current user: public




2plrA
Query: 2plr_A mol:protein length:213 Probable thymidylate kinase, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210
# Score Template Links and tools%idFirst MKKGVLIAFEGIDGSGKSSQATLLKDWIELKRDVYLTEWNSSDWIHDIIKEAKKKDLLTPLTFSLIHATDFSDRYERYILPMLKSGFIVISDRYIYTAYARDSVRGVDIDWVKKLYSFAIKPDITFYIRVSPDIALERIKKSKRKIKPQEAGADIFPGLSPEEGFLKYQGLITEVYDKLVKDENFIVIDGTKTPKEIQIQIRKFVGELIDNSFLast
1 -100.0002plr_A mol:protein length:213 Probable thymidylate kinase  ali model  100  1MKKGVLIAFEGIDGSGKSSQATLLKDWIELKRDVYLTEWNSSDWIHDIIKEAKKKDLLTPLTFSLIHATDFSDRYERYILPMLKSGFIVISDRYIYTAYARDSVRGVDIDWVKKLYSFAIKPDITFYIRVSPDIALERIKKSKRKIKPQEAGADIFPGLSPEEGFLKYQGLITEVYDKLVKDENFIVIDGTKTPKEIQIQIRKFVGELIDNSF 213
2 -79.6004dwj_A mol:protein length:229 Thymidylate kinase  ali model follow..  22  17NAMSAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLENDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGARGIGVEEVRALNEFALYPDLTIYLNVSAEVGRERIIKNSR------------DQNRLDQEDLKFHEKVIEGYQEIIHSQRFKSVNADQPLENVVEDTYQTIIKYLEK.. 222
3 -79.3002ccg_A mol:protein length:225 THYMIDYLATE KINASE  ali model follow..  22  14.HMSAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLENDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGARGIGVEEVRALNEFALYPDLTIYLNVSAEVGRERIIKNSR------------DQNRLDQEDLKFHEKVIEGYQEIIHSQRFKSVNADQPLENVVEDTYQTIIKYLEK.. 218
4 -78.1004tmk_A mol:protein length:213 PROTEIN (THYMIDYLATE KINASE)  ali model follow..  21  2..RSKYIVIEGLEGAGKTTARNVVVETLEQLRDMVFTREPGGTQLAEKLRSLLLDEVITDKAEVLMFYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGRGIDQHMLATLRDAVFRPDLTLYLDVTPEVGLKRARARGEL-------------DRIEQESFDFFNRTRARYLELAQDKSIHTIDATQPLEAVMDAIRTTVTHWVKE.. 210
5 -77.9003v9p_A mol:protein length:227 Thymidylate kinase  ali model follow..  22  16MARGKFITFEGIDGAGKTTHLQWFCDRLQEGRHVVVTREPGGTRLGETLREILLNQPMDLETEALLMFAGRREHLALVIEPALARGDWVVSDRFTDATFAYQGGRGLPRDKLEALERWVFQPDLTVLFDVPPQIASARRGAVRM-------------PDKFESESDAFFARTRAEYLRRAQPHRFVIVDSSEPIAQIRKQLEGVLAAL..... 221
6 -76.3003lv8_A mol:protein length:236 Thymidylate kinase  ali model follow..  20  18AMNAKFIVIEGLEGAGKSTAIQVVVETLQQNGHITRTREPGGTLLAEKLRALVKEEELQDITELLLVYAARVQLVENVIKPALARGEWVVGDRHDMSSQAYQGGRQIAPSTMQSLKQTAFKPDLTLYLDIDPKLGLERARGRGEL-------------DRIEKMDISFFERARERYLELANDDSVVMIDAAQSIEQVTADIRRALQDWLSQ.. 226
7 -76.3003uwk_A mol:protein length:232 Thymidylate kinase  ali model follow..  21  14HMTGLFVTLEGPEGAGKSTNRDYLAERLREGIEVQLTREPGGTPLAERIRELLLAEPMAADTELLLMFAARAQHLAGVIRPALARGAVVLCDRFTDATYAYQGGRGLPEARIAALESFVLRPDLTLVFDLPVEIGLARAAARGRL-------------DRFEQEDRRFFEAVRQTYLQRAAPERYQVLDAGLPLAEVQAGLDRLLPNLLER.. 221
8 -74.8003ld9_A mol:protein length:223 Thymidylate kinase  ali model follow..  24  12GPGSMFITFEGIDGSGKTTQSHLLAEYLSEVNNVVLTREPGGTLLNESVRNLLFKQGLDSLSELLFFIAMRREHFVKIIKPSLMQKKIVICDRFIDSTIAYQGGQGIDCSLIDQLNDLVVYPDITFIIDVDINESLSRSCK-----------------NGYEFADMEFYYRVRDGFYDIAKPHRCHVITDKSETYDIDDINFVHLEVI..... 211
9 -74.3002wwf_A mol:protein length:212 THYMIDILATE KINASE, PUTATIVE  ali model follow..  26  7KKKGKFIVFEGLDRSGKSTQSKLLVEYLKNNVEVKHLYFPNRETGIGQIISKYLENSMSNETIHLLFSANRWEHMNE-IKSLLLKGIWVVCDRYAYSGVAYSSALNLNKTWCMNPDQGLIKPDVVFYLNVPPNYAQNRSDYGEEIYEKVE-----------------TQKKIYETYKHFAHEDYWINIDATRKIEDIHNDIVKEVTKIKVE.. 203
10 -73.9002pbr_A mol:protein length:195 Thymidylate kinase  ali model follow..  30  1....MLIAFEGIDGSGKTTQAKKLYEYLKQGYFVSLYREPGGTKVGEVLREILLTEELDERTELLLFEASRSKLIEEKIIPDLKRDKVVILDRFVLSTIAYQGGKGLDVEFIKNLNEFAVKPDITLLLDIPVDIALRRLKEK----------------NRFENK--EFLEKVRKGFLELAKEENVVVIDASGEEEEVFKEILRALSGVLR... 194
11 -69.4003hjn_A mol:protein length:197 Thymidylate kinase  ali model follow..  27  1....MFITFEGIDGSGKSTQIQLLAQYLEKGKKVILKREPGGTETGEKIRKILLEEEVTPKAELFLFLASRNLLV-TEIKQYLSEGYAVLLDRYTDSSVAYQGGRNLGKEIVEELNDFALIPDLTFYIDVDVETALKRKGEL----------------NRFEKR--EFLERVREGYLVLARPERIVVLDGKRSIEEIHRDVVREVKRRWK... 194
12 -68.6002v54_A mol:protein length:204 THYMIDYLATE KINASE  ali model follow..  21  1MSRGALIVFEGLDKSGKTTQCMNIMESIPANTIKYLNFPQRSTVTGKMIDDYLTRKTYNDHIVNLLFCANRWEFA-SFIQEQLEQGITLIVDRYAFSGVAYAAAKGASMTLSKSYESGLPKPDLVIFLESGSKEINRNVGEEI--------------------EDVTFQQKVLQEYKKMIEDIHWQIISSEFEEDVKKELIKNIVIEAIHT.. 194
13 -68.3001e9f_A mol:protein length:217 THYMIDYLATE KINASE  ali model follow..  18  6ARRGALIVLEGVDGAGKSTQSRKLVEALCAGHRAELLRFPERSTEIGKLLSSYLQKDVEDHSVHLLFSANRWEQV-PLIKEKLSQGVTLVVDRYAFSGVAFTGAENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGRARGELERYENG---------------AFQERALRCFHQLMKTLNWKMVDASKSIEAVHEDIRVLSEDAIAT.. 206
14 -68.2001e9c_A mol:protein length:215 THYMIDYLATE KINASE  ali model follow..  18  6ARRGALIVLEGVDRAGKSTQSRKLVEALCAGHRAELLRFPERSTEIGKLLSSYLQKDVEDHSVHLLFSANR-WEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAF-----------------GHERYENGAFQERALRCFHQLMKTLNWKMVDASKSIEAVHEDIRVLSEDAIAT.. 204
15 -67.3002xx3_A mol:protein length:232 THYMIDYLATE KINASE  ali model follow..  18  17ARRGALIVLEGVDRAGKSTQSRKLVEALCAGHRAELLRFPERSTEIGKLLSSYLQKDVEDHSVHLLFSANR-WEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAF-----------------GHERYENGAFQERALRCFHQLMKTLNWKMVDASKSIEAVHEDIRVLSEDAIRT.. 215
16 -66.8001tmk_A mol:protein length:216 THYMIDYLATE KINASE  ali model follow..  23  2MGRGKLILIEGLDRTGKTTQCNILYKKLQPN-CKLLKFPERSTRIGGLINEYLTDDQLSDQAIHLLFSANRWEIVDK-IKKDLLEGKNIVMDRYVYSGVAYSAAKGMDLDWCLQPDVGLLKPDLTLFLSTQDVDNNAEKSGFGD--------------ERYETV--KFQEKVKQTFMKLLDDESITIVDVTKGIQEVEALIWQIVEPVLST.. 206
17 -61.1001g3u_A mol:protein length:214 THYMIDYLATE KINASE  ali model follow..  20  1....MLIAIEGVDGAGKRTLVEKLSGAFRAGRSVATLAFPYGQSVAADIAAEALHGEHSVYAMATLFALDRAGAV-HTIQGLCRGYDVVILDRYVASNAAYSAAAGKAAAWVQRIEFARLKPDWQVLLAVSAELAGERSRGRAQR--------DPGRARDNYERDAELQQRTGAVYAELAAGGRWLVVGADVDPGRLAATLAPPDVP...... 213
18 -47.9002a2z_A mol:protein length:248 Deoxycytidine kinase  ali model follow..  16  21GTRIKKISIEGNIAAGKSTFVNILKQLCEDWEVVP-VARWCNVQSTNVLQMMYEKQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGR--------------NEEQGIPLEYLEKLHYKHESWLQEVPILTLDVNEDFKDKYESLVEKVKEFLST.. 247
19 -45.8003qeo_A mol:protein length:279 Deoxycytidine kinase  ali model follow..  17  31GTRIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPVARWSNVQSTQDEFEELTMEQTYACLSMIRAQLASLNGKLKDAEKPVLFFERSVYSARYIFASNLYESESTIYQDWHDWMNNQFLELDGIIYLQATPETCLHRIYLRGRNEE--------------QGIPLEYLEKLHYKHESWLQEVPILTLDVNEDFKDKYESLVEKVKEFLST.. 272
20 -45.1002qrn_A mol:protein length:280 Deoxycytidine kinase  ali model follow..  16  32GTRIKKISIEGNIAAGKSTFVNILKQLCEDEVVPEPVARWCNVQSTQDEFEELTMSQKNGLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECTIYQDWHDWMNNQFLELDGIIYLQATPETCLHRIYLRGRNEE--------------QGIPLEYLEKLHYKHESWLQEVPILTLDVNEDFKDKYESLVEKVKEFLST.. 273
21 -44.2002no0_A mol:protein length:280 Deoxycytidine kinase  ali model follow..  17  32GTRIKKISIEGNIAAGKSTFVNILKQLSEDEVVPEPVARWSNVQSTQDEFEELTMSQKNGLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESTIYQDWHDWMNNQFLELDGIIYLQATPETCLHRIYLRGRNEE--------------QGIPLEYLEKLHYKHESWLQEVPILTLDVNEDFKDKYESLVEKVKEFLST.. 273
22 -44.2003hp1_A mol:protein length:280 Deoxycytidine kinase  ali model follow..  16  32GTRIKKISIEGNIAAGKSTFVNILKQLCEDEVVPEPVARWCNVQSTQDEFEELTMSQKNGLSMIRAQLASLNGKLKDAEKPVLFFERSVYSARYIFASNLYESECTIYQDWHDWMNNQFLELDGIIYLQATPETCLHRIYLRGRNEE--------------QGIPLEYLEKLHYKHESWLQEVPILTLDVNEDFKDKYESLVEKVKEFLST.. 273
23 -42.8001ot3_A mol:protein length:250 Deoxyribonucleoside Kinase  ali model follow..  16  17GTQPFTVLIEGNIGSGKTTYLNHFEKYKN---DICLLTEPVEKWRNVNGVNLLELKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGEQGMYNTLEEWYKFIEQADLIIYLRTSPEVAYERIRQRARSEE--------------SCVPLKYLQELHELHED-PQSCKVLVLDADLNLENIGTEYQRSESSIFD... 227
24 -34.1001nks_A mol:protein length:194 ADENYLATE KINASE  ali model follow..  14  1MK---IGIVTGIPGVGKSTVLAKVKEILDNQG-INNKIINYGDFMLATALKAKDRDEMRKLSVEKQKKLQIDAAKGIAEEARAGGEGYLFIDTHAVIRTPSGYLPGLPSYVITEIN-----PSVIFLLEADPKIILSRQKRDTTRNRNDYS------DESVILETINFARYAATASAVLAGSTVKVIVNVEGDPSIAANEIIRSMK....... 194
25 -33.9001ki9_A mol:protein length:192 adenylate kinase  ali model follow..  13  2..KNKLVVVTGVPGVGGTTITQKAMEKLSEEG-INYKMVNFGTVMFEVAQEENLVEDRDQMRKLDPDTQKRIQKLAGRKIAEMVKESPVVVDTHSTIKTPKGYLPGLPVWVLNELN-----PDIIIVVETSGDEILIRRLNDETRNRDLETTAGI-------EEHQIMNRAAAMTYGVLTGATVKIIQNKNNLLDYAVEELISVLR....... 192
26 -31.1003h86_B mol:protein length:192 Adenylate kinase  ali model follow..  13  2..KNKVVVVTGVPGVGGTTVTQKAMDILSEE-GLNYKMVNFGSAMFDVANEEGLASDRDQMRKLDPETQKRIQKMAGRKIAEMAKESPVAVDTHSTVKTPKGYLPGLPAWVLTELN-----PDIVIVVETDGDEILMRRLSDESRKRDLETTASI-------EEHQFMNRAAAMSYGVLTGATVKIVKNKNGLVDNAVEELMSVLR....... 192
27 -31.1001kht_A mol:protein length:192 adenylate kinase  ali model follow..  12  2..KNKVVVVTGVPGVGSTTSSQLAMDNLRKE-GVNYKMVSFGSVMFEVAKEENLVSDRDQMRKMDPETQKRIQKMAGRKIAEMAKESPVAVDTHSTVSTPKGYLPGLPSWVLNELN-----PDLIIVVETTGDEILMRRMSDETRVRDLDTASTI-------EQHQFMNRCAAMSYGVLTGATVKIVQNRNGLLDQAVEELTNVLR....... 192
28 -29.7002jas_A mol:protein length:206 DEOXYGUANOSINE KINASE  ali model follow..  18  1...HMKIAIFGTVGAGKSTISAEISKKLGYEFKEPVEENPYFEQYYKDLKKTVFKMQLTARSKQLKQAKNLENIIFDRTLLEDPIFMKVNYDLNNVDQTDYNTYIDFYNNVVLENLKIPLSFDIVIYLRVSTKTAISRIKKRGRSEE--------------LLIGEEYWETLNKNYEEFYKQNPFFVVDAELDVKTQIELIMNKLNSIKN... 204
29 -29.2001p6x_A mol:protein length:334 Thymidine kinase  ali model follow..  10  4MVTIVRIYLDGVYGIGKSTTGRVMASAASGGSPTLYFPEPFETDVISGIYDTQNRQSRFTTPYLILHDHTCTLFGGNSLQRGTQPDLTLVFDRHPVASYLLGDMSMCALMAMVATLPREPQGGNIVVTTLNVEEHIRRLRTRAR---------------IGEQIDITLIATLRNVYFMLVNTCHFLATQMDAFQERVSPELGDTLFALFK... 254
30 -27.3002axp_A mol:protein length:173 hypothetical protein BSU20280  ali model follow..  18  3.....LIILEGPDCCFKSTVAAKLSKELKYP-----------------------------KGSSFELAKSGNEKLFEHFNK-LADEDNVIIDRFVYSNLVYADYSILTERQLRFIEDKIKAKAKVVYLHADPSVIKKRLRVRGD-----------------EYIEGKDIDSILELYREVMSNAGTYSWDTGQSSDEIAKDIIFLVEL...... 166
31 -26.6002ocp_A mol:protein length:241 Deoxyguanosine kinase  ali model follow..  15  1..GPRRLSIEGNIAVGKSTFVKLLTKTYPEWHVATNQKACTAQSLGNLLDMMYREPARWSYTFQTFSFLSRLKVQLEPFPEKLLQERSVYSDRYIFAKNLFENGSLSDIEWLLWEFASRITLHGFIYLQASPQVCLKRLYQRA---REEEKGIELAYLEQLHGQHEAWLIHKTTKLHFEALMNIVLVLDVNDDFVTKQEDLMREVNTFVKN.. 240
32 -26.4001osn_A mol:protein length:341 Thymidine kinase  ali model follow..  15  10.MGVLRIYLDGAYGIGKTTAAEEFLHHFATPNRILLIGEPAGEDAICGIYGTQTRRLNGDVAHFQSLFCSPHAIMHAKISALMDTYKIMLSDRHPIASTICFPVGDMSPAALPGLLFTLPPGTNLVVCTVSLPSHLSRVSKRAR---------------PGETVNLPFVMVLRNVYIMLINTIIF............................ 215
33 -23.9002rhm_A mol:protein length:193 Putative kinase  ali model follow..  17  2MQTPALIIVTGHPATGKTTLSQALATGLRL---------------KDAFKEVMFDGLWSDREWSRRVGATAIMMLYHTAATILQSGQSLIME----SNFRVDLDT----ERMQNLHTIAPFTPIQIRCVASGDVLVERILSRIAQGARHPGHCDDRSPADLELV------RSRGDIPPLPLGGPLLTVDTTFPEQIDMNAIVQWVRQHLQS.. 188
34 -22.9001y63_A mol:protein length:184 Lmaj004144AAA protein  ali model follow..  14  7QPKGINILITGTPGTGKTSMAEMIAAELDGFQHL---------EVGKLVKENHFYTEYDTELDTHIIEEKDEDRLLDFMEPIMVSRGNHVVDYHSSELFPERWF------------------HMVVVLHTSTEVLFERLTKRQYSEAKRAENMEAEIQCICEEEARDAYE------------DDIVLVRENDTLEQMAATVEEIRERV..... 175
35 -22.0002bwj_A mol:protein length:199 ADENYLATE KINASE 5  ali model follow..  15  9LRKCKIIFIIGGPGSGKGTQCEKLVEKYGSTGELLREELASESERSKLIRDIMERGDLVPSGIVL-------ELLKEAMVASLGDTRGFLIDGY-------------EVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQMSRSSLPVDDTTKT-----IAKRLEAYYRASIPVIAYYETKTQLHKINAEGTPEDVFLQLCTAIDSIF.... 198
36 -21.9001z83_A mol:protein length:196 Adenylate kinase 1  ali model follow..  16  6LKKTNIIFVVGGPGSGKGTQCEKIVQKYGSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVL-------DMLRDAMVAKVNTSKGFLIDGY-------------EVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEET-----IKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALLN... 196
37 -21.5001uky_A mol:protein length:203 URIDYLATE KINASE  ali model follow..  10  13.DQVSVIFVLGGPGAGKGTQCEKLVKHLSAGDLLRAEQGRAGSQYGELIKNCIKEGQIVPQEITL-----------ALLRNAISDNVKANKHKFLIDGFPRK------MDQAISFERDIVESKFILFFDCPEDIMLERLLERGKTSGRSDDNIES-----IKKRFNTFKETSMPVIEYFETKSKVVRVRCDRSVEDVYKDVQDAIRDSL.... 203
38 -21.0002bdt_A mol:protein length:189 BH3686  ali model follow..  15  1MKK--LYIITGPAGVGKSTTCKRLAAQLDNSAYI------EGDIINHMVVGGYRPPWESDELLALTW-----KNITDLTVNFLLAQNDVVLDYIAFPDEAEALAQTV-------QAKVDDVEIRFIILWTNREELLRRDALRKKDEQMGERCLE-----------------LVEEFESKGIDERYFYNTSHLQPTNLNDIVKNLKTN...... 170
39 -21.0003adk_A mol:protein length:195 ADENYLATE KINASE  ali model follow..  16  6LKKSKIIFVVGGPGSGKGTQCEKIVQKYGSTGDLLRAEVSSGSARGKMLSEIMEKGQLVPLETVL-------DMLRDAMVAKVDTSKGFLIDGY-------------EVKQGEEFERKIGQPTLLLYVDAGPETMTKRLLKRGETSGRVDDNEET-----IKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDDVFSQVCTHLDTL..... 194
40 -20.9003UMF Entity 1(prereleased)  ali follow..  17  20LAKAKVIFVLGGPGSGKGTQCEKLVQKFHSSGDLLRAEVQSGSPKGKELKAMMERGELVPLEVVL-------ALLKEAMIKLVDKNCHFLIDGY-------------ELDQGIKFEKEVCPCLCVINFDVSEEVMRKRLLKRAETSNRVDDNEET-----IVKRFRTFNELTKPVIEHYKQQNKVITIDASGTVDAIFDKVNHELQKF..... 208
41 -20.7001of1_A mol:protein length:376 THYMIDINE KINASE  ali model follow..  15  46MPTLLRVYIDGPHGMGKTTTTQLLVALGSRD-DIVYVPEPASETIANIYTTTSAQITMGMPYAVTDAVLAPHIGGEAGSSHAPPPALTLIFDRYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPG---------------ERLDLAMLAAIRRVYGLLANTVRYTAVPPQGAEPQSNAGPRPHIGDTLFTLF 292
42 -20.0001tev_A mol:protein length:196 UMP-CMP kinase  ali model follow..  11  2..KPLVVFVLGGPGAGKGTQCARIVEHLSAGELLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAA-----AQKNKFLIDGFPRNQ---------NLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRES-----LEKRIQTYLQSTKPIIDLYEEMGKVKKIDASKSVDEVFDEVVQIFDK...... 194
43 -19.4001qf9_A mol:protein length:194 PROTEIN (URIDYLMONOPHOSPHATE/CYTIDYLMONOPHOSP  ali model follow..  12  4.SKPNVVFVLGGPGSGKGTQCANIVRDFGSAGDLLRQEQQSGSKDGEMIATMIKNGEIVPSIVTVKLLKNAIDA---------NQGKNFLVDGFPRNE---------NNNSWEENMKDFVDTKFVLFFDCPEEVMTQRLLKRGESSGRSDDNIES-----IKKRFNTFNVQTKLVIDHYNKFDKVKIIPANRDVNEVYNDVENLFKSM..... 192
44 -19.1001zp6_A mol:protein length:191 hypothetical protein Atu3015  ali model follow..  15  7.LGGNILLLSGHPGSGKSTIAEALANLPGVPKVHF----------SDDLWGYIKHGRIDPWLPQ---NRMIMQIAADVAGRYAKEGYFVILD-------------GVVRPDWLPAFTALARPLHYIVLRTTAAEAIERCLDRGGDSLSDPLVV----------------ADLHSQFADLGAFEHHVLPVSGKDTDQALQSAINALQS...... 175
45 -18.9003iij_A mol:protein length:180 Coilin-interacting nuclear ATPase protein  ali model follow..  16  14......ILLTGTPGVGKTTLGKELASKSGLKY-----------NVGDLAREEQLYDGYDEEYDCPIL----EDRVVDELDNQMREGGVIV-DYHGCDFFPERWF------------------HIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYK------------EEIVHQLPSNKPEELENNVDQILKWI..... 171
46 -18.3003cm0_A mol:protein length:186 Adenylate kinase  ali model follow..  17  1MDVGQAVIFLGPPGAGKGTQASRLAQELGSTGDILRDHVARGTPLGERVRPIMERGDLVP------------DLILELIREELAER--VIFDGFPRTLAQAEALDRL-------LSETGTRLLGVVLVEVPEEELVRRILRRAELEGRSDDNEET-----VRRRLEVYREKTEPLVGYYEARGVLKRVDGLGTPDEVYARIRAALG....... 185
47 -17.7001grq_A mol:protein length:178 CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE  ali model follow..  13  2..TTRMIILNGGSSAGKSGIVRCLQSVLPEPW-LAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRAGAWAEGVVAMARAGARIIIDDVFLGGAAAQE---------RWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYD---------------------VEVDTTHESIECAWAIAAHV........ 176
48 -17.5002vli_A mol:protein length:183 ANTIBIOTIC RESISTANCE PROTEIN  ali model follow..  14  4..RSPIIWINGPFGVGKTHTAHTLHERLPGSFVF------EPEEMGQALRKLTPGFSGDPQEHPMWLMLDALQYASREAAGPLIVPVSISDTARHRRLMSGLKDRGLSV--------------HHFTLIAPLNVVLERLRRDGQPQVNVG--------------------TVEDRLNELRGEQFQTHIDTALGTQQVAEQIAAQVG....... 170
49 -17.4003lw7_A mol:protein length:179 Adenylate kinase related protein (AdkA-like)  ali model follow..  13  2....KVILITGMPGSGKSEFAKLLKER----------------VMSDVVRKRYSIEAKPGERLMDFAKRLREIYGDGVVARLCVE-----LGTSNHDLVVFDGVRSL--AEVEEFKRLLGDSVYIVAVHSPPKIRYKRMIERLRSDDSKEISELIRRDREELKLGIGEVIAMAD-----------YIITNDSNYEEFKRRCEEVTDRVLK... 179
50 -16.3003t61_A mol:protein length:202 Gluconokinase  ali model follow..  14  21......IVVMGVSGSGKSSVGEAIAEAC-------------GYPFIEGDALHPPENIRKMSEGIPLTDDDRWPWLAAIGERLASREPVVVS------------CSALKRSYRDKLRESAPGGLAFVFLHGSESVLAERMHHRTGHFMPSSL------------------QTQLETLEDPRGEVRTVAVDVAQPLAEIVREALAGLARLAEN.. 183
51 -16.3001zak_A mol:protein length:222 ADENYLATE KINASE  ali model follow..  14  2LADPLKVMISGAPASGKGTQCELIKTKYQSAGDLLRAEIAAGSENGKRAKEFMEKGQLVPDEIVVNMVKERLRQ------DAQENG--WLLDGYPRS-----------YSQAMALETLEIRPDTFILLDVPDELLVERVVGRRLDPVTGKIYHLKYSPPENEEIASRLTQRFDDTEEKVKLENIIVKVQGDATVDAVFAKIDELLGSILEK.. 214
52 -15.8003ch4_B mol:protein length:202 Phosphomevalonate kinase  ali model follow..  9.APRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRKEQYAQEHGLNFQRLLDTSTYKEAFRKDMKRQADPGFFCRKIVEGISQPIWLVSDRRVSD--------------IQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFD-----------------------WVIENHGVEQRLEEQLENLIEFIRSR.. 193
53 -15.5002rgx_A mol:protein length:206 Adenylate kinase  ali model follow..  18  3......LVFLGPPGAGKGTQAKRLAKEKGSTGDILREAVQKGTPLGKKAKEYMERGELVP------------DLIIALIEEVFPKHGNVIFDGFPRTVKQAEALDEM-------LEKKGLKVDHVLLFEVPDEVVIERLSGRR-KYNPPPPGVKVIQREDDKPEVIKYREQTAPLIEYYKKKGILRIIDASKPVEEVYRQVLEVIGDG..... 205
54 -15.5003SR0 Entity 1(prereleased)  ali follow..  18  3......LVFLGPPGAGKGTQAKRLAKEKGSTGDILREAVQKGTPLGKKAKEYMERGELVP------------DLIIALIEEVFPKHGNVIFDGFPRTVKQAEALDEM-------LEKKGLKVDHVLLFEVPDEVVIERLSGRR-KYNPPPPGVKVIQREDDKPEVIKYREQTAPLIEYYKKKGILRIIDASKPVEEVYRQVLEVIGDG..... 205
55 -15.3002cdn_A mol:protein length:201 ADENYLATE KINASE  ali model follow..  17  17......VLLLGPPGAGKGTQAVKLAEKLGSTGELFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRLNN------PDAANG--FILDGYPRSVEQAKALHEM-------LERRGTDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYR-----------DQLKTVDAVGTMDEVFARALRALGK...... 195
56 -14.5001aky_A mol:protein length:220 ADENYLATE KINASE  ali model follow..  16  2.SESIRMVLIGPPGAGKGTQAPNLQERFHATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTN-----NPACKNG--FILDGFPRTIPQAEKLDQM-------LKEQGTPLEKAIELKVDDELLVARITGRKEDMKDDVTGEALVQRSDDNADALKYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADILNKLGK...... 219
57 -14.5002qor_A mol:protein length:204 Guanylate kinase  ali model follow..  11  3MARIPPLVVCGPSGVGKGTLIKKVLSEFPSRFRFSISCTTRNKREKET-DDFERKLKEGQFLEFDKYANNFYGTLKSEYDLAVGEGKICLFE--------------MNINGVKQLKESKHIQDGIYIFVKPPSIDILLGRLKNRNTEKPEE----------------INKRMQELTREMADKVGFNYFIVNDDLARTYAELREYLLG...... 190
58 -14.5001uf9_A mol:protein length:203 TT1252 protein  ali model follow..  15  5AKHPIIIGITGNIGSGKSTVAALLRSWLDLDALAARARENKEEELKRLFPEAVVGGRLDALARLVFSDPERLKALEAVVHPEVRRLLMEELSRLEAPLVFLEIPLLFEKGWEGRL-------HGTLLVAAPLEERVRRVMARSGLSREEVLARERAQMPEEEKRKRA------------------WVLENTGSLEDLERALKAVLAELTGGA. 198
59 -14.4001rz3_A mol:protein length:201 hypothetical protein RBSTP0775  ali model follow..  11  20.AGRLVLGIDGLSRSGKTTLANQLSQTLREQGISVCVFHMDDHIVERAKRYHTGNEEWFEYYYLQW-----VEWLTHQLFRQLKASHQLTLPFYSKRTVYLSDSDMIMIEGVFLQRKEWRP-DFVVYLDCPREIRFARENDQVKQN----------------QKFINRYWKAEDYYLETEEPIK-VVFDMT...................... 200
60 -14.4002j41_A mol:protein length:207 GUANYLATE KINASE  ali model follow..  15  4.EKGLLIVLSGPSGVGKGTVRKRIFEDPSTSYKYSISMTTRQMREGEVFKTRDAFEALIKDDQFIEYAEYVGNYYVQYVKDTMDEGHDVFLE------IEVEGAKQVRKKFPDALFIFLAPPSL--------EHLRERLVGRG------------------TESDEKIQSRINEARKEVEMMNLYDYVVVNDEVELAKNRIQCIVEA...... 186
61 -14.2001lvg_A mol:protein length:198 Guanylate kinase  ali model follow..  12  1MAGPRPVVLSGPSGAGKSTLLKKLFQEHSSIFGFSVTRNPRPGEEDGKDYYFVTREMMQRDIAAFIEHAEFSGNLKEAVRAVQAMNRICVLD------VDLQGVRSIKKTDLCPIYIFVQPPSL--------DVLEQRLRLRNT------------------ETEESLAKRLAAARTDMESSKEPGLFDINDDLDKAYATLKQALSE...... 187
62 -14.2003tau_A mol:protein length:208 Guanylate kinase  ali model follow..  13  5TERGLLIVLSGPSGVGKGTVREAVFKDPETSFDYSISMTTRLPREGEQFRSREVFEQAIKDGKMLEYAEYVGNYYLEYVEEKLAAGVDIFLE------IEVQGAMQVRKAMPEGIFIFLTPPDL--------SELKNRIIGRG------------------TESMEVVEERMETAKKEIEMMASYDYAVVNDVVANAVQKIKGIVET...... 188
63 -14.2001knq_A mol:protein length:175 Gluconate kinase  ali model follow..  13  6.HDHHIYVLMGVSGSGKSAVASEVAHQLFLHPRRNIEKMASGEPLNDDDR------------------KPWLQALNDAAFAMQRTNKVSL--------IVCSALKKHYRDLLREGNPNL----SFIYLKGDFDVIESRLKARKG---------HFFKTQMLVTQFETLQE---------ADETDVLVVDIDQPLEGVVASTIEVIKK...... 173
64 -14.1001ak2_A mol:protein length:233 ADENYLATE KINASE ISOENZYME-2  ali model follow..  17  14.PKGVRAVLLGPPGAGKGTQAPKLAKNFCATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVLELIEKNLET------PPCKNG--FLLDGFPRTVRQAEMLDDL-------MEKRKEKLDSVIEFSIPDSLLIRRITGRKEPMKDDITGEPLIRRSDDNKKALKYHTQTTPLVEYYSKRGIHSAIDASQTPDVVFASILAAFSKA..... 231
65 -14.1001z6g_A mol:protein length:218 guanylate kinase  ali model follow..  11  14MNNIYPLVICGPSGVGKGTLIKKLLNEFPNYFYFSVTRKKREKEKEGVDYYFIDKTIFEDKLKNFLEYDNYANNFKSEYDKAKEQNKICLFE--------------MNINGVKQLKKSTHIKNALYIFIKPPSTDVLLSRLLTRNTENQEQ----------------IQKRMEQLNIELANLLNFNLSIINDDLTLTYQQLKNYLLN...... 201
66 -14.0001s4q_A mol:protein length:228 Guanylate kinase  ali model follow..  10  20AAVGRVVVLSGPSAVGKSTVVRCLRERIPNLHFSVTTRAPRPGEVDGVDYHFIDPTRFQQLIDQLLEWAEIHGGLAQPVRAAAATGVPVLIE------VDLAGARAIKKTMPEAVTVFLAPPSW--------QDLQARLIGRG------------------TETADVIQRRLDTARIELAAQGDFDKVVVNRRLESACAELVSLLVG...... 204
67 -13.9001zin_A mol:protein length:217 ADENYLATE KINASE  ali model follow..  14  3......LVLMGLPGAGKGTQAEKIVAAYGSTGDMFRAAMKEGTPLGLQAKQYMDRGDLVPDEVTIGIVRERLSK------DDCQNG--FLLDGFPRTVAQAEALETM-------LADIGRKLDYVIHIDVRQDVLMERLTGRAKPGVCDKCGGELYQRADDNEATVANMKQMKPLVDFYEQKGYLRNINGEQDMEKVFADIRELLGGL..... 215
68 -13.9002xb4_A mol:protein length:223 ADENYLATE KINASE  ali model follow..  14  3......ILIFGPNGSGKGTQGNLVKDKYSESGGIFREHIGGGTELGKKAKEFIDRGDLVPDDITI-------PMVLETLESKGKDG--WLLDGFPRNTVQAQKLFEA-------LQEKGMKINFVIEILLPREVAKNRIMGRGALSARADDQDEGAINKRHDYNTVDGTLAAAYYYKNMAAKEGYIELDGEGSIDSIKDTLLAQLA....... 223
69 -13.9003dl0_A mol:protein length:216 Adenylate kinase  ali model follow..  13  3......LVLMGLPGAGKGTQGERIVEKYGSTGDMFRAAMKEETPLGLEAKSYIDKGELVPDEVTIGIVKERLGK------DDCERG--FLLDGFPRTVAQAEALEEI-------LEEMGKPIDYVINIQVDKDVLMERLTGRKTPGICDKDGGELYQRADDNEETVTNMKQTAPLLDFYDEKGYLVNVNGQQDIQDVYADLKVLLGGL..... 215
70 -13.9002c9y_A mol:protein length:242 ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL  ali model follow..  17  14.PKGIRAVLLGPPGAGKGTQAPRLAENFCATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLET------PLCKNG--FLLDGFPRTVRQAEMLDDL-------MEKRKEKLDSVIEFSIPDSLLIRRITGRKEPMKDDITGEPLIRRSDDNEKALKYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCK.. 234
71 -13.8003dkv_A mol:protein length:217 Adenylate kinase  ali model follow..  13  3......IVLMGLPGAGKGTQAERIVEKYGSTGDMFRAAMKEETPLGLEAKSYIDKGELVPDEVTIGIVRERLSK------SDCERG--FLLDGFPRTVAQAEALEEI-------LEEMGRPIDYVINIQVDKEELMERLTGRKTPGICDKDGGELYQRADDNEETVTNMKQTAPLLAFYDSKEVLVNVNGQQDIQDVFADVKVILGGL..... 215
72 -13.8003fb4_A mol:protein length:216 Adenylate kinase  ali model follow..  15  3......IVLMGLPGAGKGTQAEQIIEKYESTGDMFRAAIKNGTELGLKAKSFMDQGNLVPDEVTIGIVHERLSK------DDCQKG--FLLDGFPRTVAQADALDSL-------LTDLGKKLDYVLNIKVEQEELMKRLTGRAVEGICDKDGGELYQRIDDKPETVKNMKQTQPLLDFYSQKGVLKDIDGQQDIKKVFVDINDLLGGL..... 215
73 -13.8003tr0_A mol:protein length:205 Guanylate kinase  ali model follow..  13  4MNKANLFIISAPSGAGKTSLVRALVKALAEIKISITTRPKRPGDQEGVDYFFIDETRFQAMVKAFLEHATIYERHKDWVLRQLKAGRDVLLE------IDWQGARQIRELFPPALSIFILPPSI--------EALRERLIKRR------------------QDDTAIIEQRLALAREEMAHYKEFDYLVVNDNFDQAVQNLIHIISA...... 186
74 -13.8002p5t_B mol:protein length:253 PezT  ali model follow..  30.KQPIAILLGGQSGAGKTTIHRIKQKEFQGNIVII-----DGDSFRSQHPHYLELQQEYGKDSVEYTKDFAGKMVESLVTKLSSLGYNLLIEGTLRTVDVPK-------KTAQLLKNKGYEVQL-ALIATKPELSYLSTLIRYEELYIINPNQARATPKEHHDFIVNHLVDNTRKLEELAIFERIQIYQRDRSCVYDSKENTTSAADVLQELF 228
75 -13.8001p3j_A mol:protein length:217 Adenylate kinase  ali model follow..  13  3......LVLMGLPGAGKGTQGERIVEDYGSTGDMFRAAMKEETPLGLEAKSYIDKGELVPDEVTIGIVKERLGK------DDCERG--FLLDGFPRTVAQAEALEEI-------LEEYGKPIDYVINIEVDKDVLMERLTGRKTPGICDKDGGELYQRADDNEETVSNMKQTQPLLDFYSEKGYLANVNGQQDIQDVYADVKDLLGGL..... 215

FFAS is supported by the NIH grant R01-GM087218-01
6 1 9 4 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab

Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.