current user: public




Query: 2vgx_A mol:protein length:148 CHAPERONE SYCD, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst GPLGSGGGTIAMLNEISSDTLEQLYSLAFNQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYSYGAVMDIKEPRFPFHAAECLLQKGELAEAESGLFLAQELIANKPEFKELSTRVSSMLEAIKLKKEMKHELast
1 -79.6002vgx_A mol:protein length:148 CHAPERONE SYCD  ali model  100  1GPLGSGGGTIAMLNEISSDTLEQLYSLAFNQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYSYGAVMDIKEPRFPFHAAECLLQKGELAEAESGLFLAQELIANKPEFKELSTRVSSMLEAIKLKKEMKHE 148
2 -79.2002vgy_A mol:protein length:148 CHAPERONE SYCD  ali model follow..  98  1GPLGSGGGTIAMLNEISSDTLEQLYSLAFNQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYEEGAVMDIKEPRFPFHAAECLLQKGELAEAESGLFLAQELIANKPEFKELSTRVSSMLEAIKLKKEMKHE 148
3 -73.8003wxx_A mol:protein length:151 AcrH  ali model follow..  67  6EAFLQDGGTLAMLNDVSTDTLEQLYTLGFNQYHAGKHDEAHKIFQALCVLDHYEARFFLGLGACRQALGQFRLAIDSYSYGAMMDLQEPRFPFHAAECLLQLGELEGAESGFHSAQLLAAAKPELAELAARAGIMLEVVKTKKDME.. 151
4 -69.8002xcb_A mol:protein length:142 REGULATORY PROTEIN PCRH  ali model follow..  62  2....SDGGTLAMLRGLSEDTLEQLYALGFNQYQAGKWDDAQKIFQALCMLDHYDARYFLGLGACRQSLGLYEQALQSYSYGALMDINEPRFPFHAAECHLQLGDLDGAESGFYSARALAAAQPAHEALAARAGAMLEAVTARKDR... 142
5 -63.3003ks2_A mol:protein length:151 Chaperone protein ipgC  ali model follow..  26  13.DAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSNDEK----LKIKAQSYLDAIQDIKE.... 151
6 -63.1004nrh_B mol:protein length:178 Chaperone SycD  ali model follow..  27  40PDKNIALDTYQKIFKISSEDLEKVYKEGYHAYLDKDYAKSITVFRWLVFFNPFVSKFWFSLGASLHMSEQYSQALHAYGVTAVLRDKDPYPHYYAYICYTLTNEHEEAEKALEMAWVRAQHKPLYNELKEEILDIRK........... 176
7 -62.1003gyz_A mol:protein length:151 Chaperone protein ipgC  ali model follow..  25  17.DAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSNDEK----LKIKAQSYLDAIQ........ 151
8 -52.0002fo7_A mol:protein length:136 SYNTHETIC CONSENSUS TPR PROTEIN  ali model follow..  22  15GDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS.......................... 136
9 -50.1003asd_A mol:protein length:200 MamA  ali model follow..  13  22GRYSQAVMLLEQVYDADAFDVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALDNLGRFDEAIDSFKIALGL---RPNEGKVHRAIAFSYEQMGRHEEALPH 166
10 -50.1004xi0_A mol:protein length:202 Magnetosome protein MamA  ali model follow..  16  21GSPEEALRYLKEWARHEKNDPEPLYQMGIALANLGDYQRAVTVFDKVLKLRPNHFMASYRKGAVLLKIKQYKLALPVLEAVVAAAPADARAYYLLGLAYDGDEQLEKGIEAMQKAVDL---DPEEIKYHQHLGFMNVRKDDHKTAAEH 165
11 -49.6003as8_A mol:protein length:186 Magnetosome protein MamA  ali model follow..  14  22GRYSEAVVMLEQVYDADAFDVEVALHLGIAYVKTGAVDRGTELLERSIADAPDNIKVATVLGLTYVQVQKYDLAVPLLVKVAEANPVNFNVRFRLGVALDNLGRFDEAIDSFKIALGL---RPNEGKVHRAIAYSYEQMGSHEEALPH 166
12 -49.3003vtx_A mol:protein length:184 MamA  ali model follow..  15  19GDFDGAIRAYKKVLKADPNNVETLLKLGKTYMDIGLPNDAIESLKKFVVLDTTSAEAYYILGSANFMIDEKQAAIDALQRAIALNTVYADAYYKLGLVYDSMGEHDKAIEAYEKTISI---KPGFIRAYQSIGLAYEGKGLRDEAVKY 163
13 -49.3003asg_A mol:protein length:186 MamA  ali model follow..  13  22GRYSQAVMLLEQVYDADAFDVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALKNLGRFDEAIDSFKIALGL---RPNEGKVHRAIAFSYEQMGRHEEALPH 166
14 -48.1001na0_A mol:protein length:125 designed protein CTPR3  ali model follow..  21  2..............AMDPGNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALEL---DPNNAEAKQNLGNAKQKQG........ 125
15 -47.8003kd7_A mol:protein length:125 CTPR390  ali model follow..  18  2..............AMDPGNAEAWKNLGNAYYKQGDYQKAIEYYQKALELDPNNASAWYNLGNAYYKQGDYQKAIEYYQKALELDPNNAKAWYRRGNAYYKQGDYQKAIEDYQKALEL---DPNNAKAKQNLGNAKQKQG........ 125
16 -47.7002q7f_A mol:protein length:243 YrrB protein  ali model follow..  13  31GDYEKAAEAFTKAIEENKEDAIPYINFANLLSSVNELERALAFYDKALELDSSAATAYYGAGNVYVVKEMYKEAKDMFEKALRAGMENGDLFYMLGTVLVKLEQPKLALPYLQRAVEL---NENDTEARFQFGMCLANEGMLDEALSQ 175
17 -46.6002wqh_A mol:protein length:125 CTPR3Y3  ali model follow..  20  6.................GNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALEL---YPNNAEAKQNLGNAKQKQG........ 125
18 -46.0001hxi_A mol:protein length:121 PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5  ali model follow..  14  1....QNNTDYPFEANNPYMYHENPMEEGLSMLKLANLAEAALAFEAVCQKEPEREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLLS---QPQYEQL.................... 121
19 -45.0004j8d_A mol:protein length:175 Hsc70-interacting protein  ali model follow..  13  21DAPQEMGDENAEITEAMMDEANEKKGAAIDALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAARDLALACKLDYDE-DASAMLREVQPRAQKIAEHRRKYE. 166
20 -44.5002pl2_A mol:protein length:217 Hypothetical conserved protein TTC0263  ali model follow..  18  19GRYDAALTLFERALKENPQDPEALYWLARTQLKLGLVNPALENGKTLVARTPRYLGGYMVLSEAYVALGYLEQALSVLKDAERVNPRYAPLHLQRGLVYALLGERDKAEASLKQALALEDTAPKDLDLRVRYASALLLKGKAEEAARA 207
21 -43.9004r7s_A mol:protein length:257 Tetratricopeptide repeat protein  ali model follow..  15  89GETEKALNDYNTLLIENPEHQEALYCRGLLYIQLQNYMWAEQDFDKILEVNEKSVRARLGHAILEKMRGNYDESERIFNYLISEMPRDWILYEGRADLYFMMGKNARAMADIEKVFTE---SEPTANLYVLRGKIKLAQYEKERAALD 233
22 -43.5003urz_A mol:protein length:208 Uncharacterized protein  ali model follow..  11  68RNYDKAYLFYKELLQKAPNNVDCLEACAEMQVCRGQEKDALRMYEKILQLEADNLAANIFLGNYYYLTAEEKKKLETDYKKLSSPTKMQYARYRDGLSKLFTTRYEKARNSLQKVILRFPSTE--------AQKTLDKILRIEKEVNR 208
23 -43.3004gcn_A mol:protein length:127 Protein STI-1  ali model follow..  11  2..............NAMTDAAIAEKDLGNAAYKQKDFEKAHVHYDKAIELDPSNITFYNNKAAVYFEEKKFAECVQFCEKAVEVGRETAKAMSRAGNAFQKQNDLSLAVQWFHRSLSEFRDPELVKKVKELEK............... 127
24 -43.3001w3b_A mol:protein length:388 UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUC  ali model follow..  15  13GDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQY---NPDLYCVRSDLGNLLKALGRLEEAKAC 157
25 -43.3003cv0_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  12  152NEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGGTTTRSMWDFFRMLLNVMNRPDLVEL. 307
26 -43.2003cvq_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  12  152NEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGGTTTRSMWDFFRMLLNVMNRPDLVEL. 307
27 -43.2002kat_A mol:protein length:115 uncharacterized protein  ali model follow..  11  1....................................MQAITERLEAMLAQGTDNMLLRFTLGKTYAEHEQFDAALPHLRAALDFDPTYSVAWKWLGKTLQGQGDRAGARQAWESGLAAAQSRGD-QQVVKELQVFLRRLAREDALE.. 109
28 -42.6003uq3_A mol:protein length:258 Heat shock protein STI1  ali model follow..  13  119RNAEKELKKAEAEAYVNPEKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTK---DAEVNNGSSAREIDQLYYKASQ..... 258
29 -42.2001wm5_A mol:protein length:208 Neutrophil cytosol factor 2  ali model follow..  13  2...........AMGSMSLVEAISLWNEGVLAADKKDWKGALDAFSAVQ---DPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNLFACEVLYNIAFMYAKKEEWKKAEEQ 148
30 -42.1005dse_A mol:protein length:837 Tetratricopeptide repeat protein 7B  ali model follow..  16  704GKPAEATACTQEAANLFPMSHNVLYMRGQIAELRGSMDEARRWYEEALAISPTHVKSMQRLALILHQLGRYSLAEKILRDAVQVNSTAHEVWNGLGEVLQAQGNDAAATECFLTALELEASSP......................... 826
31 -41.9003r9a_B mol:protein length:328 Peroxisomal targeting signal 1 receptor  ali model follow..  13  155SLFLEVKELFLAAVRLDPTSIDPQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGSENIWSTLRLALSMLGQSDAYGA. 311
32 -41.8002vyi_A mol:protein length:131 SGTA PROTEIN  ali model follow..  17  3...........LGSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPAYSKAYGRMGLALSSLNKHVEAVAYYKKALELDPDNETYKSNLKIAELKLRE.......... 129
33 -41.8002lni_A mol:protein length:133 Stress-induced-phosphoprotein 1  ali model follow..  14  4..............HMNPDLALMVKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYN.......... 127
34 -41.6004ga2_A mol:protein length:150 E3 SUMO-PROTEIN LIGASE RANBP2  ali model follow..  12  11ADVERYIASVQGSTPSPRQKSIKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTDKAVECYRRSVELNPTQKDLVLKIAELLCKNDVTDGRAKYVERAAKL---FPGSPAVYKLKEQLLDCEGED...... 150
35 -41.5002kck_A mol:protein length:112 TPR repeat  ali model follow..  22  1...............MVDQNPEEYYLEGVLQYDAGNYTESIDLFEKAIQLDPEESKYWLMKGKALYNLERYEEAVDCYNYVINVIEDNKDVWAAKADALRYIGKEVEAEIAEARAK................................ 104
36 -41.3004ga0_A mol:protein length:150 E3 SUMO-protein ligase RanBP2  ali model follow..  13  11ADVERYIASVQGSTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTDKAVECYRRSVELNPTQKDLVLKIAELLCKNDVTDGRAKYLERAAKL---FPGSPAIYKLKEQLLDCEGED...... 150
37 -41.3004cgv_A mol:protein length:136 RNA POLYMERASE II-ASSOCIATED PROTEIN 3  ali model follow..  13  4..........EDGIHVDSQKALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVLELEPNNFEATNELRKISQALASKEN....... 134
38 -41.3003hym_B mol:protein length:330 Cell division cycle protein 16 homolog  ali model follow..  12  173NNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGL---RRDDTFSVTMLGHCIEMYIGDSEAYIG 326
39 -41.2003fp2_A mol:protein length:537 TPR repeat-containing protein YHR117W  ali model follow..  17  1GSHMNGEPDIAQLKGLSPSQAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNKQAMKVLNENLSK 152
40 -41.2001xnf_A mol:protein length:275 Lipoprotein nlpI  ali model follow..  14  19LQQEVILARMEQILATDDERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYLGIYLTQAGNFDAAYEAFDSVLELDPTYNYAHLNRGIALYYGGRDKLAQDDLLAFYQDDPNDPFRSLWLYLAEQKLDEKQAKEVLKQH 170
41 -41.1004ga1_A mol:protein length:150 E3 SUMO-PROTEIN LIGASE RANBP2  ali model follow..  12  11ADVERYIASVQGSTPSPRQKSMKGFYFAKLYMEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTDKAVECYRRSVELNPMQKDLVLKIAELLCKNDVTDGAKYWVERAAKL---FPGSPAVYKLKEQLLDCEGE....... 149
42 -41.1004gco_A mol:protein length:126 Protein STI-1  ali model follow..  15  1........SNARLAYINPELAQEEKNKGNEYFKKGDYPTAMRHYNEAVKRDPENAILYSNRAACLTKLMEFQRALDDCDTCIRLDSKFIKGYIRKAACLVAMREWSKAQRAYEDALQVDPSNEEAREGVRNCLR.............. 126
43 -41.0004uzy_A mol:protein length:651 FLAGELLAR ASSOCIATED PROTEIN  ali model follow..  12  31QKFAEAIQHLQYQLQNVPESRAALSLLGYCYYYTGQYDMASQMYEQLVTLYPSNEDYKLYYAQSLYKGGMYPEASKCRRQLDKCAPEDPDTMVNTGCIMFKEGKFEAARQKFNDAVQA---LGYQPELLYNIALCYYKTKQFGPALK. 202
44 -41.0005aio_A mol:protein length:448 TRANSCRIPTION FACTOR TAU 131 KDA SUBUNIT  ali model follow..  11  24NDLQVAERLFNEVIKKDARNFAAYETLGDIYQLQGRLNDCCNSWFLAAHLNASDWEFWKIVAILSADLDHVRQAIYCFSRVISLNPMEWESIYRRSMLYKKTGQLARALDGFQRLYMY---NPYDANILRELAILYVDYDRIEDSIE. 167
45 -40.8002ho1_A mol:protein length:252 Type 4 fimbrial biogenesis protein PilF  ali model follow..  12  45GNTEQAKVPLRKALEIDPSSADAHAALAVVFQTEMEPKLADEEYRKALASDSRNARVLNNYGGFLYEQKRYEEAYQRLLEASQLYPERSRVFENLGLVSLQMKKPAQAKEYFEKSLRL---NRNQPSVALEMADLLYKEREYVPARQ. 190
46 -40.8001na3_A mol:protein length:91 designed protein CTPR2  ali model follow..  23  6.................GNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAKQNLGNAKQKQG............................................. 91
47 -40.4001fch_A mol:protein length:368 PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR  ali model follow..  13  195SLFLEVKELFLAAVRLDPTSIDPQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGSENIWSTLRLALSMLGQSDAYGA. 351
48 -40.3002vq2_A mol:protein length:225 PUTATIVE FIMBRIAL BIOGENESIS AND TWITCHING MO  ali model follow..  22QDYRQATASIEDALKSDPKNELAWLVRAEIYQYLKVNDKAQESFRQALSIKPDSAEINNNYGWFLGRLNRPAESMAYFDKALATYPTPYIANLNKGICSAKQGQFGLAEAYLKRSLAA---QPQFPPAFKELARTKMLAGQLGDADY. 168
49 -40.1001a17_A mol:protein length:166 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model follow..  12  9................ALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGD 140
50 -40.0005a31_C mol:protein length:597 CELL DIVISION CYCLE PROTEIN 23 HOMOLOG  ali model follow..  11  345SQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAV---GDVEKMALVKLAKLHEQLTESEQAAQ. 488
51 -39.9004rg6_A mol:protein length:560 Cell division cycle protein 27 homolog  ali model follow..  12  317REHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVI---DPKNPLCKFHRASVLFANEKYKSALQE 461
52 -39.9004ui9_F mol:protein length:824 CELL DIVISION CYCLE PROTEIN 27 HOMOLOG  ali model follow..  12  581REHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVI---DPKNPLCKFHRASVLFANEKYKSALQE 725
53 -39.7002bug_A mol:protein length:140 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model follow..  13  11................ALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALNDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQ.......... 132
54 -39.7003fwv_A mol:protein length:128 Hsc70/Hsp90-organizing protein  ali model follow..  10  1.................SKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYIVNQAAVYFEKGDYNKCRELCEKAIEVGRENAYAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPKVLKKCQQAEKILKEQ.......... 128
55 -39.7002fi7_A mol:protein length:265 type 4 fimbrial biogenesis protein PilF  ali model follow..  12  58GNTEQAKVPLRKALEIDPSSADAHAALAVVFQTEMEPKLADEEYRKALASDSRNARVLNNYGGFLYEQKRYEEAYQRLLEASQLYPERSRVFENLGLVSLQMKKPAQAKEYFEKSLRL---NRNQPSVALEMADLLYKEREYVPARQ. 203
56 -39.6001hh8_A mol:protein length:213 NEUTROPHIL CYTOSOL FACTOR 2  ali model follow..  13  1...............MSLVEAISLWNEGVLAADKKDWKGALDAFSAVQ---DPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNLFACEVLYNIAFMYAKKEEWKKAEEQ 143
57 -39.6001elw_A mol:protein length:118 TPR1-DOMAIN OF HOP  ali model follow..  16  2..................EQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEA.............. 117
58 -39.6002hr2_A mol:protein length:159 Hypothetical protein  ali model follow..  18  1............GMKPLKEVVGAYLALAQRQLVAGEYDEAAANCRRAMEISHTDAFCHAGLAEALAGLRSFDEALHSADKALHYFNRRGEAVYSRALALDGLGRGAEAMPEFKKVVEM---IEERKGETPGKERMMEVAIDRIAQLGA 158
59 -39.5003q47_B mol:protein length:137 STIP1 homology and U box-containing protein 1  ali model follow..  14  5................KSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEER 136
60 -39.3004kbq_A mol:protein length:139 E3 ubiquitin-protein ligase CHIP  ali model follow..  14  7................KSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEER 138
61 -38.9003upv_A mol:protein length:126 Heat shock protein STI1  ali model follow..  15  1.................SMKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQLYYKASQQR...... 125
62 -38.8003u4t_A mol:protein length:272 TPR repeat-containing protein  ali model follow..  13  55.LAQKDIETYFSKVNATKAKSADFEYYGKILMKKGQDSLAIQQYQAAVDRDTTRLDMYGQIGSYFYNKGNFPLAIQYMEKQIRPTTTDPKVFYELGQAYYYNKEYVKADSSFVKVLELKPNIYIGYLWRARANAAQDPDTKQGLAKPY 201
63 -38.7004i17_A mol:protein length:228 hypothetical protein  ali model follow..  1..............GAQTTDPNQLKNEGNDALNAKNYAVAFEKYSEYLKLTNNDSVTAYNCGVCADNIKKYKEAADYFDIAIKKNYNLANAYIGKSAAYRDMKNNQEYIATLTEGIKAVPGNATYAIYYLKEGQKFQQAGNIEKAEEN 139
64 -38.5004ui9_J mol:protein length:620 CELL DIVISION CYCLE PROTEIN 16 HOMOLOG  ali model follow..  12  382NNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGL---RRDDTFSVTMLGHCIEMYIGDSEA... 532
65 -38.3004cgu_A mol:protein length:112 TPR REPEAT-CONTAINING PROTEIN ASSOCIATED WITH  ali model follow..  12  3..................SQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSK-LQYRLELAQGAVGSVQIPVVEVDELPE........................ 107
66 -38.1005a31_X mol:protein length:599 ANAPHASE-PROMOTING COMPLEX SUBUNIT 7  ali model follow..  11  285GDNKNSVLKFEQAQMLDPYLIKGMDVYGYLLAREGRLEDVENLGCRLFNISDQHAEPWVVSGCHSFYSKRYSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAIRL---APCRLDCYEGLIECYLASNSIREAMV. 428
67 -38.1004kvm_A mol:protein length:734 N-terminal acetyltransferase A complex subuni  ali model follow..  11  24KQYKKGLKAIEPLLERHPEHGESLAIKGILLHSLGNTKEGYDNVRLGLRNDVGSGVCWHIFGLISRADKDYVQAAKCYINAHKLEKNNSSLLRDLALLQSQLRQYKALADTRNALLQD---NPGVRANWSALAVAQFLRGEYASAYK. 167
68 -37.9002gw1_A mol:protein length:514 Mitochondrial precursor proteins import recep  ali model follow..  13  251NDPLGAHEDIKKAIELFPR-VNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRK---FPEAPEVPNFFAEILTDKNDFDKALKQ 394
69 -37.9004eqf_A mol:protein length:365 PEX5-related protein  ali model follow..  14  181RRMSKSPVDSSVLEGVKELDPDLQTGLGVLFHLSGEFNRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREAVSNFLTALSLQRKSRNSGNIWAALRIALSLMDQPELFQA. 348
70 -37.8004cgw_A mol:protein length:117 RNA POLYMERASE II-ASSOCIATED PROTEIN 3  ali model follow..  13  14................NKQQAISEKDRGNGFFKEGKYERAIECYTRGIAADGANALLPANRAMAYLKIQKYEEAEKDCTQAILLDGSYSKAFARRGTARTFLGKLNEAKQDFETVLLLEP............................ 117
71 -37.6001zu2_A mol:protein length:158 Mitochondrial import receptor subunit TOM20-3  ali model follow..  11  3.....................LGSMDTETEFDRILLFEQIRQDAENTYKSNPLDADNLTRWGGVLLELSQIQEAITKFEEALLIDPKKDEAVWCIGNAYTSFAFFDLATQFFQQAVDE---QPDNTHYLKSLEMTAKAPQLHAEAYKQ 147
72 -37.6004XNH Entity 1(prereleased)  ali follow..  10  34KQYKKSLKLLDAILKKDGSHVDSLALKGLDLYSVGEKDDAASYVANAIRKASASPICCHVLGIYMRNTKEYKESIKWFTAALNNGSTNKQIYRDLATLQSQIGDFKNALVSRKKYWEA---FLGYRANWTSLAVAQDVNGERQQAIN. 180
73 -37.4001elr_A mol:protein length:131 TPR2A-DOMAIN OF HOP  ali model follow..  1.................GKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQ.......... 128
74 -37.0004hou_A mol:protein length:273 Interferon-induced protein with tetratricopep  ali model follow..  13  149KNYERAKACFEKVLEVDPENPESSAGYAISAYRKNHKPFSLLPLRQAVRLNPDNGYIKVLLALKLQDEGQEAEGEKYIEEALANMSSQTYVFRYAAKFYRRKGSVDKALELLKKALQ............................... 273
75 -36.9004hnw_A mol:protein length:863 N-terminal acetyltransferase A complex subuni  ali model follow..  10  34KQYKKSLKLLDAILKKDGSHVDSLALKGLDLYSVGEKDDAASYVANAIRKASASPICCHVLGIYMRNTKEYKESIKWFTAALNNGSTNKQIYRDLATLQSQIGDFKNALVSRKKYWEA---FLGYRANWTSLAVAQDVNGERQQAIN. 180

FFAS is supported by the NIH grant R01-GM087218-01
8 5 8 8 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.