current user: public




Query: 2tma_A mol:protein length:284 TROPOMYOSIN, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280
# Score Template Links and tools%idFirst MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEEIKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSILast
1 -53.8002tma_A mol:protein length:284 TROPOMYOSIN  ali model  100  1MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEEIKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI 284
2 -51.2001c1g_A mol:protein length:284 TROPOMYOSIN  ali model follow..  98  1MDAIKKKMQMLKLDKENALDRADEAEADKKAAEDRSKQLEDELVSLQKKLKATEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLFEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEEIKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI 284
3 -31.8004lin_A mol:protein length:300 Tail needle protein gp26  ali model follow..  10  4VPEFGSSRMADPSLNNPVVIQATRLDASILPRNVFSKSYLLYVIAQGTDVGAIAGKANEAGQGAYDAQVKNDEQDVELADHEARIKQLRIDVDDHESRITANTKAITALNVRVTTAEGEIASLQTNVSALDGRVTTAENNISALQADVDDHESRITANTKAITALNVRVTTAEGEIASLQTNVSALDGRVTTAENNISALQADYVSKTATTSQSLASPLNVTTSYSVGGKKVVGARQTNKGVFDADLTFAVSDTYTQSEIQAIANALITERRRTKALEDALRA. 295
4 -25.7004e40_A mol:protein length:252 Putative uncharacterized protein  ali model follow..  12  2............EGEIKVELEDSDDVAAACELRAQLAGVSIASGILLRPAVIRNATTEFSRKKSEDILAKGGAAVERASAAVDRVSGLDKTNETAQKVRKAAAVAHHALEHVKEEVEIVAKKVNEIIELTAGATEHAKGAKANGDASAVKVSNLLARAKESENQYVKEAAEECSESTNYDVTAKSLAAALDKLPGEDNAVKTTFQSILTSLDNLDKDVKSVEQRAEELETALEKAERQLEKAEKAAEEAETESSKVETESS....................... 252
5 -24.4003c9i_A mol:protein length:242 Tail needle protein gp26  ali model follow..  4..............................VPRGSHMADPSLNNPVVIQATRLDASILPRNVFSKSYLLYVIAQGTDVGAIAGKANEAGQGAYDAQVKNDEQDVELADHEARIKQLRIDVDDHESRITANTKAITALNVRVTTAEGEIASLQTNVSALDGRVTTAENNISALQADYVSKTATTSQSLASPLNVTTSYSVGGKKVVGARQTTAATGTANKGVFDADLTFAVSDTYTQSEIQAIANALITERRRTKAMEDALRA...................... 237
6 -24.4002b9c_A mol:protein length:147 striated-muscle alpha tropomyosin  ali model follow..  85  1.......................................................................................MNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEDKVEELLSKNYHLENEVARLKKLVGE.................................................. 147
7 -24.3004zkp_A mol:protein length:237 Tail needle protein gp26  ali model follow..  12................................................................NPVVIQATRLDASILPRNVFSKSYLLYVIAQGTDVGAIAGKANEAGQGAYDAQVKNDEQDVELADHEARIKQLRIDVDDHESRITANTKAITALNVRVTTAEGEIASLQTNVSALDGRVTTAENNISALQADYVSKTATTSQSLASPLNVTTSYSVGGKKVLGARQTTAATGTANKGVFDADLTFAVSDTYTQSEIQAIANALITERRRTKAMEDALRA. 232
8 -24.1002efr_A mol:protein length:155 General control protein GCN4 and Tropomyosin  ali model follow..  22  1......................................................................................................................RMKQLEDKVEELLSKNYHLENEVARLKKLLERAEERAELSEGKSAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEEMKQLEDKVEELLSKNYHLENEVARLKK............ 154
9 -23.6005bu5_A mol:protein length:233 DNA stabilization protein  ali model follow..  4..........................................................................SNLNEPVIIQATRLDTSILPRNIFSQSYLLYVIAQGTDVGNVANKANEAGQGAYDAQVKNDEQDVELADHDARIAANTKAINILEVRLTTAEGKIVVLRSDVDYLLDEVIDIQAHLVTVDQRLDGVESDVSDIKSDYVSKTVTESQSLASPLDVKTSYSVDGIQVVGARQT-QSYTVGTTYTQSEVAALATGLEQARQRILALETALRL. 228
10 -21.7004xa6_A mol:protein length:175 Gp7-MYH7(1777-1855)-EB1 chimera protein  ali model follow..  13  2.......................................................................................................ASMPLKPEEHEDILNKLLDPELAQSERTEALQQLRVNYGSFVSEYNDLTKSHAHLERMKKNMEQTIKDLQHRLDEAEQILKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDE........ 175
11 -21.5002d3e_A mol:protein length:134 General control protein GCN4 and Tropomyosin  ali model follow..  82  1......................................................................................................................................................MEDKVEELLSKNYHLENEVARLKKLLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI 134
12 -20.3001jch_A mol:protein length:551 COLICIN E3  ali model follow..  12  303.ENRRQQEWDATHPVEAAERNYERARAELNQANEDVARNQERQAKAVQVYNSRKSELDAANKTLAD---AIAEIKQFNRFAHDPMAGGHRMWQMAGLKAQRAQTDVNNKQAAFDAAAKEKSDADAALSSAMESRKKKEDKKRSAENNLNDEKNKPRKGFKDYGHDYHPAPKTENIKGKPGIPKTPKQNGGGKRKRWTGDKGRKIYEWDSQHGELEGYRASDGQHLGSFDPKTGNQLKGPDPKRNIKKYL................................... 551
13 -20.2001i84_S mol:protein length:1184 SMOOTH MUSCLE MYOSIN HEAVY CHAIN  ali model follow..  14  901LQAETELYAEAEEMRVRLAAKKQELEEILHEMEARIEEEEERSQQLQAEKKKMQQQMLDLEEQLEEEEAARQKLQLEKVTADGKIKKMEDDILIMEDQNNKLTKERKLLEERVSDLTTNLAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKIKRKLEGESSDLHEQIAELQAQIAELKAQLAKKEEELQAALARLEDETSQKNNALKKIRELESHISDLQEDLESEKAARNKAEKQKRDLSEELEALKTELEDTLDTTATQQELRGSDYKDDDD. 1183
14 -20.1005chx_A mol:protein length:214 Xrcc4-MYH7-1590-1657  ali model follow..  10  53...................................................................................................SEISQEADDMAMEKGKYVGELRKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVENPAEVIRELCYCLDTTAENQAKNEHHLRVVDSLQTSLDAETRSRNEALRVKKKMEGDLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQL........................ 214
15 -19.9003o0z_A mol:protein length:168 Rho-associated protein kinase 1  ali model follow..  13  5..................................................................................................................................NEKLSQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRILENSKSQTDKDYYQLQAILEAERRDRGHDSEMIGDLQARITSLQEEVKHLKHNLEKVEGERKEAQDMLNHSEKEKNNLEIDLNYKLKSLQQRLEQ.... 154
16 -19.7004ux3_A mol:protein length:543 STRUCTURAL MAINTENANCE OF CHROMOSOMES PROTEIN  ali model follow..  149....QGKIVALTNAKDKERLQLLEDVVGAKSFEVKLKASLKKMEETEQKKIQINKEMGELNSKLSEMEQERKELEKERNRKIYQFTLYDRELNEVINQMERLDGDYNNTVYSSESSKHPTSLVPR---GSDITSDQLLQRLNDMNTEISGLKNVNKRAFENFKKFNERRKDLAERASELDESKDSIQDLIVKLKQQVNAVDSTFQKVSENFEAVFERLVPRGTAKLIIHRKNDNANDHDESIDVDMDAESNESQNGKDSEIMYTGVSISVSFNSKQNEQHVEQL 431
17 -19.4004gkw_A mol:protein length:167 Spindle assembly abnormal protein 6  ali model follow..  2...................................................................................................................SHMLVEDKEDEVADLKQDTESLQKQLEENQEELEIVGNMLREEQGKVDQLQKRNVAHQKEIGKLRAELGTAQRNLEKADQLLKRNSQQQNQQSLDMRKLGEL----EADLKEKDSMVESLTETIGILRKELENEKLKAAENMDSFEKLSMENENLKEKIAHYRAQRFSP 166
18 -19.3002bsg_A mol:protein length:487 FIBRITIN  ali model follow..  49TVSVLRNVEVLDKNIGILKTSLETANSDIKTIQGILDVSGDI--EALAQIGINKKDISDLKTLTSEHTEILNGTNNTVDSILADIGPFNAEANSVYRTINDLLWIKRELGQYTGQDINGLPVVGNPSSGMKHRIINNTDVITSQGIRLSELETKFIESD--VGSLTIEVGNLREELGPKPPSFQNVYSRLNEIDTKQTTVESDISAIKTSINSIITSVNTNTDNIASINLELNQSGGIKQRLTVIETSIDDIPSSIKGQIKDNTTSIESLNGIVSGLRANVSWL 342
19 -18.7002qih_A mol:protein length:157 protein UspA1  ali model follow..  1MRGSGSATSANTDRIATAELGIAENKKDAQIAKAQANENKDGIAKNQADIQLHDKKITNLGILHSMVARAVGNNTQGVATNKADIAKNQADIANNIKNIYELAQQQDQHSSDIKTLAKVSAANTDRIAKNKAEADASFETLTKNQKLCSQA..................................................................................................................................... 151
20 -18.7004mu6_A mol:protein length:367 Kinectin 1 (Kinesin receptor)  ali model follow..  13  71.QSYKAQLAEDKIQKEQDDAEALKDKKLKEVLTRELNHIPTQISEQQTELRLLHYKLERLFESQAKVDVI-MKKIKPSSSHSASIERLQRSINEREIKIQSLFEQEVNNKIKLNEIEKRASVRSQHHTKRVKRAQARIGYNSTGEDILSTLSGK-RSIQKQHHALEKKCSDLIQEADQINYPLFLEELQKYLNKKKHTLSSQEVDALKSVIKYIKQHLE-FEHEVINTQSSLHIKKQSISSQIVKLRELQNKLKTLKNNNPNLTAANEELVSRNLELTAMKEH. 361
21 -18.3002h7o_A mol:protein length:303 Protein kinase ypkA  ali model follow..  21.DLLRTHLSSAATKQLDMGGVLSDLDTMLVALDKAEREGGVDKDQLKSFNSLILKTYRVIEDYVKGREGDTKNSSTEVSPYHRSNFMLSIVEPSLQRIQKHLDQTHSFSDGSLVRAHKHLETLLEVLVTLSQQGQPVSSETYGFLNRLAEAK---ITLSQQLNTLQQQQESAKAQLSILINRSGSWADVARQSLQRFDSTRPVVKFGTEQYTAIHRQMMAAHAAISEFTDDMRNFTVDSIPLLIQLGRSSLMDEHLVEQREKLRELTTIAER............ 294
22 -18.1004k1p_A mol:protein length:360 NheA  ali model follow..  71IDEYNPKLIDLNQEMMRYSIRFNSYYSKLYELAGNINEDEQSKADFTNAYGKLQLQVQSIQENMEQDLLELNRFKT---VLDKDSNNLSIKADEAIKTLQGSSGDIVKLREDIKRIQGEIQAELTTILNRPQEIIKGSINIGK-NEIVNAADSQTREAALRIQQKQKELLPLIQKLSQTEAEATQIT----FVEDQVSSFTELIDRQITTLETLLTDWKVLNNNMIQIQKNVEEGTYTDSSL------LQKHFNQIKKVSDEMNKQTNQFEDYVTNVEVH.... 360
23 -18.1005cj0_A mol:protein length:207 Xrcc4-MYH7-(1631-1692) chimera protein  ali model follow..  10  47...............................................................................TGTVSESEISQEADDMAMEKGKYVGELRKALLSGAGPADVYTNFSKESCYFFFEKNLKDVSFRLGSFNLEKVENPAEVIRELICYCLDTTAENQAKNEHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNLLQAELEELRAVV............................................. 207
24 -17.4001cii_A mol:protein length:602 COLICIN IA  ali model follow..  11  2IMAVDIYVNPPRVDVSSFGNKTIWGGNEWVDDSPTRSDIEKRDKEITAYKNTLSAQQKENENKRTEAGKRLSAAIAAREKDENTLKTLR---AGNADAADITRQEFRLLQAELREYGFRTEIAGYDALRLHTESRMLFADADSLRISPREARSLIEQAEKRQKDAQNADKKAADMLAEYERRKGILDTRLSELEKNGGAALAVLDAQQ---ARLLGQQTRNDRAISEARNKLSSVTESLNTARNALTRAEQQLTQQKNTPDG...................... 265
25 -17.2002xnx_M mol:protein length:146 M PROTEIN  ali model follow..  11  1...............................................................................................................................................MVWDRQRLEKELEEKKEALELAIDQASRDYHRATALEKELEEKKKALELAIDQASQDYNRANVLEKELEAITREQEINRNLLGNAKLELDQLSSEKEQLTIEKAKLEEEKQISDASRQSLRRDLDASREAKKQVEKDLLE. 140
26 -16.9004hpq_C mol:protein length:413 Atg17  ali model follow..  12  4.AVIEKLLENSRKFLTGAKLICQESNDHLTTTKLRIREWQKFQSKLHFVLDCIQQQTKFLSEILLREGIEEEWSQTVLVRLVNDMKFWQNEITKMMNKLDNITNEIDQ-RDSSHILDSKLNEIPTIRKQVENITRQYQTMLAKVQSQLVESRKLNEEFTNEADQLEQELADFLKSFTDHFDKCSALSSR-EDAQNLFEIVERDDKDLAAINSLLQDAAIDVASFVRKVNMLLDERDADKAKMQATLSKLLTELRKHEEYISVFEGISALIQKFKASCLEDIRQT 324
27 -16.5003ibp_A mol:protein length:302 Chromosome partition protein mukB  ali model follow..  10  2....SHMIASLSDSVSNAREERMALRQEQEQLQSRIQSLMQR----APVWLAAQNSLNQLSEQCGEEFTSSQDVTEYLQQLLEREREAIVERDEVGARKNAVDEEIERLSQPGGSEDQRLNALAERFGGVLLSEIYDDVSLEDAHAIVVPDLSQVTEHLEGLTDCPEDLYLIEGDPQSFDDSVFSVDELEKAVVVKIADRQWRYSRFPEVRAARESRIESLHAEREVLSERFATLSFDVQKTQRLHQAFSR--SDPEAEIRQLNSRRVELERALSNHENDNQQQ 301
28 -16.5003u59_A mol:protein length:101 Tropomyosin beta chain  ali model follow..  84  4MEAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQGLQKKLKGTEDEVEKYSESVKEAQEKLEQAEKKATDAEAEVASLNRRIQLVEEE.......................................................................................................................................................................................... 101
29 -16.4004wjg_E mol:protein length:343 Haptoglobin-hemoglobin receptor  ali model follow..  55VSRAVEALTRVDVALQRLKELGKANDTKAVKIIENITSARENLALFNNETQAVLTARDHVHKHRAAALQGWSDAKEKGDAAAEDVWVLLNAAKKGNGSADVKAAAEKSRYSSSSTSETELQKAIDAAANVGGL-SAHKSKYGDVLNKFKLSNASVGAV----RDTSGRGGKHMEKVNNVAKLLKDAEVSLAAAAAEIEEVKNAHETKAQEEMKRNGNPIENESETNSGGNAESQGNGDREDKNDEQQQVDEEETKVENGSSEEGSCCGNESNGPHVMKKRHG.. 332
30 -16.3004ll8_E mol:protein length:235 SWI5-dependent HO expression protein 3  ali model follow..  12  1...MEHMESKLLENLNLLKNENENLNSIFERKNKKLKELEKDYSELSNRYNEQKEKMDQLSKLAKNSSAIEQSCSEKLQNMEVNYNSLL---ESQNLYRDHYSDEISKLNEKIGLLELELSNQNLNYGSDTSSNSDIELNLNKFNDSVKDLKSLETEKDSKLSKIITHSLD-WLNLYQTNENLISTFAEKMDLKDVLKRNDEKISNKGAVVQTLKKNVQTQVESNNADALSSNNAQ................................................ 235
31 -15.9003u1c_A mol:protein length:101 Tropomyosin alpha-1 chain  ali model follow..  71  4MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEERSKQLEDDIVQLEKQLRVTEDSRDQVLEELHKSEDSLLFAEENAAKAESEVASLNRRIQLVEEE.......................................................................................................................................................................................... 101
32 -15.6001nyh_A mol:protein length:166 Regulatory protein SIR4  ali model follow..  10  17.................................................................................................................KQLDDITDSNTTEILTSVDVLGTHSQTGTQQSNMYTSTQKTELEIDNKDSVTECSKDMKEDGLSFVDIVLSKAASALDEKEKQLAVANEIIRSLSDEVMRNEIRITSLQGDLTFTKKCLENARSQISEKDAKINKLMEKDFQVNKEIK....................... 164
33 -15.5004uxv_A mol:protein length:545 SEPTATION RING FORMATION REGULATOR EZRA  ali model follow..  13  95LTAAESSIEKILREISDLVTSEEKSREEIEQVRERYSKSRKNLLAYSHLYGELYDSLEKDLDEIWSGGGNYITARKVLLEQDRNLERLQSYIDDVPKLLADCKQTVPGQIAKLKDGYGEMKEKGYKLEHIELDIDEASAILQLIDENIQSVYQQLEGEVEAGQSVLSKMPELIIAYDKLKEEKEHTKAETELVKESYRLTAGELGKQQ----AFEKRLDEIGKLLSSVKDKLDAEHVAYSLLVEEVASIEKQIEEVKKEHAEYRENLQALRKEELQARETLSNL 405
34 -15.2002fxm_A mol:protein length:129 Myosin heavy chain, cardiac muscle beta isofo  ali model follow..  14  7..................................................................................................................................................KSAEREKEMASMKEEFTRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELTLAK............... 129
35 -14.9002v71_A mol:protein length:189 NUCLEAR DISTRIBUTION PROTEIN NUDE-LIKE 1  ali model follow..  15  1.........................................................................GAMDFSSLKEETAYWKELSMKYKQSFQEARDELVEFQEGSRELEAELEA---QLVQAEQRNRDLQADNQRLKYEVEALKEKLEHQYA---QSYKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIMSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQR----LKDEARDLRQELAVRERQQEVTRK............ 189
36 -14.9003tul_A mol:protein length:158 Cell invasion protein sipB  ali model follow..  12  19.........................................................................................................................................DVSLSQLESRLAVWQAMIESQKEMGIQVSKEFQTALGEAQEATDLYEASIKKTDTAKSVYDAATKKLTQAQNKLQSLDPADPGYAQAEAAVEQAGKEATEAKEALDKATDATVKAGTDAKAKAEKADNILTKFQGTANAA....... 158
37 -14.8004cgk_A mol:protein length:392 SECRETED 45 KDA PROTEIN  ali model follow..  10  28.ETTDDKIAAQDNKISNLTAQQQEAQKQVDQIQEQVSAIQAEQSNLQAENDRLQAESKKLEGEITELSKNIVSRNQSLEKQARSAQTNGAVTSYINKSITEAISRVAAMSEIVSANNKMLEQQKADKKAISEKQVANNDAINTVIANQQKLADDAQALTTKQAELKAAELSLAAEKATAEGEKASLLEQKAAAEAEARAAAVAEAAYKEKRASQQQSVLASANT............................................................ 255
38 -14.7003u0c_A mol:protein length:201 Invasin ipaB  ali model follow..  11  2.........................................................................SQAANDAANKLFSLTIADLTANQNINTTNAHSTSNILIPELKAPKSLNASSQLTLLIGNLIQILEKSLTALTNKITAWKSQQQARQQKNLEFSDKINTLLSETEGLTRDYEKQINKLKNADSKIKDLENKINQIQTRLSELDPESPEKKKLSREEIQLTIKKDAAVKDRTLIEQKTLSIHSKLTDKSMQLEKEIDSF.............. 199
39 -14.6002ocy_A mol:protein length:154 Rab guanine nucleotide exchange factor SEC2  ali model follow..  15  4...............................................................................................................................................LSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLKEDYNTELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLDEANNMVADARKEKYAIEILNKRLTEQLREKDTLLDTLTLQLKNLKKVMHSL 148
40 -14.6003iox_A mol:protein length:497 AgI/II  ali model follow..  10  2................................................................................................ANEADYQAKLTAYQTELARVQKANADAK---AAYEAAVAANNAANAALTAENTAIKKRNADAKA---DYEAKLAKYQADLAKYQKDLADYPVKLKAYEDEQTSIKAALAELEKHKNEDGNLTEPSAQNLVYDLEPNANLSLTTDGKFLKASAVDDAFSKSTSKAKYDQKILQLDDLDITNLEQS.... 179
41 -14.4004q4g_X mol:protein length:472 Peptidoglycan endopeptidase RipA  ali model follow..  11  43.........................TDTIAALIADVAKANQRLQDLSDEVQAEQESVNKAMVDVETARDNAAAAEDDLEVSQRAVKDANAAIAAAQHRFDTFAAATDEIIATVTAAKTLSASSQAVMANLQRARTERVNTESAARLAKQKADKAAADAKASQDAAVAALTETRRKFDEQREEVQRLAAERDAAQARLQAARLVAWSSEGGQGAPPF.................................................................... 248
42 -14.0002nrj_A mol:protein length:346 Hbl B protein  ali model follow..  10  81DTKVKKQLLDTLNGIVEYDTTFDNYYETMVEATGDGETLKEGITDLRGEIQQNQKYAQQLIEELTKLR---DSIGHDVRAFGSNKELLQSILKNQGADVDADQKRLEEVLGSVNYYKQLESDGFNIVGVARDNLGKLEPLLAELRQTVDYKVTLNRVV----GVAYSNINEMHKALDDAINALTYMSTQWHDLDSQYSGVLGHIENAAQKAD---------QNKFKFLKPNLNAAKDSWKTLRTDAVTLKEGIKELKVETVTPQK................... 346
43 -13.9002ysu_B mol:protein length:135 Colicin-E2  ali model follow..  10  1................................................................................................................................................THPVEAAERNYERARAELNQANEDVARNQERQAKAVQVYNSRKSELDAANKTLADAIAEIKQ---FNRFAHDPMAGGHRMWQMAGLKAQRAQTDVNNKQAAFDAAAKEKSDADAALSAAQERRKQKENKEKDAKDKLD.. 135
44 -13.9004m0m_A mol:protein length:756 Putative uncharacterized protein  ali model follow..  482IKHLEQTMDEVRQILES-KNEKGFLWQQINHISPNARQYCEQVKALREHLEHNQVLSDTQKEEIRKAMDRMDNINDSSKDSQQKYREIRREVIELNAKATTPEDDNQLTRSHFQKAYFELSGDTQKTLNLESLSQTLNQGETSMTDKITQRLDGYKNRNWFWNSVKEVLNFFNIPLPKLHSEVK--EQIADKLKERLVDLKEK-----GMGNDVNAITRELGKAREDLIEHYKKTSKLEMG----------ELDKIINKSMEELLVARKVTKDLVHEEVSQVKL 755
45 -13.7003na7_A mol:protein length:256 HP0958  ali model follow..  18  13ISHLDKEIDSLEPLIREKRKDLDKALNDKEAKNKAILNLEEEKLALKLQVSKNEQTLQDTNAKIASIQKKMSEIKS-----ERELRSLNIEEDIAKERSNQANREIENLQNEIKRKSEKQEDLKKEMLELEKLALELESLVEN---EVKNIKETQQIIFKKKEDLVEKTEP................................................................................................................. 175
46 -13.6004ilo_A mol:protein length:257 CT398  ali model follow..  13  14IQELDIKMIRLMRVKKEHQNELAKIQALKTDIRRKVEEKEQEMEKLKDQIKGGEKRIQEISDQINKLENQQAAVKK-----MDEFNALTQEMTAANKERRTLEHQLSDLMDKQAGSEDLLISLKESLSSTENSSSAIEEEIRE---NIRKINEEGRSLLSQRTQLKETTDP................................................................................................................. 176
47 -13.6001ic2_A mol:protein length:81 TROPOMYOSIN ALPHA CHAIN, SKELETAL MUSCLE  ali model follow..  95  1MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEERSKQLEDELVALQKKLKGTEDELDKYSESLKDAQEKLELADKKATD............................................................................................................................................................................................................ 80
48 -13.5001bg1_A mol:protein length:596 PROTEIN (TRANSCRIPTION FACTOR STAT3B)  ali model follow..  10  2............................................................................................QANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMK. 192
49 -13.5002wpq_A mol:protein length:99 TRIMERIC AUTOTRANSPORTER ADHESIN FRAGMENT  ali model follow..  1MKQIEDKIEEILSKIYHIENEIARIKKLIFDTNEKVDQNTADITTNTNSINQNTTDIATNTTNINNLSDSMKQIEDKIEEILSKIYHIENEIARIKKLI......................................................................................................................................................................................... 99
50 -13.2001yvl_A mol:protein length:683 Signal transducer and activator of transcript  ali model follow..  11  40....KQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLENNFLHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQR----FNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQL------LLKKMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWKRRQQSACIGGP---PNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQVLWDRTFSL 308
51 -13.1005cws_D mol:protein length:227 Nucleoporin NUP49  ali model follow..  13  3.EALQQEIAKIDEEIQKCIRDKEAVDAFLPAHGEQLAAIPTDVNFVTRKSEGAHNALSSDILAIDQLRELVKQDADNARLSFKAIDNLKLPMQYHQAGLSKQMGGAGTAGASGASADADGQSNADLISYFSKTADEMEEMMKKFEKTITEIEAHLTGVEAHAMAMQNVAQSRNAAQGGVDERVYELAAVLREFEESILKVAGVVGGVKEGVTELQLR................................................................... 220
52 -13.0004rfx_A mol:protein length:141 Dynactin subunit 1  ali model follow..  15  3...........................................................................................................................................................TTETGYVQGAEKTVDEVKEQVDAAEEMVETLTERNLDLEEKVRELRETVGDLEAMNEMNDELQENARETELELREQLDLAAARVREAEKRVEAAQETVADYQQTIKKYRELTAHLQDVNRELMSQQEA. 133
53 -13.0005dfz_D mol:protein length:559 Vacuolar protein sorting-associated protein 3  ali model follow..  190INRLKSEYDDAIKERDTYAQFLSKLESQNKEISE--SNKEKQYSHNLSEKENLKKEEERLLDQLLRLEMTDDDLDGELVRLQEKKVQLENEKLQKLSDQNLMDLNNIQFNKNLQSLKLQYELSLNQLDKLRK........................................................................................................................................................ 319
54 -12.9004rsi_B mol:protein length:397 Structural maintenance of chromosomes protein  ali model follow..  10  4LEPWDLQLQEKESQIQLAESELSLLEETQAKLKKNVETLEEKILAKKTHKQELQDLILDLKKKLNSLKDERSQGEKNFTSAHLKLKEMQKVLNAHRQRAMEARSSLSKAQNKSKVLTALSRLQKSRLGDLGVIDDSFDVAISTACPRLDDVVVDTVECAQHCIDYLRK-GLMKLGTNQSDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEMEADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEY 391
55 -12.7004xa4_A mol:protein length:209 Xrcc4-MYH7(1551-1609) chimera protein  ali model follow..  11  49.................................................................................TVSESEISQEADDMAMEKGKYVGELRKALLSGAGPADVYTNFSKESCYFFFEKNLKDVSFRLGSFNLEKVENPAEVIRELICYCLDTTAENQAKNEHLQKELEHEEGKILRAQLEFNQIKAEIEKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETRSRN............................................ 209
56 -12.5003tkl_B mol:protein length:267 LidA protein, substrate of the Dot/Icm system  ali model follow..  10  9TSQADKEIQKMLDEYEQAIKRAQENIKKGEELEKKLDKLERQGKDLEDKYKTYEENLEGFEKLLTDSE---ELSLSEINEKMKAFSKDSEKLTQLMEKHKGDEKTVQSLQREHHDIKAKLANLQVLHDAHTGKKSYVNEKGNPVSSLKDAH-NKDQEVVEHKGQFYLLQKGQWDAIKNDPAALEKAQKDYSQSKHDLATIKMEALIHKLSL-EMEKQLETINDLIMSTDPKENEEATKLLHKHNGLNLKLANLQDMLAVHR....................... 267
57 -12.3003tnf_B mol:protein length:384 LidA  ali model follow..  12  2...MLDEYEQAIKRAQENIKKGEELEKKLDKLERQGKDLEDKYKTYEENLEGFEKLLTDSE---ELSLSEINEKMEAFSKDSEKLTQLMEKHKGDEKTVQSLQREHHDIKAKLANLQVLHDAHTGKKSYVNEKGNPVS-SLKDAHLAINKDQEVVEHEGQFYLLQKGQWDAIKNNPAALEKAQKDYSQSKHDLEALIHKLSLEMEQLETINNLIMSTDPKENEEATKLLHKHNGLNLKLANLQDMLAVHRKE................................ 252
58 -12.2005cj4_A mol:protein length:208 Xrcc4-MYH7-(1562-1622) chimera protein  ali model follow..  15  53............................................................................................SEISQEADDMAMEKGKYVGELRKALLSGAGPADVYTFNFSK----ESCYFFFEKNLKDVSFRLGSFN--LEKVENPAEVIRELICYCLDTTAENQAKNEHLQLEFNQIKAEIERLAEKDEEMEQAKRNHLRVVDSLQTSLDAETRSRNEALRVKKKMEGDL............................... 208
59 -12.2001qoy_A mol:protein length:318 HEMOLYSIN E  ali model follow..  32IETADGALDLYNKYLDQVIP--QTFDETIKELSRFKQEASVLVGDIKTLLMDSQDKYFEATQTVYEWCGVATQLLAAYILLFDEYNEKKASIKVLDDGITKLNEAQKSLLVSSQSFNNASGKLLALDSQLTNDFSEKSSYFQSQVDKIRKEAYAGAAAGVVVGPFGLIISYSIAAGVVEGKLIPELKNKLKSVQNFFTTLSNTVKQANKDIDAAKLKLTTEIAAIGEIKTETETTRFYVDYDDLMLSLLKEAAKKMINTCNE...................... 302
60 -12.1004jjy_A mol:protein length:360 Programmed cell death 6-interacting protein  ali model follow..  81IQTVDQLIKELPELLQRNREILDESLRLLDEEEATDNDLRAKRTPSNELYKPLRAEGTNFRTVLDKAVQADGQVKECYQSHRDTIVLLCKPEPELNAAIPAKTMQGSEVVNVLKSLLSNLDEVKKEREGLENDLKSVNFDMTSKFLTALAQDGVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANLR-EEVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKTERRDE................. 356
61 -12.0003jbh_A mol:protein length:1953 MYOSIN 2 HEAVY CHAIN STRIATED MUSCLE  ali model follow..  17 1595IDSMQASLEAEAKGKAEALRMKKKLESDINELEIALDHSNKANAEAQKNIKKYQIQLKETQQALEEEQRARDEVREQYAMSERRCNAMHGELEESRQLLEQADRARRAADSELAELHENVNELSAQNSSLSMAKRKLEGEMQALHADLDEMLNEAKSSEEKAKKAMVDAARLADELRAEQEHAQQQEKMRKAMEGQIKELQVRLDEAEAAAKGGKKIIQKLEQKVRELETELDNEQRRHSEAAKNVRRSERRVKELQFQAEEDRKNQERMQDLVDKLQQKIKTY 1879
62 -11.9004pxt_A mol:protein length:211 Bipolar kinesin KRP-130  ali model follow..  3............................................................................................QQQLLMSKEIQTNLQVIEENNQRHKAMLDSMQEK-TIIDSSLQSVEEHAKQMHKKLEQLGAMSLPDAEELQNLQEELANERALAQQEDALLESMMMQMEQIKNLRSKNSISMSV---HLNKMEESRLTRNHRIDDIKSGIQDYQKLGIESQSAQAELTSQMEAGMLCLDQGVANCSMLQVHMKNLNQKYEK. 192
63 -11.8003l4q_C mol:protein length:170 Phosphatidylinositol 3-kinase regulatory subu  ali model follow..  2...............................................................................................QQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAFNETIKIFEEQGQTQEKKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQELRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLG....................... 169
64 -11.8002e7s_A mol:protein length:135 Rab guanine nucleotide exchange factor SEC2  ali model follow..  16  2...........................................................................................................................................PLGSLEEQLNKSLKTIASQKAAIE-----------NYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLDEANNLVADARMEKYAIEILNKRLTEQLREKDMLLDTLTLQLKNLKKVMHS. 135
65 -11.7005cws_C mol:protein length:208 Nucleoporin NSP1  ali model follow..  10  1.............................................MDEIITRWATDLAKYQKEFKEQAAKVMEWDRLLVENGEKIQKLYTSTYEAERASNEIERQLSNVESQQEELTAWLDRYERELDELKQMGSAAGEQAAGPDQERERTYKLAEKLTDQLDEMGKDLAKMIKEINDMSNTLSKGSKPDDPLTQIVRVLNGHLAQLQ-----IDTNAAALQAKVAAAQKAAGSMGANVP............................................ 193
66 -11.7005cws_E mol:protein length:247 Nucleoporin NUP57  ali model follow..  13  74.....................................................................................PSIVARLMLQRRVITEFNNKLHQINASLDAILSRHDDHTVRAFNARRRHAELSRRCLHLAARVQVLRNRGYALSGDEDELKQKLQQIDKTLND-----PAQGSRLEELWSRLIVLRGYAEDLKDQINQAGITESD-EEIEAKAKKILEDYDKQLQHLKKQVEEAKKDFEEWEKQHN....................... 247
67 -11.6003n4x_A mol:protein length:190 Monopolin complex subunit CSM1  ali model follow..  12  1MDPLTVYKNSVKQQIDSADLLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKELKTQTSQQAENSEVIKDLYEYL........................................................................................................................................................................................................... 81
68 -11.6001hci_A mol:protein length:476 ALPHA-ACTININ 2  ali model follow..  12  167VRALLRKHEAFESDLAAHQDRVEQIAAIAQELNEDAVNVNDRCQKICDQWDRLGTLTQKRREALERMEKLLETIDQLHLEFAKRAAPFNNWMEGAMEDLQDMFEEIQSLITAHEQFKATLPEADGERQSIMAIQNEVEKVIQSYNIR-PYSTVTMDELRTKWDKVKQLVPIRDQSLQEELARQHANERLRRQFAAQANAIGPWIQNKMEEIARSSGALEDQMNQLKQYEHNIINYKNNIDKLEGDHQLIQEDNKHTNYTMEHIRVGWELLLTTIARTINEVET. 470
69 -11.5002pms_C mol:protein length:125 PNEUMOCOCCAL SURFACE PROTEIN A (PSPA)  ali model follow..  15  3...................................................................................................................................................................HMDAEEVAPQAKIAELENQVHRLEQELKEIDESESEDYAKEGFRAPLQSKLDAKKAKLS-KLEELSDKIDELDAEIAKLEDQLKAAEENNNVEDYFKEGLEKTIAAKKAELEKTEADLKK. 121
70 -11.4001ei3_A mol:protein length:491 FIBRINOGEN  ali model follow..  56.............................................IDDTDQNYSQRIDNIRQQLADSQNKYKTSNRVIVETI---NILKPGLEGAQQLDENYGHVSTELRRRIVTLKQRVATQVNRIKALQNSIQEQVVEMKRLEVDIDIKIRACKGSCARSFDYQVD----KEGYDNIQKHLTQASSIDMHPDFQTTTLS-TLKMRPLKDSNVPEHFKLKPSPEMQAMSAFNNIKQMQVVLERPETDHVAE................................ 254
71 -11.4002p01_A mol:protein length:323 Alpha-2-macroglobulin receptor-associated pro  ali model follow..  15  105.....SGTQEDGLDDPRLEKLWHKAKTSGKFSGEELDKLWREFLHHKEKVHEYNETLSRTEEIHENVISPSDLSDIKGSVLHSRHTELKEKLRSINQGLDRLRRVSHQGYSTEAEFEEDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLEIAHEKLRHAESVGDGE-SRSREKHALLEGRTKELGYTVKKHLQDLSGRISRARHNE..................................................................... 322
72 -11.3002ch7_A mol:protein length:309 METHYL-ACCEPTING CHEMOTAXIS PROTEIN  ali model follow..  13  4MKDVQTETFSVAESIEEISKANEEITNQLLGISKEMDNISTRIESISASVQETTAGSEEISSATKNIADSAQQAASFADQSTQLAKEAGDALKKVIEVTRMISNSAKDVERVVESFQKGAEEITSFVETINAIAE--QTNLLALNAAIEEIRKLAEESQQASENVRRVVNEIRSIAEDAGKVSSEITARVEEGTKLADEADEKLNSIVGAVERINEMLQNIAAAIEEQTAAVDEITTAMTENAKNAEEITNSVKEVNARLQEISASTEEVTSRVQTIRENVQML 301
73 -11.3002ieq_A mol:protein length:109 Spike glycoprotein  ali model follow..  1....................................................................................................................................................................................KAINNIVASFSSVNDAITQTAEAIHTVTIALNKIQDVVNQQGSALNHLTSQLRHNFQSGGRGNLTYLNLSSELKQLEAKTASLFQTTVELQGLIDQINSTYVDL 109
74 -11.3002yfa_A mol:protein length:258 METHYL-ACCEPTING CHEMOTAXIS TRANSDUCER  ali model follow..  42...............................................................................................DTAAANTLAKLDAFSKQQAYLATTFKSPEKLLGELGDTISAYKLSLNKMRQGYDATRAARVSMDSSAIRADQAMDALSQEVMARPEADSVRLAQYQLISKARQQLLQ-AENSSANEQAALRQLDAALADTDNLKRQLPSEDARLQQFENAVLAYRDAVRQFRDAVANITTSRAEMTVQGADIVKRSDAL 240
75 -11.1001kql_A mol:protein length:56 Fusion Protein of and striated muscle alpha-t  ali model follow..  67  1....................................................................................................................................................................................................................................MDKVEELLSKNYHLENEVARLKKLVDDLEDELYAQKLKYKAISEELDHALNDMTSI 56

FFAS is supported by the NIH grant R01-GM087218-01
8 5 9 5 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ma H, Xiong H, Liu T, Zhang L, Godzik A., Zhang Z. Aggregate formation and synaptic abnormality induced by DSCR1. J Neurochem. 2004 Mar;88(6):1485-96.