current user: public




2vgxA
Query: 2vgx_A mol:protein length:148 CHAPERONE SYCD, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst GPLGSGGGTIAMLNEISSDTLEQLYSLAFNQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYSYGAVMDIKEPRFPFHAAECLLQKGELAEAESGLFLAQELIANKPEFKELSTRVSSMLEAIKLKKEMKHELast
1 -73.9002vgx_A mol:protein length:148 CHAPERONE SYCD  ali model  100  1GPLGSGGGTIAMLNEISSDTLEQLYSLAFNQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYSYGAVMDIKEPRFPFHAAECLLQKGELAEAESGLFLAQELIANKPEFKELSTRVSSMLEAIKLKKEMKHE 148
2 -73.7002vgy_A mol:protein length:148 CHAPERONE SYCD  ali model follow..  98  1GPLGSGGGTIAMLNEISSDTLEQLYSLAFNQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYEEGAVMDIKEPRFPFHAAECLLQKGELAEAESGLFLAQELIANKPEFKELSTRVSSMLEAIKLKKEMKHE 148
3 -66.8002xcb_A mol:protein length:142 REGULATORY PROTEIN PCRH  ali model follow..  62  1G---SDGGTLAMLRGLSEDTLEQLYALGFNQYQAGKWDDAQKIFQALCMLDHYDARYFLGLGACRQSLGLYEQALQSYSYGALMDINEPRFPFHAAECHLQLGDLDGAESGFYSARALAAAQPAHEALAARAGAMLEAVTARKDR... 142
4 -59.6003ks2_A mol:protein length:151 Chaperone protein ipgC  ali model follow..  26  13.DAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSNDE----KLKIKAQSYLDAIQDIKE.... 151
5 -57.3003gyz_A mol:protein length:151 Chaperone protein ipgC  ali model follow..  25  17.DAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSNDEK----LKIKAQSYLDAIQ........ 151
6 -55.6002fo7_A mol:protein length:136 SYNTHETIC CONSENSUS TPR PROTEIN  ali model follow..  22  15GDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS.......................... 136
7 -53.1003asg_A mol:protein length:186 MamA  ali model follow..  13  22GRYSQAVMLLEQVYDADAFDVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALKNLGRFDEAIDSFKIALGL---RPNEGKVHRAIAFSYEQMGRHEEALPH 166
8 -53.0003as8_A mol:protein length:186 Magnetosome protein MamA  ali model follow..  14  22GRYSEAVVMLEQVYDADAFDVEVALHLGIAYVKTGAVDRGTELLERSIADAPDNIKVATVLGLTYVQVQKYDLAVPLLVKVAEANPVNFNVRFRLGVALDNLGRFDEAIDSFKIALGL---RPNEGKVHRAIAYSYEQMGSHEEALPH 166
9 -52.8003asd_A mol:protein length:200 MamA  ali model follow..  13  22GRYSQAVMLLEQVYDADAFDVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALDNLGRFDEAIDSFKIALGL---RPNEGKVHRAIAFSYEQMGRHEEALP. 165
10 -51.5001na0_A mol:protein length:125 designed protein CTPR3  ali model follow..  21  2..............AMDPNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALEL---DPNNAEAKQNLGNAKQKQG........ 125
11 -51.5001hxi_A mol:protein length:121 PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5  ali model follow..  14  1....QNNTDYPFEANNPYMYHENPMEEGLSMLKLANLAEAALAFEAVCQKEPEREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLLS---QPQYEQL.................... 121
12 -51.4003kd7_A mol:protein length:125 CTPR390  ali model follow..  18  2..............AMDPGNAEAWKNLGNAYYKQGDYQKAIEYYQKALELDPNNASAWYNLGNAYYKQGDYQKAIEYYQKALELDPNNAKAWYRRGNAYYKQGDYQKAIEDYQKALEL---DPNNAKAKQNLGNAKQKQG........ 125
13 -51.1002q7f_A mol:protein length:243 YrrB protein  ali model follow..  13  31GDYEKAAEAFTKAIEENKEDAIPYINFANLLSSVNELERALAFYDKALELDSSAATAYYGAGNVYVVKEMYKEAKDMFEKALRAGMENGDLFYMLGTVLVKLEQPKLALPYLQRAVEL---NENDTEARFQFGMCLANEGMLDEALSQ 175
14 -51.0002wqh_A mol:protein length:125 CTPR3Y3  ali model follow..  20  6.................GNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALEL---YPNNAEAKQNLGNAKQKQG........ 125
15 -50.2002vyi_A mol:protein length:131 SGTA PROTEIN  ali model follow..  16  2..........PLGSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPAYSKAYGRMGLALSSLNKHVEAVAYYKKALEL---DPDNETYKSNLKIAELKLREA...... 130
16 -49.2002lni_A mol:protein length:133 Stress-induced-phosphoprotein 1  ali model follow..  15  2............GSHMNPDLALMVKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDL---DSSCKEAADGYQRCMMAQYN....... 127
17 -47.5002pl2_A mol:protein length:217 Hypothetical conserved protein TTC0263  ali model follow..  18  19GRYDAALTLFERALKENPQDPEALYWLARTQLKLGLVNPALENGKTLVARTPRYLGGYMVLSEAYVALGYLEQALSVLKDAERVNPRYAPLHLQRGLVYALLGERDKAEASLKQALALEDTAPKDLDLRVRYASALLLKGKAEEAAR. 206
18 -46.8003cvq_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  12  152NEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGGTTTRSMWDFFRMLLNVMNRPDLVEL. 307
19 -46.7003cv0_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  12  152NEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGGTTTRSMWDFFRMLLNVMNRPDLVEL. 307
20 -46.7003r9a_B mol:protein length:328 Peroxisomal targeting signal 1 receptor  ali model follow..  13  155SLFLEVKELFLAAVRLDPTSIDPQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGSENIWSTLRLALSMLGQSDAYGA. 311
21 -46.1003uq3_A mol:protein length:258 Heat shock protein STI1  ali model follow..  13  119RNAEKELKKAEAEAYVNPEKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTK---DAEVNNGSSAREIDQLYYKASQ..... 258
22 -45.9001fch_A mol:protein length:368 PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR  ali model follow..  13  195SLFLEVKELFLAAVRLDPTSIDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGSENIWSTLRLALSMLGQSDAYGA. 351
23 -45.7003hym_B mol:protein length:330 Cell division cycle protein 16 homolog  ali model follow..  12  173NNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGL---RRDDTFSVTMLGHCIEMYIGDSEAYIG 326
24 -45.7002vq2_A mol:protein length:225 PUTATIVE FIMBRIAL BIOGENESIS AND TWITCHING MO  ali model follow..  22QDYRQATASIEDALKSDPKNELAWLVRAEIYQYLKVNDKAQESFRQALSIKPDSAEINNNYGWFLGRLNRPAESMAYFDKALATYPTPYIANLNKGICSAKQGQFGLAEAYLKRSLAA---QPQFPPAFKELARTKMLAGQLGDADY. 168
25 -45.4002ho1_A mol:protein length:252 Type 4 fimbrial biogenesis protein PilF  ali model follow..  12  45GNTEQAKVPLRKALEIDPSSADAHAALAVVFQTEMEPKLADEEYRKALASDSRNARVLNNYGGFLYEQKRYEEAYQRLLEASQLYPERSRVFENLGLVSLQMKKPAQAKEYFEKSLRL---NRNQPSVALEMADLLYKEREYVPARQ. 190
26 -45.3003urz_A mol:protein length:208 Uncharacterized protein  ali model follow..  10  18GQNGQAVSYFRQTIALNIDRTEMYYELALAYKKNRNYDKAYLFYKELLQKAPNNVDCLEACAEMQVCRGQEKDALRMYEKILQLEADNLAANIFLGNYYYLTAEQEKKLETDYKKLSS---PTKMQYARYRDGLSKLFTTRYEKARN. 178
27 -45.2001elr_A mol:protein length:131 TPR2A-DOMAIN OF HOP  ali model follow..  1.................GKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHR-TPDVLKKCQQAEKILKEQER....... 130
28 -45.2001xnf_A mol:protein length:275 Lipoprotein nlpI  ali model follow..  18  57GLRALARNDFSQALAIRPDMPEVFNYLGIYLTQAGNFDAAYEAFDSVLELDPTYNYAHLNRGIALYYGGRDKLAQDDLLAFYQDDPNDPETNFYLGKYYLSLGDLDSATALFKLAVAN---NVHNFVEHRYALLELSLLGQDQDDLAE 271
29 -45.1001w3b_A mol:protein length:388 UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUC  ali model follow..  15  81GQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL---DPNFLDAYINLGNVLKEARIFDRAVA. 224
30 -44.9003sz7_A mol:protein length:164 Hsc70 cochaperone (SGT)  ali model follow..  11  2..........PRSMAPTPE-SDKLKSEGNAAMARKEYSKAIDLYTQALSIAPANPIYLSNRAAAYSASGQHEKAAEDAELATVVDPKYSKAWSRLGLARFDMADYKGAKEAYEKGIEA---EGNGGSDAMKRGLETTK-RKIEEANRG 134
31 -44.8002kck_A mol:protein length:112 TPR repeat  ali model follow..  18  1...............MVDQNPEEYYLEGVLQYDAGNYTESIDLFEKAIQLDPEESKYWLMKGKALYNLERYEEAVDCYNYVINVIEDNKDVWAAKADALRYIEGKEVEAEIAEARAKL.............................. 105
32 -44.8001wm5_A mol:protein length:208 Neutrophil cytosol factor 2  ali model follow..  13  2...........AMGSMSLVEAISLWNEGVLAADKKDWKGALDAFSAVQ---DPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNLFACEVLYNIAFMYAKKEEWKKAEEQ 148
33 -44.5003u4t_A mol:protein length:272 TPR repeat-containing protein  ali model follow..  13  88GQDSLAIQQYQAAVDRDTTRLDMYGQIGSYFYNKGNFPLAIQYMEKQIRPTTTDPKVFYELGQAYYYNKEYVKADSSFVKVLELKPNIYEANEYIAYYYTINRDKVKADAAWKNILAL---DPTNKKAIDGLKMKLE........... 266
34 -44.4003fwv_A mol:protein length:128 Hsc70/Hsp90-organizing protein  ali model follow..  10  1.................SKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYIVNQAAVYFEKGDYNKCRELCEKAIEVGRENAYAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPKVLKKCQQAEKILKEQ.......... 128
35 -44.4002fi7_A mol:protein length:265 type 4 fimbrial biogenesis protein PilF  ali model follow..  12  58GNTEQAKVPLRKALEIDPSSADAHAALAVVFQTEMEPKLADEEYRKALASDSRNARVLNNYGGFLYEQKRYEEAYQRLLEASQLYPERSRVFENLGLVSLQMKKPAQAKEYFEKSLRL---NRNQPSVALEMADLLYKEREYVPARQ. 203
36 -44.3003q47_B mol:protein length:137 STIP1 homology and U box-containing protein 1  ali model follow..  14  3..............HMKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEER 136
37 -43.9002kat_A mol:protein length:115 uncharacterized protein  ali model follow..  11  1....................................MQAITERLEAMLAQGTDNMLLRFTLGKTYAEHEQFDAALPHLRAALDFDPTYSVAWKWLGKTLQGQGDRAGARQAWESGLAAAQSRGD-QQVVKELQVFLRRLAREDALE.. 109
38 -43.7002e2e_A mol:protein length:177 Formate-dependent nitrite reductase complex n  ali model follow..  11  24QNPEAQLQALQDKIRANPQNSEQWALLGEYYLWQNDYSNSLLAYRQALQLRGENAELYAALATVLYYQASTAQTRAMIDKALALDSNEITALMLLASDAFMQANYAQAIELWQKVMDL---NSPRINRTQLVESINMAKLLQRRSDLE 171
39 -43.6001hh8_A mol:protein length:213 NEUTROPHIL CYTOSOL FACTOR 2  ali model follow..  13  1...............MSLVEAISLWNEGVLAADKKDWKGALDAFSAVQ---DPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNLFACEVLYNIAFMYAKKEEWKKAEEQ 143
40 -43.3003upv_A mol:protein length:126 Heat shock protein STI1  ali model follow..  16  1.................SMKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTK---DAEVNNGSSAREIDQLYYKASQQR... 125
41 -43.1002hr2_A mol:protein length:159 Hypothetical protein  ali model follow..  18  1............GMKPLKEVVGAYLALAQRQLVAGEYDEAAANCRRAMEISHTDAFCHAGLAEALAGLRSFDEALHSADKALHYFNRRGEAVYSRALALDGLGRGAEAMPEFKKVVEM---IEERKGETPGKERMMEVAIDRIAQLG. 157
42 -42.8003fp2_A mol:protein length:537 TPR repeat-containing protein YHR117W  ali model follow..  17  1GSHMNGEPDIAQLKGLSPSQAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNKQAMKVLNENLSK 152
43 -42.6001a17_A mol:protein length:166 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model follow..  11  3..........EPPADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQKAFERAIA.. 138
44 -41.4002gw1_A mol:protein length:514 Mitochondrial precursor proteins import recep  ali model follow..  17  284NDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELENKDPRSEQAKIGLAQMKLQQEDIDEAIT. 470
45 -40.8002bug_A mol:protein length:140 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model follow..  12  2.......SGTDPPADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALNDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQ.......... 132
46 -40.4002xpi_A mol:protein length:597 ANAPHASE-PROMOTING COMPLEX SUBUNIT CUT9  ali model follow..  10  387NKISEARRYFSKSSTMDPQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLFQGTHLPYLFLGMQHMQLGNILLANEYLQSSYALFQYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKEKPWAATWANLGHAYRKLKMYDAAID. 537
47 -40.4001na3_A mol:protein length:91 designed protein CTPR2  ali model follow..  22  2..............AMDPNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAKQNLGNAKQKQG............................................. 91
48 -40.3001elw_A mol:protein length:118 TPR1-DOMAIN OF HOP  ali model follow..  16  2..................EQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEA.............. 117
49 -39.9003k9i_A mol:protein length:117 BH0479 protein  ali model follow..  12  2................................VLGLEAQAVPYYEKAIASGKDLAECYLGLGSTFRTLGEYRKAEAVLANGVKQFPNHQALRVFYAMVLYNLGRYEQGVELLLKIIAETSDDETIQSYKQAILFYADKLDETWKA... 117
50 -39.9002l6j_A mol:protein length:111 TPR repeat-containing protein associated with  ali model follow..  12  2..................SQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSK-LQYRLELAQGAVGSVQIPVVEVDELPE........................ 106
51 -39.7001zu2_A mol:protein length:158 Mitochondrial import receptor subunit TOM20-3  ali model follow..  10  2....................PLGSMDTETEFDRILLFEQIRQDAENTYKSNPLDADNLTRWGGVLLELSQIQEAITKFEEALLIDPKKDEAVWCIGNAYTSFAFFDLATQFFQQAVDE---QPDNTHYLKSLEMTAKAPQLHAEAYKQ 147
52 -39.0003ieg_A mol:protein length:359 DnaJ homolog subfamily C member 3  ali model follow..  14  17GQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIALKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSEQEEKRSQALDAFDGADYTAAITFLDKILEV---CVWDAELRELRAECFIKEGEPRKAISD 176
53 -38.3002dba_A mol:protein length:148 Smooth muscle cell associated protein-1, isof  ali model follow..  19  24................GASSVEQLRKEGNELFKCGDYGGALAAYTQALGLDATPQDLHRNRAACHLKLEDYDKAETEASKAIEKDGGDVKALYRRSQALEKLGRLDQAVLDLQRCVSLEPKNKVFQEALRNISGPSSG.......... 148
54 -38.0002c2l_A mol:protein length:281 CARBOXY TERMINUS OF HSP70-INTERACTING PROTEIN  ali model follow..  14  1.................SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEER 131
55 -37.4002y4t_A mol:protein length:450 DNAJ HOMOLOG SUBFAMILY C MEMBER 3  ali model follow..  14  34GQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSENEELRSQALNAFGSGDYTAAIAFLDKILEV---CVWDAELRELRAECFIKEGEPRKAISD 193
56 -37.3004abn_A mol:protein length:474 TETRATRICOPEPTIDE REPEAT PROTEIN 5  ali model follow..  11  114...PEAEVLLSKAVKLEPELVEAWNQLGEVYWKKGDVTSAHTCFSGALTHCK-NKVSLQNLSMVLRQLQHVMDSVRQAKLAVQMDVLDGRSWYILGNAYLSPKISQQALSAYAQAEKVDRKASSNPDLHLNRATLHKYEESYGEALEG 274
57 -37.3003mkr_A mol:protein length:291 Coatomer subunit epsilon  ali model follow..  15  144DRLDLARKELKKMQDQDEDATLTQLATAWVSLAAGKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGVLQEALDKDSGHPETLINLVVLSQHLGKPPEVTNRYSQLKDAHRSHPFIKEYRAKENDFDRLVLQYAPS... 291
58 -37.1002r5s_A mol:protein length:176 Uncharacterized protein VP0806  ali model follow..  11  20GEHAQALNVIQTLSDELQSRGDVKLAKADCLLETKQFELAQELLATIPLEYQDNSYKSLIAKLELHQQAAESPELKRLEQELAANPDNFELACELAVQYNQVGRDEEALELLWNILKVNLGAQD-GEVKKTFMDILSALGQGNAIASK 166
59 -36.8003ma5_A mol:protein length:100 Tetratricopeptide repeat domain protein  ali model follow..  17  3................DPEDPFTRYALAQEHLKHDNASRALALFEELVETDPDYVGTYYHLGKLYERLDRTDDAIDTYAQGIEVARETQKDLSELQDAKLKAEGLE.......................................... 94
60 -36.3003gw4_A mol:protein length:203 Uncharacterized protein  ali model follow..  13  6HDYALAERQAQALLAHPATASGARFMLGYVYAFMDRFDEARASFQALQQQHTAEHRALHQVGMVERMAGNWDAARRCFLEERELPLAASANAYEVATVALHFGDLAGARQEYEKSLVYAQDQVAIACAFRGLGDLAQQEKNLLEAQQ. 168
61 -34.5002fbn_A mol:protein length:198 70 kDa peptidylprolyl isomerase, putative  ali model follow..  13  30..................QSAFDIKEEGNEFFKKNEINEAIVKYKEALDFKNIEISCNLNLATCYNKNKDYPKAIDHASKVLKIDKNNVKALYKLGVANMYFGFLEEAKENLYKAASL---NPNNLDIRNSYELCVNKLKEARKKDKL 172
62 -34.2003ro3_A mol:protein length:164 G-protein-signaling modulator 2  ali model follow..  14  23GNFRDAVIAHEQRLLIAKEERIAYSNLGNAYIFLGEFETASEYYKKTLLLRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIRIGEGRACWSLGNAYTALGNHDQAMHFAEKHLEISRE........................... 161
63 -34.1003v6t_A mol:protein length:499 dHax3  ali model follow..  80ETVQRLLPVLCQAHGLTPQQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQALLPVLCQAHGLTPEQVVAIASNGGGKQALETVQRLLPVLCQAHGL---TPQQVVAIASNGGGKQALETVQRLLPV 224
64 -33.8002kc7_A mol:protein length:99 bfr218_protein  ali model follow..  2......................DQLKTIKELINQGDIENALQALEEFLQTEPVGDEAYYLMGNAYRKLGDWQKALNNYQSAIELNPDSPALQARKM-VMDILNFYNKDMYNQLE.................................. 93
65 -33.7002avp_A mol:protein length:70 synthetic consensus TPR protein  ali model follow..  27  1..................GSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS............................................................ 70
66 -33.0002jlb_A mol:protein length:568 XCC0866  ali model follow..  11  3ADGPRELLQLRAAVRHRPQDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQL---LPEEPYITAQLLNWRRRLCDWRALDV. 146
67 -32.7003rkv_A mol:protein length:162 putative peptidylprolyl isomerase  ali model follow..  16  9..................KSVEALRQKGNELFVQKDYKEAIDAYRDALELDRKNIPLYANMSQCYLNIGDLHEAEETSSEVLKREETNEKALFRRAKARIAAWKLDEAEEDLKLLLRN---HPAAASVVAREMKIVTERRAEKKADSR 153
68 -32.4002v5f_A mol:protein length:104 PROLYL 4-HYDROXYLASE SUBUNIT ALPHA-1  ali model follow..  11  4...................TAEDCFELGKVAYTEADYYHTELWMEQALRQLDEKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEYIMAKEKDVNKS..................................... 102
69 -32.4001tjc_A mol:protein length:108 Prolyl 4-hydroxylase alpha-1 subunit  ali model follow..  11  4...................TAEDSFELGKVAYTEADYYHTELWMEQALRQLDDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEYIMAKEKDVNKS..................................... 102
70 -32.3003v6p_A mol:protein length:442 dHax3  ali model follow..  39ETVQRLLPVLCQAHGLTPQQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQALLPVLCQAHGLTPEQVVAIASNGGGKQALETVQRLLPVLCQAHGL---TPQQVVAIASNGGGKQALETVQRLLPV 183
71 -31.7003ffl_A mol:protein length:167 Anaphase-promoting complex subunit 7  ali model follow..  28GLHSNVRLLSSLLLTLPPQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKK---------ALSKTSKVRPSTGNSASTPQSQCLPSEIEVKYKLAECYTVLKQDKDAIAILDGIPSRQRT----PKINMLLANLYKK.......... 161
72 -31.4001p5q_A mol:protein length:336 FK506-binding protein 4  ali model follow..  14  139..................EQSTIVKERGTVYFKEGKYKQALLQYKKIVKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLSRRGEAHLAVNDFELARADFQKVLQL---YPNNKAAKTQLAVCQQRIRRQLAREKK 280
73 -31.4001zbp_A mol:protein length:273 hypothetical protein VPA1032  ali model follow..  12  11GQLQQALELLIEAIKASPKDASLRSSFIELLCIDGDFERADEQLMQSIKLFPEYLPGASQLRHLVKAQARKDFAQGAATAKVLGENEELTKSLVSFNLSMVSQDYEQVSELALQIEELRQEKGFVRDIDDRLGGYIELFSTAGN.... 164
74 -31.3002xev_A mol:protein length:129 YBGF  ali model follow..  18  3.....................RTAYNVAFDALKNGKYDDASQLFLSFLELYPNGPNALYWLGESYYATRNFQLAEAQFRDLVSRYPTHAGGLLKLGLSQYGEGKNTEAQQTLQQVATQYPGSDAARVAQERLQSIRLGQQLR...... 129
75 -31.0003pe3_A mol:protein length:723 UDP-N-acetylglucosamine--peptide N-acetylgluc  ali model follow..  15  23GNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKL---KPDFPDAYCNLAHCLQIVCDWTDYDE. 166

FFAS is supported by the NIH grant R01-GM087218-01
5 9 9 0 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Plewczynski D, Tkacz A, Wyrwicz LS, Godzik A, Kloczkowski A, Rychlewski L. Support-vector-machine classification of linear functional motifs in proteins. J Mol Model 2006 Aug;12(4):453-61. Epub 2005 Dec 10.