current user: public




2tmaA
Query: 2tma_A mol:protein length:284 TROPOMYOSIN, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280
# Score Template Links and tools%idFirst MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEEIKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSILast
1 -47.7002tma_A mol:protein length:284 TROPOMYOSIN  ali model  100  1MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEEIKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI 284
2 -46.9001c1g_A mol:protein length:284 TROPOMYOSIN  ali model follow..  98  1MDAIKKKMQMLKLDKENALDRADEAEADKKAAEDRSKQLEDELVSLQKKLKATEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLFEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEEIKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI 284
3 -26.0003c9i_A mol:protein length:242 Tail needle protein gp26  ali model follow..  13.......................................PSLNNPVVIQATRLDASILPRNVFSKSYLLYVIAQGTDVGAIAGKANEAGQGAYDAQVKNDEQDVELADHEARIKQLRIDVDDHESRITANTKAITALNVRVTTAEGEIASLQTNVSALDGRVTTAENNISALQADYVSKTATTSQSLASPLNVTTSYSVGGKKVVGARQTTAATGTANKGVFDADLTFAVSDTYTQSEIQAIANALITERRRTKAMEDALRA...................... 237
4 -23.6001jch_A mol:protein length:551 COLICIN E3  ali model follow..  12  289.DVLSPDQVKQRQDEENRRQQEWDATHPVEAAERNYERARAELNQANEDVARNQERQAKAVQVYNSRKSELDAANKT----------LADAIAEIKQFNRFAHDPMAGGHRMWQMAGLKAQRAQTDVNNKQAAFDAAAKEKSDADAALSSAMESRKKKEDKKRSAENNLNDEKNKPRKGFKDYGHDYHPAPKTENIKGLGDLKPGIPKTPKQNGGGKRKRWTGDKGRKIYEWDSQHGELEGYRASDGQHLGSFDPKTGNQLKGPDPKRNIKKYL.......... 551
5 -21.5002qih_A mol:protein length:157 protein UspA1  ali model follow..  1MRGSGSATSANTDRIATAELGIAENKKDAQIAKAQANENKDGIAKNQADIQLHDKKITNLGILHSMVARAVGNNTQGVATNKADIAKNQADIANNIKNIYELAQQQDQHSSDIKTLAKVSAANTDRIAKNKAEADASFETLTKNQKLCSQA..................................................................................................................................... 151
6 -21.3002b9c_A mol:protein length:147 striated-muscle alpha tropomyosin  ali model follow..  14  1...MNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEDKVEELLSKNYHLENEVARLKKLVGE...................................................................................................................................... 147
7 -20.6003u0c_A mol:protein length:201 Invasin ipaB  ali model follow..  22.ANQNINTTNAHSTSNILIPELKAPKSLNASSQLTLLIGNLIQILGEKSLTALTNKITAWKSQQQARQQKNLEFSDKINTLLSETEGLTRDYEKQINKLKNADSKIKDLENKINQIQTRLSELDPESPEKKKLSREEIQLTIKKDAAVKDRTLIEQKTLSIHSKLTDKSMQLEKEIDSFS........................................................................................................ 200
8 -20.4002efr_A mol:protein length:155 General control protein GCN4 and Tropomyosin  ali model follow..  22  1......................................................................................................................RMKQLEDKVEELLSKNYHLENEVARLKKLLERAEERAELSEGKSAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEEMKQLEDKVEELLSKNYHLENEVARLKK............ 154
9 -19.6002ojq_A mol:protein length:348 Programmed cell death 6-interacting protein  ali model follow..  76IQTVDQLIKELPELLQRNREILDESLRLLDEEEATDNDLRAKFKESNELYKPLRAEGTNFRTVLDKAVQADGQVKECYQSHRDTIVLLCKPEPELNAAIPSANPAKSEVVSVLKSLLSNLDEVKKEREGLENDLKSVNFDMTSKFLTALAQDGVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMK-QSNNEANLREEVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKTER.................... 348
10 -19.6002d3e_A mol:protein length:134 General control protein GCN4 and Tropomyosin  ali model follow..  82  1......................................................................................................................................................MEDKVEELLSKNYHLENEVARLKKLLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI 134
11 -19.3002bsg_A mol:protein length:487 FIBRITIN  ali model follow..  56VEVLDKNIGILKTSLETANSDIKTIQGILDVSGAQIGINKKDISDLKTLTSEHTEILNGTNNTVDSILADIGPFNAEANSVYRTIRELGQYTGQDINGLPVVGNPSSGMKHRIINNTDVITSQGIRLSELETKFIELTIEVGNLREELPKPPSFSQNVYSRLNEIDTKQTTVESDISAIKTSIGSIITSVNTNTDNIASINLELNQSGGIKQRLTVIETSIGDIPSSIKGQIKDNTTSIESLNGIVSGLRANVSWLNQIVGSLLNRVSTIETSVSGLNNAVQNL 382
12 -19.2002oev_A mol:protein length:705 Programmed cell death 6-interacting protein  ali model follow..  418.DTVPQSILTKSRSVIE-QGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDNDLRAKFKERWQRTPS-NELYKPLRAEGTNFRTVLDKAVQADGQVKECYQSHRDTIVLLCKPEPELNAAIPSANMQGSEVVNVLKSLLSNLDEVKKEREGLENDLKSVNFDMTSKFLTALAQDGVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMK-QSNNEANLREEVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDI 701
13 -19.1003o0z_A mol:protein length:168 Rho-associated protein kinase 1  ali model follow..  12  2...............................................................................................................................SLANEKLSQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRILENSKSQTDKDYYQLQAILEAERRDRGHDSEMIGDLQARITSLQEEVKHLKHNLEKVEGERKEAQDMLNHSEKEKNNLEIDLNYKLKSLQQRLEQEVN. 157
14 -19.0002oex_A mol:protein length:351 Programmed cell death 6-interacting protein  ali model follow..  79IQTVDQLIKELPELLQRNREILDESLRLLDEEEATDNDLRAKFKESNELYKPLRAEGTNFRTVLDKAVQADGQVKECYQSHRDTIVLLCKPEPELNAAIPSANPAKSEVVNVLKSLLSNLDEVKKEREGLENDLKSVNFDMTSKFLTALAQDGVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMK-QSNNEANLREEVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKTER.................... 351
15 -19.0001cii_A mol:protein length:602 COLICIN IA  ali model follow..  15  106.DITRQEFRLLQAELREYGFRTEIAGYDALRLHTESRMLFADADSLRISPREARSLIEQAEKRQKDAQNADKKAADMLAEYERRKGILDTRLSELEKNGGAALAVLDAQQARLTRNDRAISEARNKLSSVTESLNTARNALTRAEQQLTQQKNTPDGKTIVSPEKFPGRSSTNDSIVVSGDPRFAGTIKISGLDYKRNILNDRNPVVTEDVEGDKKIYNAEVAEWDKLRQRLLDARNKITSAESAVNSARNNLSARTNEQKHANDALNALLKEKENIRNQLSGI 410
16 -17.6001y1u_A mol:protein length:585 Signal transducer and activator of transcript  ali model follow..  1...............SPAGVLVDAMSQKHLQINQRFEELRLITQDTENELKKLQQTQEYFIIQYQESLRIQAQFAQLGQLNPQERMSRETALQQKQVSLETLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNEC..... 265
17 -17.6001i84_S mol:protein length:1184 SMOOTH MUSCLE MYOSIN HEAVY CHAIN  ali model follow..  14  901LQAETELYAEAEEMRVRLAAKKQELEEILHEMEARIEEEEERSQQLQAEKKKMQQQMLDLEEQLEEEEAARQKLQLEKVTADGKIKKMEDDILIMEDQNNKLTKERKLLEERVSDLTTNLAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKIKRKLEGESSDLHEQIAELQAQIAELKAQLAKKEEELQAALARLEDETSQKNNALKKIRELESHISDLQEDLESEKAARNKAEKQKRDLSEELEALKTELEDTLDTTATQQELRGSDYKDDDD. 1183
18 -17.2002xnx_M mol:protein length:146 M PROTEIN  ali model follow..  13  1..........MVWDRQRLEKELEEKKEALELAIDQASRDYHRATALEKELEEKKKALELAIDQASQDYNRANVLEKELEAITREQEINRNLLGNAKLELDQLSSEKEQLTIEKAKLEEEKQISDASRQSLRRDLDASREAKKQVEKDLLE...................................................................................................................................... 140
19 -17.1001qoy_A mol:protein length:318 HEMOLYSIN E  ali model follow..  10  25VEVVKNAIETADGALDLYNKYLDQ-VIPWQTFDETIKELSRFKQEYSQAASVLVGDIKTLMDSQDKYFEATQTVYEWCGVATQLLAAYILLFDEYNEKKASAQKDIKVLDDGITKLNEAQKSLLVSSQSFNNASGKLLALDSQLTNDFSEKSSYFQSQVDKIRKEAYAGAAAGVVVGPFGLIISYSIAAGVVEGKLIPELKNKLKSVQNFFTTLSNTVKQANKDIDAAKLKLTTEIAAIGEIKTETETTRFYVDYDDLMLSLLKEAAKKMINTCNEYQKEVPEV 318
20 -16.2003ibp_A mol:protein length:302 Chromosome partition protein mukB  ali model follow..  11  5IASLSDSVSNAREERMALRQEQEQLQSRIQSLMQRAPVWLAA----QNSLNQLSEQCGEEFTSSQDVTEYLQQLLEREREAIVERDEVGARKNAVDEEIERLSQPGGSEDQRLNALAERFGGVLLSEIYDDVSLEDAPYF-PSRHAIVVPDLSQVTEHLEGLTDCPEDLYLIEGDPQSFDDSVFSVDELEKAVVVKIADRQWRYSRFPEV-AARESRIESLHAEREVLSERFATLSFDVQKTQRLHQAFSRFISDPEAEIRQLNSRRVELERALSNHENDNQQQ 301
21 -15.9003l4q_C mol:protein length:170 Phosphatidylinositol 3-kinase regulatory subu  ali model follow..  13  2....QQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAFNETIKIFEEQGQTQEKSSKEYLERF-----RREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQELRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLG........................................................................................................... 169
22 -15.6001bg1_A mol:protein length:596 PROTEIN (TRANSCRIPTION FACTOR STAT3B)  ali model follow..  9.AVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLN----GNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIG---GPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHL 285
23 -15.5003tnf_B mol:protein length:384 LidA  ali model follow..  12  2...MLDEYEQAIKRAQENIKKGEELEKKLDKLERQGKDLEDKYKTYEENLEGFEKLLELSLSEINEKMEAFSKDSEKLTQLMEKHKGDEKTVQSLQREHHDIKAKLANLQVLHDAHTGKKSYVNEKGNPVSSLKDAQKGQWDAIKNNPAALEKAQKDYSQSKHDLATI-LEMEKQLETINNLIMSTDPKENEEATKLLHKHNGLNLKLANLQDMLAVHRKKDQQLFNLGGKFYPIHKEQKILEKDGKFYLLKQGEDWESIKDSPEKQKKAEHDFHKLQYETPM. 337
24 -15.3003u59_A mol:protein length:101 Tropomyosin beta chain  ali model follow..  84  4MEAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQGLQKKLKGTEDEVEKYSESVKEAQEKLEQAEKKATDAEAEVASLNRRIQLVEEE.......................................................................................................................................................................................... 101
25 -15.1002ysu_B mol:protein length:135 Colicin-E2  ali model follow..  14  4VEAAERNYERARAELNQANEDVARNQERQAKAVQVYNSRKSELDAANKTLADAIAEIKQAHDPMAGGHRMWQMAGLKAQRAQTDVNNKQAAFDAAAKEKSDADAALSAAQERRKQKENKEKDAKDKLD............................................................................................................................................................ 135
26 -15.1003na7_A mol:protein length:256 HP0958  ali model follow..  18  13ISHLDKEIDSLEPLIREKRKDLDKALNDKEAKNKAILNLEEEKLALKLQVSKNEQTLQDTNAKIASIQKKMSEIKS-----ERELRSLNIEEDIAKERSNQANREIENLQNEIKRKSEKQEDLKKEMLELEKLALELESLVENEVKNIKETQQIIFKKKEDLVE........................................................................................................................ 171
27 -14.9003mtt_A mol:protein length:187 Phosphatidylinositol 3-kinase regulatory subu  ali model follow..  1MIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAFNETIKIFEEQGQTQEKCSKE-RFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQQLRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNETEDQYALMEDL.......................................................................................................... 180
28 -14.9003fhn_A mol:protein length:706 Protein transport protein TIP20  ali model follow..  12LLNINDRIKQVQNERNELASKLQNLKQSLASNDTEVALSEVIAQDIIEVGASVE-GLEQLRAKYGDLQNKLEKVAVQQTQMQAGVDKLDSFERQLDELAEQPPDQ--FTLDDVKALHSKLTSVFATVPQINNIDSQYAAYNKLKSKVTGKYNDVIIQRLATSNTFDQKLLEAQWDTQKFASTSVGLVKCLRENSTKLYQLSLLYLPLEEETQNGDSERPLSRSNNNQ......................................................... 239
29 -14.9003u1c_A mol:protein length:101 Tropomyosin alpha-1 chain  ali model follow..  71  4MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEERSKQLEDDIVQLEKQLRVTEDSRDQVLEELHKSEDSLLFAEENAAKAESEVASLNRRIQLVEEE.......................................................................................................................................................................................... 101
30 -14.9001bf5_A mol:protein length:575 SIGNAL TRANSDUCER AND ACTIVATOR OF TRANSCRIPT  ali model follow..  10  2.....DKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWKRRQQSACIGGPPNA---CLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQVLWDRTFSLFQQLIQSSFVVER-CMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKVKVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLK.... 275
31 -14.8002nrj_A mol:protein length:346 Hbl B protein  ali model follow..  10  81DTKVKKQLLDTLNGIVEYDTTFDNYYETMVEATGDGETLKEGITDLRGEIQQNQKYAQQLIEELTKLRDSIGH---DVRAFGSNKELLQSILKNQGADVDADQKRLEEVLGSVNYYKQLESD-GIIVGVARDNLGKLEPLLAELRQTVDYKVTLNRVVGV----AYSNINEMHKALDDAINALTYMSTQWHDLDSQYSGVLGHIENAAQKADQ--NKFKFLKPNLNAAKDSWKTLRTDAVTLKEGIKELKVE................................ 340
32 -14.7001yvl_A mol:protein length:683 Signal transducer and activator of transcript  ali model follow..  39......EKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQH--NIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKIAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWKRRQQSACIGGP---PNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQVLWDRTFSLFQQLIQ. 314
33 -14.6003iox_A mol:protein length:497 AgI/II  ali model follow..  10  5.ADYQAKLTAYQTELARVQKANADAKAA---YEAAVAANNAANAALTAENTAIKKRNADAKADYEA---KLAKYQADLAKYQKDLADYPVKLKAYEDEQTSIKAALAELEKHKNEDGNLTEPSAQNLVYDLEPNANLSLTTDGKFLKASAVDDAFSKSTSKAKYDQKILQLDDLDITNLEQSNDVASSM............................................................................................... 186
34 -14.5001hci_A mol:protein length:476 ALPHA-ACTININ 2  ali model follow..  12  167VRALLRKHEAFESDLAAHQDRVEQIAAIAQELNEDAVNVNDRCQKICDQWDRLGTLTQKRREALERMEKLLETIDQLHLEFAKRAAPFNNWMEGAMEDLQDMFEEIQSLITAHEQFKATLPEADGERQSIMAIQNEVEKVIQSYNIRIPYSTVTMDELRTKWDKVKQLVPIRDQSLQEELARQHANERLRRQFAAQANAIGPWIQNKMEEIAR-TGALEDQMNQLKQYEHNIINYKNNIDKLEGDHQLIQEA-KHTNYTMEHIRVGWELLLTTIARTINEVET. 470
35 -14.4002fxm_A mol:protein length:129 Myosin heavy chain, cardiac muscle beta isofo  ali model follow..  14  8SAEREKEMASMKEEFTRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELTLAK.................................................................................................................................................................. 129
36 -13.5002wpq_A mol:protein length:99 TRIMERIC AUTOTRANSPORTER ADHESIN FRAGMENT  ali model follow..  1MKQIEDKIEEILSKIYHIENEIARIKKLIFDTNEKVDQNTADITTNTNSINQNTTDIATNTTNINNLSDSMKQIEDKIEEILSKIYHIENEIARIKKLI......................................................................................................................................................................................... 99
37 -13.4001ei3_A mol:protein length:491 FIBRINOGEN  ali model follow..  11  40.DDWGTKCPSCCRMQGIIDDTDQNYSQRIDNIRQQLADSQNKYKTSNRVIVETINILKPGLEGAQQLDENYGH---VSTELRRRIVTLKQRVATQVNRIKALQNSIQEQVVEMKRLEVDIDIKIRACKGSCARSFDYQVDKEGYD-NIQKHLTQASSIDMHPDFQTTTLSTLKMRPLKDSNVPEHFKLKPSPEMQAMS----AFNNIKQMQVVLERPETDHVAEARGDSSPSHTGKLITSSHRRE....................................... 275
38 -13.4002v71_A mol:protein length:189 NUCLEAR DISTRIBUTION PROTEIN NUDE-LIKE 1  ali model follow..  14  5FSSLKEETAYWKELSMKYKQSFQEARDELVEFQEGSRELEAELEQAEQRNRDLQADNQRLKYEVEALKEKLEHQYA---QSYKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIMSLEDFEQRLNQAIERNAFLESELDEKESSVQRLKDEARDLRQELAVRERQQEVTRK....................................................................................................... 189
39 -13.2001d7m_A mol:protein length:101 CORTEXILLIN I  ali model follow..  19  1..EMANRLAGLENSLESEKVSREQLIKQKDQLNSLLASLESEGAEREKRLRELEAKLDETLKNLELEKLARMELEARLAKTEKDRAILELKLAEAIDEKSKLE..................................................................................................................................................................................... 101
40 -13.1003plt_A mol:protein length:234 Sphingolipid long chain base-responsive prote  ali model follow..  12  23.RKLSQLVKTEKGVLRAMEVVASERREAAKQLSLWGADNDDDVSDVTDKLGVLIYELGELQDQFIDKYDQYRVTLKSIRNIEASVQPSRDRKEKITDEIAHLKYKDPQ-STKIPVLEQELVRAEAESLVAEAQLSNITRELKAAYSYMFDSLRELSEKFALIAGYGKALLELLDDSPVTPGEARPAYDGYEASRQIIMDAESALES.............................................................................. 227
41 -13.1001sjj_A mol:protein length:863 actinin  ali model follow..  337VSDINNAWGGLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHESWTDGKEAMLQQKDSEIKALLKKHEAFESDLAAHQDRVEQIAADSPSVNARCQKICDQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFEEIQGLTTAHEQFKATLPDADKERQAILGIHNEVSKTPQEINGKWEHVRQLVPRRDQALMEEHARQQQNERLRKQFGAQANVIGPWIQTKMEEIGR-HGTLEDQLNHLRQYEKSIVNYKPKIDQL 664
42 -13.0002ocy_A mol:protein length:154 Rab guanine nucleotide exchange factor SEC2  ali model follow..  10  2.MALSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLDEANNMVADARKEKYAIEILNKRLTEQLREKDTLLDTLTLQLKNLKKVMHSLDNE......................................................................................................................................... 151
43 -12.5001mql_B mol:protein length:221 Hemagglutinin HA2 chain  ali model follow..  23..GFRHQNSEGTGQAADLKSTQAAIDQINRKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLADSEMNKLFEKTRRQLRENAEDMG--NGCFKIYHKCDNACIESIRNGTYDHDIYRDEALNNRFQIKGVELKSGYKDW..................................................................................................................... 185
44 -12.2002oto_A mol:protein length:155 M protein  ali model follow..  16  23..................................................................................................................................................QNIRLRHENKDLKARLENAMEVAGRDFKRAEELEKAKQALEDQRKDLETKLKELQQDYDLAK---ESTSWDRQRLEKELEEKKEALELAIDQASRDYHRATALEKELEEKKKALELAIDQASQDYNRANVLEKELE.. 155
45 -12.2003n4x_A mol:protein length:190 Monopolin complex subunit CSM1  ali model follow..  12  1MDPLTVYKNSVKQQIDSADLLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKELKTQTSQQAENSEVIKDLYEYL........................................................................................................................................................................................................... 81
46 -12.1002wcd_A mol:protein length:309 HEMOLYSIN E, CHROMOSOMAL  ali model follow..  10  10VEVVKNAIETADGALDLYNKYLDQ-VIPWQTFDETIKELSRFKQEYSQAASVLVGDIKTLLMDSQKYFEATQTVYEWCGVATQLLAAYILLFDEYNEKKASAQKDIKVLDDGITKLNEAQKSLLVSSQSFNNASGKLLALDSQLTNDFSEKSSYFQSQVDKIRKEAYAGAAAGVVAGPFGLIISYSIAAGVVEGKLIPELKNKLKSVQNFFTTLSNTVKQANKDIDAAKLKLTTEIAAIGEIKTETETTRFYVDYDDLMLSLLKEAAKKMINTCNEYQKEVPEV 303
47 -11.7001ic2_A mol:protein length:81 TROPOMYOSIN ALPHA CHAIN, SKELETAL MUSCLE  ali model follow..  95  1MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEERSKQLEDELVALQKKLKGTEDELDKYSESLKDAQEKLELADKKATD............................................................................................................................................................................................................ 80
48 -11.7003iyk_A mol:protein length:526 VP5  ali model follow..  11  72.AVLLNVLGSGEEIPDPLSPGERGIQAKLKELEDEQRNELVRLKYNDKIKEKFGKELEEVYNFMNGEANAEIEDEKQFDILNKAVTSYNKILTEEDLQMRRLATALQKEIGERTHAETVMKEYRDKIDALKNAIEVERDGMQE-----EAIQEIAGMTADVLEAASEEVPLIGAGMATAVATGRAIEGKLKKVINALSGIDLTHLRTPKIEPSVVSTILEYRAKEIPDNALAVSVLSKNRAIQENHKELMHIKNEILPRFKKAMDEEKEICGIEDKV....... 345
49 -11.5002e7s_A mol:protein length:135 Rab guanine nucleotide exchange factor SEC2  ali model follow..  14  2..................................................................................................................................................PLGSLEEQLNKSLKTIASQKAAI----ENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLDEANNLVADARMEKYAIEILNKRLTEQLREKDMLLDTLTLQLKNLKKVMHS. 135
50 -11.3002ap3_A mol:protein length:199 conserved hypothetical protein  ali model follow..  15...................................................................................................KKEIKAYLKQVDKIKDDEEPIKTVGKKIAELDEKKKKLTEDVN--SKDTAVRGKAVKDLIKNADDRLKEFEKEEDAIKKSEQDFKKAKSHVDNIDNDKRKEVKQLDDVLKEKYKLHSDYAKAYKKAVNSEKTLFKYLNQNDATQQGVNEKSKAIEQNYKKLKEVSDKYTKVLNKVQKEKQDVDQF 198
51 -11.1002pms_C mol:protein length:125 PNEUMOCOCCAL SURFACE PROTEIN A (PSPA)  ali model follow..  3..HMDAEEVAPQAKIAELENQVHRLEQELKEIDESESEDYAKEGFRAPLQSKLD-AKKAKLSKLEELSDKIDELDAEIAKLEDQLKAAEENNNVEDYFKEGLEKTIAAKKAELEKTEADLKKAVNE.............................................................................................................................................................. 125
52 -10.9003q8t_A mol:protein length:96 Beclin-1  ali model follow..  14  3.................................................................................................................................................................................................GSDSEQLQRELKELALEEERLIQELEDVEKNRKVVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQMQLDKL 93
53 -10.8002ch7_A mol:protein length:309 METHYL-ACCEPTING CHEMOTAXIS PROTEIN  ali model follow..  13  4MKDVQTETFSVAESIEEISKANEEITNQLLGISKEMDNISTRIESISASVQETTAGSEEISSATKNIADSAQQAASFADQSTQLAKEAGDALKKVIEVTRMISNSAKDVERVVESFQKGAEEITSFVETIQTNLLALNAAIEAARA-ADEIRKLAEESQQASENVRRVVNEIRSIAEDAGKVSSEITARVEEGTKLADEADEKLNSIVGAVERINEMLQNIAAAIEEQTAAVDEITTAMTENAKNAEEITNSVKEVNARLQEISASTEEVTSRVQTIRENVQML 301
54 -10.8003mq7_A mol:protein length:121 Bone marrow stromal antigen 2  ali model follow..  12  6DKANSEAARDGLRAVMEARNVTHLLQQELTEAQKGFQDVEAQAATANHTVMALMASLDA---EKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSS......................................................................................................................................................................... 117
55 -10.5003uux_B mol:protein length:242 Mitochondrial division protein 1  ali model follow..  16  145PSALKSFSQTLVNSLEFLNIQKNSTLSEIRDIEVEVENLRQKKEKLLGKIANIEQNQLLLEDNLKQIDDRLDFLEEYGLEVIEANSDENAE................................................................................................................................................................................................. 235
56 -10.3002p01_A mol:protein length:323 Alpha-2-macroglobulin receptor-associated pro  ali model follow..  14  115.............................PRLEKLWHKAKTSGKFSGEELDKLWREFLHHKEKVHEYNVLLETLSRT----EEIHENVISPSDLSDIKGSVLHSRHTELKEKLRSINQGLDRLRRVSHQGYSTEAEFEEP-----IDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLEIAHEKLRHAESVGDGRVSRSREKHALLEGRTKELGYTVKKHLQDLSGRISRARHNE......................................... 322
57 -10.2003hnw_A mol:protein length:138 uncharacterized protein  ali model follow..  20  72..KAKKMADSLSLDIENKDKEIYDLKHELIAAQIKAESSAKEIKELKSEINKYQKNIVKLETELNDSKK....................................................................................................................................................................................................................... 138
58 -10.1003nwh_A mol:protein length:112 Bone marrow stromal antigen 2  ali model follow..  2...IDPFTKANSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDA---EKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKK....................................................................................................................................................................... 112
59 -9.9101wdf_A mol:protein length:95 E2 glycoprotein  ali model follow..  7.SAFNNALGAIQDGFDATNSALGKIQSVVNANAEALNNLLNQLSNRFGAISDLSLDFEKLNVTLLDLTYEMNRIQDAIKKLNESYINLKE.................................................................................................................................................................................................. 95
60 -9.8901u4q_A mol:protein length:322 Spectrin alpha chain, brain  ali model follow..  35LASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKDKRETINGRFQRIKSMAAARRAKLNESH-RLHQFFRDMDDEESWIKEKKLLVSS-----EDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRLAQFVDHWKELKQLAAARGQRLEESL-EYQQFVANVEEEEAWINEKMTLVASEDAAIQGLLKKHEAFETDFTVHKDRVNDVCANGEDLIKHVENITAKMKGLKGKVSDLEKAAAQRKAKLDE. 319
61 -9.8802ve7_C mol:protein length:250 KINETOCHORE PROTEIN NUF2, KINETOCHORE PROTEIN  ali model follow..  137.EACRETYMEFLWQYKSSADKMQQLNAAHQEALMKLERLEKEVDEDTTVTIPSAVYVAQLYHQVSKIEWEYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISD................................................................................................................................................................................... 240
62 -9.8003mqb_A mol:protein length:121 Bone marrow stromal antigen 2  ali model follow..  11  6DKANSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDA---EKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSS......................................................................................................................................................................... 117
63 -9.6701kql_A mol:protein length:56 Fusion Protein of and striated muscle alpha-t  ali model follow..  69  2.....................................................................................................................................................................................................................................DKVEELLSKNYHLENEVARLKKLVDDLEDELYAQKLKYKAISEELDHALNDMTSI 56
64 -9.6502a1d_D mol:protein length:329 Staphylocoagulase  ali model follow..  11  26.WYLKGRLTSLESQFINALDILETYHYGEKEYKDAKDKLMTRILGEDQYLLERKKVQYEEYKKLYQKYKEENPTSKLKLKTFDQYTIEDLTMREYNELTESLKSAVKDFEKDVEKIENQHHDLKPFTDEMEEKATSRVDDLANKAYSVYFAFVRDTQHKTEALELKAKVDLVLSNERIEKEMIKDLESIIEDFFIEITSYDSSKHHYKNHSEGFEALVKETREAVANADESWKTKTVKKYGESETKSPVENKVEDPQSPKFDNQQEVKTTAGKAEETTQPVAQ. 327
65 -9.5703cl3_D mol:protein length:130 NF-kappa-B essential modulator  ali model follow..  15  4ASGSLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQ---HSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAE........................................................................................................................................................... 129
66 -9.5101l8d_A mol:protein length:112 DNA double-strand break repair rad50 ATPase  ali model follow..  16  1...MKKLLEELETKKTTIEEERNEITQRIGELKNKIGDLKTAIEELKKAKGKCPVCGRELTDE--HREELLSKYHLDLNNSKNTLAKLIDRKSELERELRRIDMEIKRLTPLLTVAE....................................................................................................................................................................... 112
67 -9.4802wpr_A mol:protein length:107 TRIMERIC AUTOTRANSPORTER ADHESIN FRAGMENT  ali model follow..  13  2...........................................................................................................................................................................................KQIEDKIEEILSKIYHIENEIARIKKLIEKVDQNTADITTNTNSINQNTTDIATNTTNINNLSDSITTLMKQIEDKIEEILSKIYHIENEIARIKKL 98
68 -9.4803a7p_A mol:protein length:152 Autophagy protein 16  ali model follow..  13  23TDSMDDLLIRRLTDRNDKEAHLNELFQDNSGAIGGNIVSHDD--ALLNTLAILQKELKSKEQEIRRLKEVIALKNKNTERLNAALISGTIENNVLQQKLSDLKKEHSQLVARLKKTEKETEAMNSEIDGTK......................................................................................................................................................... 152
69 -9.4002dfs_A mol:protein length:1080 Myosin-5A  ali model follow..  823.....QKFQRMYVVRKRYQCMRDATIALQALLRGYLVRNKYQMMLREHKSIIIQKHVRGWLARVHYHRTLKAIVYLQCCYRRMMAKRELKKLKIEARSVERYKKLHIGLENKIMQLQRKIDEQNKEYKSLLEKMNNLEITYSTETEKLRSDVERLRMSEEEAKNATNRVLSLQEEIAKLRKELHQTQTEKKTIEEWADKYKHETEQLV---SELKEQNTLLKTEKEELNRRIHDQAKEITETMEK--KLVEETKQLELDLNDERLRYQ................ 1080
70 -9.3603qh9_A mol:protein length:81 Liprin-beta-2  ali model follow..  10  7MEKEQREQEEKQRKAEELLQELRHLKIKVEELENERNQYEWKLKATKAEVAQLQEQVALKDAEIERLHSQLSR................................................................................................................................................................................................................... 79
71 -9.3602ve7_A mol:protein length:315 KINETOCHORE PROTEIN HEC1, KINETOCHORE PROTEIN  ali model follow..  14  110LIDCIKIHTAMKESSPLFDDGQPWGEETEDGIMHNKLFLDYTIKCYESFMSGADSFDEMNAELQSKLKDLFNVDAFKLESLEAKNRALNEQIARLEQERSTANKA---NAERLKRLQKSADLYKDRLGLEIRKIYGEKLQFIFTNIDPKNPESPFMFSLHLNEARDYEVSDSAPHLEGLAEFQENVRKT-NNFSAFLANVRKAFTATVYQ.......................................................................... 315
72 -9.3103he4_A mol:protein length:56 SYNZIP6  ali model follow..  20  2....SQKVAQLKNRVAYKLKENAKLENIVARLENDNANLEKDIANLEKDIANLERDVAR................................................................................................................................................................................................................................. 56
73 -9.2901sj8_A mol:protein length:308 Talin 1  ali model follow..  4MPPLTSAQQALTGTINSSMQAVQAAQATLDDFE-TLPPLGQDAASKAWRKNKMDESKHEIHSQVDAITAGTASVVNLTAG-ETDYTAVGCAVTTISSNLTEMSRGVKLLAALLEDEGGNGRPLLQAAKGLAGAVSELLRSAQPAS---AEPRQNLLQAAGNVGQASGELLQQIGESDTDPHFQDVLMQLANAVASAAAALVLKAKSVAQRTEDSGLQTQVIATQCALSTSQLPVCQEQLVEAGRLVAKAVEGCVSASQAATEDGQLLRGVGAAATAVTQALNEL 300
74 -9.1603dyj_A mol:protein length:332 TALIN-1  ali model follow..  10  21ASAVSGIIADLDTTIMFATA--ETFADHREGILKTAKVLVEDTKVLVQNAAGSQEKLAQAAQSSVATITRLDVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKAAAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVFCSPEPPAKTSPEDFIRMTKGITMATAKASCRQEDVIATANLSRRAIADMLRACKEAAFHPEVAPDVRLRALHYGRECANGYLELLDHVLLNPDLKQQLTGHSKRVAGSVTEL 322
75 -9.1102wvr_A mol:protein length:209 GEMININ  ali model follow..  13  4..SMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTSTTSSPGV-IVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEK----RKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLV............................................................................................... 186

FFAS is supported by the NIH grant R01-GM087218-01
6 0 4 8 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Osterman A, Overbeek R, Godzik A. Automatic detection of subsystem/pathway variants in genome analysis. Bioinformatics. 2005 Jun 1;21 Suppl 1:i478-i486.