follow..  30  2VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDAQDVAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDAN. 105
26 -62.7002oe0_A mol:protein length:114 Thioredoxin-3  ali model follow..  39  8ITKLTNLTEFRNLI--KQNDKLVIDFYATWCGPCKMMQPHLTKLIQAYPDVRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPTALEKGIKD.. 107
27 -62.7001wmj_A mol:protein length:130 Thioredoxin H-type  ali model follow..  43  16VIACHNKDEFDAQMTKAAGKVVIIDFTASWCGPCRFIAPVFAEYAKKFPGAVFLKVDVDELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTIVKH. 120
28 -62.4002iwt_A mol:protein length:125 THIOREDOXIN H ISOFORM 2  ali model follow..  39  17VISVHSLEQWTMQIEETAKKLVVIDFTASWCGPSRIMAPVFADLAKKFPNAVFLKVDVDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTAKVGLH. 121
29 -61.8002j23_A mol:protein length:121 THIOREDOXIN  ali model follow..  38  11.VQVISSYDQFKQVTGG-DKVVVIDFWATWCGPCKMIGPVFEKISDTPDKVGFYKVDVDEQSQIAQEVGIRAMPTFVFFKNGQKIDTVVGADPSKLQAAITQH. 113
30 -61.2001r26_A mol:protein length:125 Thioredoxin  ali model follow..  34  15VVDVYSVEQFRNIM--SEDILTVAWFTAVWCGPCKTIERPMEKIAYEFPTVKFAKVDADNNSEIVSKCRVLQLPTFIIARSGKMLGHVIGANPGMLRQKLRDI. 115
31 -60.1003d22_A mol:protein length:139 Thioredoxin H-type  ali model follow..  33  26VHLITTKERWDQKLSEADGKIVLANFSARWCGPSRQIAPYYIELSENYPSLMFLVIDVDELSDFSASWEIKATPTFFFLRDGQQVDKLVGANKPELHKKITAI. 130
32 -60.1002f51_A mol:protein length:118 thioredoxin  ali model follow..  36  6VHFNGTHEALLNRIKEA-PGLVLVDFFATWCGPCQRLGQILPSIAEANKDVTFIKVDVDKNGNAADAYGVSSIPALFFVKKEKTLDQFVGADVSRIKADIEKFK 112
33 -60.1003d21_A mol:protein length:139 Thioredoxin H-type  ali model follow..  33  26VHLITTKERWDQKLSEADGKIVLANFSARWCGPCKQIAPYYIELSENYPSLMFLVIDVDELSDFSASWEIKATPTFFFLRDGQQVDKLVGANKPELHKKITAI. 130
34 -59.6003hhv_A mol:protein length:110 Thioredoxin (TrxA-2)  ali model follow..  30  8.VKHLNSKNFDEFI--TKNKIVVVDFWAEWCAPCLILAPVIEELANDYPQVAFGKLNTEESQDIAMRYGIMSLPTIMFFKNGELVDQILGAPREEIEVRLKSL. 108
35 -59.6003cxg_A mol:protein length:133 Putative thioredoxin  ali model follow..  23  16YIELKNTGSLNQVFSSTQNSSIVIKFGAVWCKPCNKIKEYFKNQLNYY-YVTLVDIDVDIHPKLNDQHNIKALPTFEFYFNLNNVHTVEGANQNDIEKAFQKY. 121
36 -59.4003d6i_A mol:protein length:112 Monothiol glutaredoxin-3  ali model follow..  24  2VIEINDQEQFTYLTTTAGDKLIVLYFHTSWAEPCKALKQVFEAISNEPSNVSFLSIDADENSEISELFEISAVPYFIIIHKGTILKELSGADPKEYVSLLEDC. 107
37 -58.7002e0q_A mol:protein length:104 thioredoxin  ali model follow..  34  1.VIHLDSKNFDSFL--ASHEIAVVDFWAEWCAPCLILAPIIEELAEDYPQVGFGKLNSDENPDIAARYGVMSLPTVIFFKDGEPVDEIIGAPREEIEIRIKNL. 101
38 -58.4002i4a_A mol:protein length:107 thioredoxin  ali model follow..  31  4.TLAVSDSSFDQDVLKA-SGLVLVDFWAEWCGPCKMIGPALGEIGKEFGKVTVAKVNIDDNPETPNAYQVRSIPTLMLVRDGKVIDKKVGAPKSQLKAWVESAQ 107
39 -58.1002i1u_A mol:protein length:121 Thioredoxin  ali model follow..  34  14.TIKVTDASFATDVLSS-NKPVLVDFWATWCGPCKMVAPVLEEIATERTDLTVAKLDVDTNPETARNFQVVSIPTLILFKDGQPVKRIVGAGKAALLRELSDV. 116
40 -57.8002o8v_B mol:protein length:128 Thioredoxin 1  ali model follow..  30  18.IIHLTDDSFDTDVLKA-DGAILVDFWAEWCGPAKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDAN. 120
41 -57.6003dyr_A mol:protein length:111 Thioredoxin-1  ali model follow..  31  5.IIHLTDDSFDTDVLKA-DGAILVDFWAEWCGPCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGTPTLLLFKNGEVAATKVGASKGQLKEFLDAN. 107
42 -57.4001thx_A mol:protein length:115 THIOREDOXIN  ali model follow..  25  9.VITITDAEFESEVLKA-EQPVLVYFWASWCGPCQLMSPLINLAANTYDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVSKDKLLSFLDTH. 111
43 -57.3001srx_A mol:protein length:108 THIOREDOXIN  ali model follow..  31  4.IIHLTDDSFDTDLVKA-DGAILVDFWAEWCGPCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYIERGIPTLLLFKNGEVAATKVGASKGQLKEFLDAN. 106
44 -57.3002eir_A mol:protein length:108 Thioredoxin 1  ali model follow..  30  4.IIHLTDDSFDTDVLKA-DGAILVDFWAEWCGPCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKCFLDCN. 106
45 -57.2001keb_A mol:protein length:108 Thioredoxin 1  ali model follow..  30  4.IIHLTDDSFDTDVLKA-DGAILVDFWAEWCGPCKLIASILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDAN. 106
46 -57.2001t00_A mol:protein length:112 Thioredoxin  ali model follow..  33  7.LKHVTDDSFEQDVLKN-DKPVLVDFWAAWCGPCRQIAPSLEAIAAEYDKIEIVKLNIDENPGTAAKYGVMSIPTLNVYQGGEVAKTIVGAPKAAIVRDLEDF. 109
47 -56.9001txx_A mol:protein length:108 PROTEIN (THIOREDOXIN)  ali model follow..  29  4.IIHLTDDSFDTDVLKA-DGAILVDFWAEWCVWCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDAN. 106
48 -56.9001zcp_A mol:protein length:108 Thioredoxin 1  ali model follow..  28  4.IIHLTDDSFDTDVLKA-DGAILVDFWAEWCACAKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDAN. 106
49 -56.9002cvk_A mol:protein length:110 Thioredoxin  ali model follow..  36  4.PIEVTDQNFDETL--GQHPLVLVDFWAEWCAPCRMIAPILEEIAKEYGKLLVAKLDVDENPKTAMRYRVMSIPTVILFKDGQPVEVLVGAPKRNYQAKIEKH. 105
50 -56.8001dby_A mol:protein length:107 CHLOROPLAST THIOREDOXIN M CH2  ali model follow..  28  3.AGAVNDDTFKNVVLES-SVPVLVDFWAPWCGPCRIIAPVVDEIAGEYDKLKCVKLNTDESPNVASEYGIRSIPTIMVFKGGKKCETIIGAPKATIVQTVEKY. 105
51 -56.8002puk_C mol:protein length:106 Thioredoxin M-type, chloroplast (TRX-M)  ali model follow..  28  2.VQDVNDSSWKEFVLES-EVPVMVDFWAPWCGPSKLIAPVIDELAKEYGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAPKSTLTDSIEKY. 104
52 -56.8003tco_A mol:protein length:109 Thioredoxin (TrxA-1)  ali model follow..  30  5VTLVLTEENFDEVI--RNNKLVLVDCWAEWCAPCHLYEPIYKKVAEKYGKAVFGRLNVDENQKIADKYSVLNIPTTLIFVNGQLVDSLVGADEDTLESTVNKY. 107
53 -56.7001uvz_A mol:protein length:119 THIOREDOXIN  ali model follow..  33  9.FNIQDGPDFQDRVVNS-ETPVVVDFHAQWCGPCKILGPRLEKMVAKQGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIDEDQLEAFLKKL. 111
54 -56.7002o7k_A mol:protein length:107 Thioredoxin  ali model follow..  39  6.IVKVTDADFDSKVESG---VQLVDFWATWCGPCKMIAPVLEELAADYGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFPKENLAEVLDKH. 106
55 -56.6002o89_A mol:protein length:107 Thioredoxin  ali model follow..  37  6.IVKVTDADFDSKVESG---VQLVDFWATWCGTSKMIAPVLEELAADYGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFPKENLAEVLDKH. 106
56 -56.4003VFI Entity 1(prereleased)  ali follow..  24  1.LRSLSDSDFQLEVRQH-PDPIIIMFTGSWCQPCKKMKPTFEEMASQMGDIRFAYMDAEDAEKTMAELNIRTLPSLALFVDGMIREVFSGTNKSDLRYWINNN. 103
57 -56.4003ul3_B mol:protein length:128 Thioredoxin  ali model follow..  28  26.RLQQNGSNIINGVNMK-NTVIVLYFFAKWCQACTMQSTEMDKLQKYYKRIYLLKVDLDKNESLARKFSVKSLPTIILLKNKTMLARKDHFSSNDLIALIKKH. 128
58 -56.2003hz4_A mol:protein length:140 Thioredoxin  ali model follow..  23  8.IIEFEDMTWSQQVEDS-KKPVVVMFYSPACPYCKAMEPYFEEYAKEYSSAVFGRINIATNPWTAEKYGVQGTPTFKFFCHGRPVWEQVGQYPSILKNAVRDM. 110
59 -56.2002voc_A mol:protein length:112 THIOREDOXIN  ali model follow..  35  3.IVKATDQSFSAET---SEGVVLADFWAPWCGPSKMIAPVLEELDQEMDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKDGEVVETSVGFPKEALQELVNKH. 103
60 -56.1001nsw_A mol:protein length:105 THIOREDOXIN  ali model follow..  30  2.TMTLTDANFQQAI--QGDGPVLVDFWAAWCGPCRMMAPVLEEFAEAHDKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGRPVKQLIGYPKEQLEAQLADV. 103
61 -56.1003emx_A mol:protein length:135 Thioredoxin  ali model follow..  19  18.LIYITPEEFRQLL----QGDAILAVYSKTCPHCHRDWPQLIQASKEVDGSLIGERELSAARLEMNKAGVEGTPTLVFYKEGRIVDKLVGAPWSLKVEKAREI. 124
62 -56.0001nw2_A mol:protein length:105 THIOREDOXIN  ali model follow..  30  2.TMTLTDANFQQAI--QGDKPVLVDFWAAWCGPCRMMAPVLEEFAEAHDKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGEPVKQLIGYPKEQLEAQLADV. 103
63 -55.7003hxs_A mol:protein length:141 Thioredoxin  ali model follow..  32  24.TIHLTRAEFLKKIADLGDKPAIVDFYADWCGPCKMVAPILEELSKEYGKIYIYKVNVDKEPELARDFGIQSIPTIWFVPMKGEPQVNMGASKEQLKGYIDKV. 137
64 -55.6002l5l_A mol:protein length:136 Thioredoxin  ali model follow..  28  22.KVYNFEKNPEEWKYEG-DKPAIVDFYADWCGPCKMVAPILDELAKEYGQIVIYKVDTEKEQELAGAFGIRSIPSILFIPMEGKPEMAQGAPKASFKKAIDEF. 124
65 -55.4002dj0_A mol:protein length:137 Thioredoxin-related transmembrane protein 2  ali model follow..  22  9.IKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYTGLNFGKVDVGRYTDVSTRYKVKQLPTLILFQGGKEAMRRPQIKKGRAVSWTFSEE 120
66 -55.3003gnj_A mol:protein length:111 Thioredoxin domain protein  ali model follow..  21  6.LEKLDTNTFEQLIYDE-GKACLVMFSRKNCHVCQKVTPVLEELRLNYESFGFYYVDVEEEKTLFQRFSLKGVPQILYFKDGEYKGKMAGDEDDEVEQMIADV. 108
67 -55.1002l6c_A mol:protein length:110 Thioredoxin  ali model follow..  24  4.IRDITTEAGMAHF--EGLSDAIVFFHKNLCPHCKNMEKVLDKFGARAPQVAISSVDSEARPELMKELGFERVPTLVFIRDGKVAKVFSGINPRELQALYAS.. 103
68 -52.6001oaz_A mol:protein length:123 THIOREDOXIN 1  ali model follow..  31  5.IIHLTDDSFDTDVLKA-DGAILVDFWAEWCGPCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDAN. 121
69 -50.7003p2a_A mol:protein length:148 Putative thioredoxin-like protein  ali model follow..  30  40.VINATAETLDKLL--QDDLPMVIDFWAPWCGPCRSFAPIFAETAAERGKVRFVKVNTEAEPALSTRFRIRSIPTIMLYRNGKMIDMLNGAPKAPFDNWLDEQ. 141
70 -50.7002av4_A mol:protein length:160 Thioredoxin-like protein 4A (DIM1)  ali model follow..  15  17LQHLNSGWAVDQAIVNEDERLVCIRFGHDYDPDCMKMDELLYKVADDIKNCVIYLVDITEVPDFNTMYELYDPVSVMFFYRNKHMMIDLGTNNNKINWPMNNKQ 122
71 -50.6001v98_A mol:protein length:140 thioredoxin  ali model follow..  34  35.VVEADEKGFAQEVAGAP--LTLVDFFAPWCGPCRLVSPILEELARDHGRLKVVKVNVDEHPGLAARYGVRSVPTLVLFRRGAPVATWVGAPRRVLEERLRPY. 136
72 -49.7001qgv_A mol:protein length:142 SPLICEOSOMAL PROTEIN U5-15KD  ali model follow..  16  5LPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTNNNKINWAMEDKQ 110
73 -49.5002ppt_A mol:protein length:155 thioredoxin-2  ali model follow..  27  48.KVAGIDPAILARAERD-DLPLLVDFWAPWCGPCRQMAPQFQAAAATLGQVRLAKIDTQAHPAVAGRHRIQGIPAFILFHKGRELARAAGAPASELVGFVRGK. 150
74 -49.0003aps_A mol:protein length:122 DnaJ homolog subfamily C member 10  ali model follow..  25  5.SIDLTPQTFNEKVLQG-KTHWVVDFYAPWCGPCQNFAPEFELLARMIGKVRAGKVDCQAYPQTCQKAGIKAYPSVKLYQYERAKKSIWEEDAKTIAALIYGK. 111
75 -48.6001x5d_A mol:protein length:133 Protein disulfide-isomerase A6  ali model follow..  24  9.VIELTDDSFDKNVLDS-EDVWMVEFYAPWCGHCKNLEPEWAAAASEVGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGTRSDIVSRALDL. 115

FFAS is supported by the NIH grant R01-GM087218-01
6 1 0 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Li Z, and Godzik A. Modeling and Analyzing Three-Dimensional Structures of Human Disease Proteins Pacific Symposium on Biocomputing 11:439-450(2006) [PDF]