current user: public




Query: 2vim_A mol:protein length:104 THIOREDOXIN, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst MRVLATAADLEKLINENKGRLIVVDFFAQWCGPCRNIAPKVEALAKEIPEVEFAKVDVDQNEEAAAKYSVTAMPTFVFIKDGKEVDRFSGANETKLRETITRHKLast
1 -70.7002vim_A mol:protein length:104 THIOREDOXIN  ali model  100  1MRVLATAADLEKLINENKGRLIVVDFFAQWCGPCRNIAPKVEALAKEIPEVEFAKVDVDQNEEAAAKYSVTAMPTFVFIKDGKEVDRFSGANETKLRETITRHK 104
2 -70.6003zzx_A mol:protein length:105 THIOREDOXIN  ali model follow..  43  2VYQVKDQEDFTKQLNEAGNKLVVIDFYATWCGPCKMIAPKLEELSQSMSDVVFLKVDVDECEDIAQDNQIACMPTFLFMKNGQKLDSLSGANYDKLLELVEKNK 105
3 -70.1004puf_C mol:protein length:117 Thioredoxin  ali model follow..  37  8VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINEL. 110
4 -70.0004pok_A mol:protein length:109 Thioredoxin  ali model follow..  38  6VKQIESKTAFQKALKAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKKKLEATINKL. 108
5 -69.9003qfa_C mol:protein length:116 Thioredoxin  ali model follow..  36  7VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPSKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINEL. 109
6 -69.7001gh2_A mol:protein length:107 THIOREDOXIN-LIKE PROTEIN  ali model follow..  32  3VKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFQFFRNKVRIDQYQGADAVGLEEKIKQH. 105
7 -69.4003kd0_A mol:protein length:105 Thioredoxin  ali model follow..  36  2VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPSKMIKPFFHSLSEKYSNVIFLEVDVDDSQDVASESEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINEL. 104
8 -69.3003m9j_A mol:protein length:105 Thioredoxin  ali model follow..  37  2VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASESEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINEL. 104
9 -69.3001cqg_A mol:protein length:105 THIOREDOXIN  ali model follow..  36  2VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPAKMIKPFFHSLSEKYSNVIFLEVDVDDAQDVASEAEVKATPTFQFFKKGQKVGEFSGANKEKLEATINEL. 104
10 -69.3003e3e_A mol:protein length:105 Thioredoxin  ali model follow..  36  2VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPSKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKRMPTFQFFKKGQKVGEFSGANKEKLEATINEL. 104
11 -69.3001erw_A mol:protein length:105 THIOREDOXIN  ali model follow..  35  2VKQIESKTAFQEALDAAGDKLVVVDFSATWSGPSKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINEL. 104
12 -67.0004j56_E mol:protein length:114 Thioredoxin  ali model follow..  38  6VKIVTSQAEFDSII--SQNELVIVDFFAEWCGPSKRIAPFYEECSKTYTKMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGANDSALKQLIEKYA 107
13 -66.5001syr_A mol:protein length:112 thioredoxin  ali model follow..  39  4VKIVTSQAEFDSII--SQNELVIVDFFAEWCGPCKRIAPFYEECSKTYTKMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGANDSALKQLIEKY. 104
14 -66.4002mmn_A mol:protein length:104 Thioredoxin  ali model follow..  38  2VKIVTSQSEFDSII--SQNELVIVDFFAEWCGPCKRIAPFYEECSKTYTKMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGANDSALKQLIEKYA 103
15 -66.2004dss_B mol:protein length:112 Thioredoxin-2  ali model follow..  39  4VTQLKSASEYDSALAS-GDKLVVVDFFATWCGPSKMIAPMIEKFAEQYSDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAIASN. 105
16 -66.2001ti3_A mol:protein length:113 thioredoxin H  ali model follow..  42  6VIACHTVDTWKEHFEKGSQKLIVVDFTASWCPPCKMIAPIFAELAKKFPNVTFLKVDVDELKAVAEEWNVEAMPTFIFLKDGKLVDKTVGADKDGLPTLVAKHA 111
17 -66.2001xwa_A mol:protein length:111 thioredoxin  ali model follow..  41  7VYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKAN. 110
18 -65.8002vm1_A mol:protein length:118 THIOREDOXIN H ISOFORM 1.  ali model follow..  39  8VIACHTKQEFDTHMANGKDKLVIIDFTASWCGPCRVIAPVFAEYAKKFPGAIFLKVDVDELKDVAEAYNVEAMPTFLFIKDGEKVDSVVGGRKDDIHTKIVAL. 112
19 -65.7002fa4_A mol:protein length:111 Thioredoxin II  ali model follow..  40  3VTQLKSASEYDSALAS-GDKLVVVDFFATWCGPCKMIAPMIEKFAEQYSDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAIASN. 104
20 -65.5001xfl_A mol:protein length:124 Thioredoxin h1  ali model follow..  41  12VIACHTVETWNEQLQKASKTLVVVDFTASWCGPCRFIAPFFADLAKKLPNVLFLKVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAKH. 116
21 -65.2002oe0_A mol:protein length:114 Thioredoxin-3  ali model follow..  39  8ITKLTNLTEFRNLIK--QNDKLVIDFYATWCGPCKMMQPHLTKLIQAYPDVRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPTALEKGIKD.. 107
22 -65.1004i8b_A mol:protein length:105 Thioredoxin  ali model follow..  48  3VLHIETDDDFDSFLKENKDKLIVVDFFATWCGPCKKIAPAFEALSADRS-ALYVKVDVDKLEETARKYDVSAMPTFIVIKNGEKVDTVVGASIENVEAAIRKHK 105
23 -65.0001r26_A mol:protein length:125 Thioredoxin  ali model follow..  34  15VVDVYSVEQFRNIMS--EDILTVAWFTAVWCGPCKTIERPMEKIAYEFPTVKFAKVDADNNSEIVSKCRVLQLPTFIIARSGKMLGHVIGANPGMLRQKLRDI. 115
24 -64.9003f3q_A mol:protein length:109 Thioredoxin-1  ali model follow..  39  2VTQFKTASEFDSAIA--QDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAIAAN. 102
25 -64.7002iwt_A mol:protein length:125 THIOREDOXIN H ISOFORM 2  ali model follow..  39  17VISVHSLEQWTMQIEEAAKKLVVIDFTASWCGPSRIMAPVFADLAKKFPNAVFLKVDVDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTAKVGLHA 122
26 -64.5004cw9_A mol:protein length:109 THIOREDOXIN  ali model follow..  44  3VLHINALDQLTALLS--TEKVIVIDFFATWCGPSRSISPYFEELAGQYNNIKFVKVDVDQAEEICVNYKVRSMPTFVLVKDGIEQKRFSGADRNALKQMVET.. 102
27 -64.4002xbi_A mol:protein length:108 THIOREDOXIN  ali model follow..  45  6LIELKQDGDLESLLEQHKNKLVVVDFFATWCGPCKTIAPLFKELSEKY-DAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIAKVEDMIKKF. 107
28 -64.1002ypm_A mol:protein length:106 LAFCA THIOREDOXIN  ali model follow..  48  2VIQVTNKDEFESILSEA-DKLVVVDFTATWCGPCKMIAPKFEELSEEYPDVVFLKVDVDEVEDVAAEYGISAMPTFQFFKNGKKVDELTGANQEKLKAMIKKHA 105
29 -63.5001ep7_A mol:protein length:112 THIOREDOXIN CH1, H-TYPE  ali model follow..  40  4VIVIDSKAAWDAQLAKGKHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGVIFLKVDVDAVAAVAEAAGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKH. 109
30 -63.3002xbq_A mol:protein length:117 THIOREDOXIN  ali model follow..  45  15LIELKQDGDLESLLEQHKNKLVVVDFFATWCGPCKTIAPLFKELSEKY-DAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIAKVEDMIKKF. 116
31 -62.9001wmj_A mol:protein length:130 Thioredoxin H-type  ali model follow..  43  16VIACHNKDEFDAQMTKAAGKVVIIDFTASWCGPCRFIAPVFAEYAKKFPGAVFLKVDVDELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTIVKH. 120
32 -62.5002diy_A mol:protein length:130 Thioredoxin-like protein 2  ali model follow..  32  20VEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRH. 122
33 -61.8003d22_A mol:protein length:139 Thioredoxin H-type  ali model follow..  33  26VHLITTKERWDQKLSEASGKIVLANFSARWCGPSRQIAPYYIELSENYPSLMFLVIDVDELSDFSASWEIKATPTFFFLRDGQQVDKLVGANKPELHKKITAI. 130
34 -61.8003d21_A mol:protein length:139 Thioredoxin H-type  ali model follow..  33  26VHLITTKERWDQKLSEASGKIVLANFSARWCGPCKQIAPYYIELSENYPSLMFLVIDVDELSDFSASWEIKATPTFFFLRDGQQVDKLVGANKPELHKKITAI. 130
35 -61.4001faa_A mol:protein length:124 THIOREDOXIN F  ali model follow..  33  24.....NKDTFWPIVKAAGDKPVVLDMFTQWCGPCKAMAPKYEKLAEEYLDVIFLKLDCNENKTLAKELGIRVVPTFKILKENSVVGEVTGAKYDKLLEAIQAAR 123
36 -61.1003d6i_A mol:protein length:112 Monothiol glutaredoxin-3  ali model follow..  25  2VIEINDQEQFTYLTTTAGDKLIVLYFHTSWAEPCKALKQVFEAISNENSNVSFLSIDADENSEISELFEISAVPYFIIIHKGTILKELSGADPKEYVSLLEDCK 108
37 -60.9003cxg_A mol:protein length:133 Putative thioredoxin  ali model follow..  23  16YIELKNTGSLNQVFSSTQNSSIVIKFGAVWCKPCNKIKEYFKNQL-NYYYVTLVDIDVDIHPKLNDQHNIKALPTFEFYFNLNNVHTVEGANQNDIEKAFQKY. 121
38 -60.3002wz9_A mol:protein length:153 GLUTAREDOXIN-3  ali model follow..  32  14VEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRH. 116
39 -60.2002yoi_A mol:protein length:106 LECA THIOREDOXIN  ali model follow..  48  2VIQVTNKEEFEAILSEA-DKLVVVDFFATWCGPCKMIAPFFEELSEEYPDVVFIKVDVDEVPDVAAKYGITSMPTFKFFKNGKKVDELVGANQEKLKQMILKH. 104
40 -58.4002j23_A mol:protein length:121 THIOREDOXIN  ali model follow..  36  11VQVISSYDQFKQVTG--GDKVVVIDFWATWCGPCKMIGPVFEKISDTPDKVGFYKVDVDEQSQIAQEVGIRAMPTFVFFKNGQKIDTVVGADPSKLQAAITQH. 113
41 -57.3001m7t_A mol:protein length:107 Chimera of Human and E. coli thioredoxin  ali model follow..  30  2VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDAQDVAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDAN. 105
42 -54.9002f51_A mol:protein length:118 thioredoxin  ali model follow..  36  6VHFNGTHEALLNRIKEA-PGLVLVDFFATWCGPCQRLGQILPSIAEANKDVTFIKVDVDKNGNAADAYGVSSIPALFFVKKEKTLDQFVGADVSRIKADIEKFK 112
43 -47.6003hhv_A mol:protein length:110 Thioredoxin (TrxA-2)  ali model follow..  30  12.....NSKNFDEFITK--NKIVVVDFWAEWCAPCLILAPVIEELANDYPQVAFGKLNTEESQDIAMRYGIMSLPTIMFFKNGELVDQILGAPREEIEVRLKSL. 108
44 -47.4002e0q_A mol:protein length:104 thioredoxin  ali model follow..  36  5.....DSKNFDSFLAS--HEIAVVDFWAEWCAPCLILAPIIEELAEDYPQVGFGKLNSDENPDIAARYGVMSLPTVIFFKDGEPVDEIIGAPREEIEIRIKNL. 101
45 -46.2002l6c_A mol:protein length:110 Thioredoxin  ali model follow..  23  1MSAIRDITTEAGMAHFEGLSDAIVFFHKNLCPHCKNMEKVLDKFGARAPQVAISSVDSEARPELMKELGFERVPTLVFIRDGKVAKVFSGINPRELQALYAS.. 103
46 -45.5004knd_A mol:protein length:112 Thioredoxin  ali model follow..  33  13.....QDSTFEQEVLKS-DTPVLVDFWAVWCGPCKAIAPVVDDLAARYKGLKVAKMDVDQHQGVPQQYGIRSIPTLLVFKGGRVVDTVIGADKTRLEDSVKKA. 110
47 -45.3004ruv_A mol:protein length:114 Thioredoxin  ali model follow..  19  3MQSIKSNESFKSVINS--DTPVIVKFEAGWCPDCRAMDLWIDPIVEQYNDYQWYTVNRDELEDVVVENEVMGIPSLLVFKNGDKIAHLHSANAKSPEQV..... 99
48 -45.3002lrc_A mol:protein length:114 Probable thioredoxin  ali model follow..  26  7.....AEAPARDELDRL-AGPTLVEFGTDWCGHCQAAQPLLAEVFSDYPEVGHLKVEDGPGRRLGRSFQVKLWPTFVFLRDGREVARVVRPSASVLEEAFESL. 104
49 -45.0002mcs_A mol:protein length:128 Thioredoxin  ali model follow..  33  17IEQIGDSEFDNKVTSCNDNILILVDFWAPWCGPCRSLEPQLEKLAQQYTEVKIYKINIEDNQDVATQYGVSAIPTILMFKNGKKLSQVIGAISKIISEINNN.. 120
50 -44.8001uvz_A mol:protein length:119 THIOREDOXIN  ali model follow..  33  8TFNIQDGPDFQDRVVNS-ETPVVVDFHAQWCGPCKILGPRLEKMVAKQHKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIDEDQLEAFLKKL. 111
51 -44.7003tco_A mol:protein length:109 Thioredoxin (TrxA-1)  ali model follow..  31  10.....TEENFDEVIRN--NKLVLVDCWAEWCAPCHLYEPIYKKVAEKYKKAVFGRLNVDENQKIADKYSVLNIPTTLIFVNGQLVDSLVGADEDTLESTVNKY. 107
52 -44.7002cvk_A mol:protein length:110 Thioredoxin  ali model follow..  37  8.....TDQNFDETLGQ--HPLVLVDFWAEWCAPCRMIAPILEEIAKEYEGLLVAKLDVDENPKTAMRYRVMSIPTVILFKDGQPVEVLVGAPKRNYQAKIEKH. 105
53 -44.3002ynx_A mol:protein length:106 LACA THIOREDOXIN  ali model follow..  45  7.....NDENFDEVIKKN-NKVVVVDFWAEWCGPCRMIAPIIEELAKEYAGVVFGKLNVDENPEIAAKYGIMSIPTLLFFKNGKVVDQLVGAPKEALKERIKKY. 105
54 -44.2003ziv_A mol:protein length:106 AECA THIOREDOXIN  ali model follow..  44  7.....NDENFDEVIKKS-DKVVVVDFWAEWCGPCRMIAPIIEELAEEYAGVVFGKVNVDENPEIAAKYGIMSIPTLLFFKNGKVVDQLVGAPKEALKERIKKY. 105
55 -44.1002voc_A mol:protein length:112 THIOREDOXIN  ali model follow..  38  13..............AETSEGVVLADFWAPWCGPSKMIAPVLEELDQEMGDLKIVKIDVDENQETAGKYGVMSIPTLLVLKDGEVVETSVGFPKEALQELVNKH. 103
56 -44.0002o89_A mol:protein length:107 Thioredoxin  ali model follow..  38  10.....TDADFDSKVESG---VQLVDFWATWCGTSKMIAPVLEELAADYEGADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFPKENLAEVLDKH. 106
57 -44.0004xhm_A mol:protein length:137 Thioredoxin (Trx-3)  ali model follow..  38  39.....NSSNFDETLKN--NENVVVDFWAEWCHPCKMIAPVIEELAKEYAKVVFGKLNTDENPTIAARYGISAIPTLIFFKKGKPVDQLVGAPKSELKRWVQRN. 136
58 -44.0002o7k_A mol:protein length:107 Thioredoxin  ali model follow..  40  10.....TDADFDSKVESG---VQLVDFWATWCGPCKMIAPVLEELAADYEGADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFPKENLAEVLDKH. 106
59 -43.8004cdo_A mol:protein length:185 THIOREDOXIN-LIKE PROTEIN 4A, POLYGLUTAMINE-BI  ali model follow..  15  4LPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDK 108
60 -43.7003gnj_A mol:protein length:111 Thioredoxin domain protein  ali model follow..  23  10.....DTNTFEQLIYDE-GKACLVMFSRKNCHVCQKVTPVLEELRLNYEEFGFYYVDVEEEKTLFQRFSLKGVPQILYFKDGEYKGKMAGDEDDEVEQMIADV. 108
61 -43.5001nsw_A mol:protein length:105 THIOREDOXIN  ali model follow..  31  6.....TDANFQQAIQ--GDGPVLVDFWAAWCGPCRMMAPVLEEFAEAHADVTVAKLNVDENPETTSQFGIMSIPTLILFKGGRPVKQLIGYPKEQLEAQLADV. 103
62 -43.5003hz4_A mol:protein length:140 Thioredoxin  ali model follow..  24  12.....EDMTWSQQVEDS-KKPVVVMFYSPACPYCKAMEPYFEEYAKEYGSAVFGRINIATNPWTAEKYGVQGTPTFKFFCHGRPVWEQVGQYPSILKNAVRDM. 110
63 -43.4004wxt_A mol:protein length:125 Thioredoxin  ali model follow..  34  16.....SDASFSTDVLAS-NKPVLVDFWATWCGPCKMVAPVLEEIASERGDLTVAKLDVDANPETAQNFQVVSIPTLILFKDGQPVKRIVGAGKAALLRELSDA. 114
64 -43.4001nw2_A mol:protein length:105 THIOREDOXIN  ali model follow..  31  6.....TDANFQQAIQ--GDKPVLVDFWAAWCGPCRMMAPVLEEFAEAHADVTVAKLNVDENPETTSQFGIMSIPTLILFKGGEPVKQLIGYPKEQLEAQLADV. 103
65 -43.3002dj0_A mol:protein length:137 Thioredoxin-related transmembrane protein 2  ali model follow..  25  13.....NDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNGLNFGKVDVGRYTDVSTRYKVSTLPTLILFQGGKEAMRRPQIDKKG......... 110
66 -43.2003jcm_L mol:protein length:143 Spliceosomal protein DIB1  ali model follow..  19  6LPQLRTGWHVDQAIVTETKRLVVIRFGRKNDRQCMIMDELLSSIAERVRNAVIYLCDIDEVSDFDEMYELTDPMTVMFFYHNKHMMCDFGTNNNKLNFIVDDKQ 111
67 -43.1004ba7_A mol:protein length:106 LBCA THIOREDOXIN  ali model follow..  43  7.....NDENFEEEVLKS-DKPVLVDFWAPWCGPCRMIAPIIEELAEEYEGVKFAKVNVDENPETAAKYGIMSIPTLLLFKNGEVVDKLVGAPKEALKERIEKH. 105
68 -43.0002l5l_A mol:protein length:136 Thioredoxin  ali model follow..  25  20LAKVYNFEKNPEEWKYEGDKPAIVDFYADWCGPCKMVAPILDELAKEYDQIVIYKVDTEKEQELAGAFGIRSIPSILFIPMEGKPEMAQGAPKASFKKAIDEF. 124
69 -43.0002av4_A mol:protein length:160 Thioredoxin-like protein 4A (DIM1)  ali model follow..  15  17LQHLNSGWAVDQAIVNEDERLVCIRFGHDYDPDCMKMDELLYKVADDIKNCVIYLVDITEVPDFNTMYELYDPVSVMFFYRNKHMMIDLGTNNNKINWPMNNKQ 122
70 -43.0002puk_C mol:protein length:106 Thioredoxin M-type, chloroplast (TRX-M)  ali model follow..  29  6.....NDSSWKEFVLES-EVPVMVDFWAPWCGPSKLIAPVIDELAKEYSKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAPKSTLTDSIEKY. 104
71 -42.9002yj7_A mol:protein length:106 LPBCA THIOREDOXIN  ali model follow..  42  7.....TDENFEQEVLKS-DKPVLVDFWAPWCGPCRMIAPIIEELAKEYEGVKVVKVNVDENPNTAAQYGIRSIPTLLLFKNGQVVDRLVGAPKEALKERIDKH. 105
72 -42.9001dby_A mol:protein length:107 CHLOROPLAST THIOREDOXIN M CH2  ali model follow..  29  7.....NDDTFKNVVLES-SVPVLVDFWAPWCGPCRIIAPVVDEIAGEYKDLKCVKLNTDESPNVASEYGIRSIPTIMVFKGGKKCETIIGAPKATIVQTVEKY. 105
73 -42.9004pob_A mol:protein length:117 Thioredoxin  ali model follow..  33  12.....TDDSFQEDVVSS-NKPVLVDFWATWCGPCKMVAPVLEEIAKDHGELTIAKLDVDANPETARAFQVTSIPTLILFQNGEATKRIVGASKSALLRELDGV. 110
74 -42.8002i1u_A mol:protein length:121 Thioredoxin  ali model follow..  35  18.....TDASFATDVLSS-NKPVLVDFWATWCGPCKMVAPVLEEIATERATLTVAKLDVDTNPETARNFQVVSIPTLILFKDGQPVKRIVGAGKAALLRELSDV. 116
75 -42.8003vfi_A mol:protein length:104 thioredoxin  ali model follow..  25  5.....SDSDFQLEVRQH-PDPIIIMFTGSWCQPCKKMKPTFEEMASQMEDIRFAYMDAEDAEKTMAELNIRTLPSLALFVDGMIREVFSGTNKSDLRYWINNN. 103

FFAS is supported by the NIH grant R01-GM087218-01
8 2 8 1 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.