current user: public




Query: 2plr_A mol:protein length:213 Probable thymidylate kinase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210
# Score Template Links and tools%idFirst MKKGVLIAFEGIDGSGKSSQATLLKDWIELKRDVYLTEWNSSDWIHDIIKEAKKKDLLTPLTFSLIHATDFSDRYERYILPMLKSGFIVISDRYIYTAYARDSVRGVDIDWVKKLYSFAIKPDITFYIRVSPDIALERIKKSKRKIKPQEAGADIFPGLSPEEGFLKYQGLITEVYDKLVKDENFIVIDGTKTPKEIQIQIRKFVGELIDNSFLast
1 -102.0002plr_A mol:protein length:213 Probable thymidylate kinase  ali model  100  1MKKGVLIAFEGIDGSGKSSQATLLKDWIELKRDVYLTEWNSSDWIHDIIKEAKKKDLLTPLTFSLIHATDFSDRYERYILPMLKSGFIVISDRYIYTAYARDSVRGVDIDWVKKLYSFAIKPDITFYIRVSPDIALERIKKSKRKIKPQEAGADIFPGLSPEEGFLKYQGLITEVYDKLVKDENFIVIDGTKTPKEIQIQIRKFVGELIDNSF 213
2 -77.4002ccg_A mol:protein length:225 THYMIDYLATE KINASE  ali model follow..  22  13SHMSAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLENDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGARGIGVEEVRALNEFAIYPDLTIYLNVSAEVGRERIIKNSR------------DQNRLDQEDLKFHEKVIEGYQEIIHSQRFKSVNADQPLENVVEDTYQTIIKYLEK.. 218
3 -77.0004dwj_A mol:protein length:229 Thymidylate kinase  ali model follow..  22  17NAMSAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLENDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGARGIGVEEVRALNEFAIYPDLTIYLNVSAEVGRERIIKNSR------------DQNRLDQEDLKFHEKVIEGYQEIIHSQRFKSVNADQPLENVVEDTYQTIIKYLEK.. 222
4 -73.2002pbr_A mol:protein length:195 Thymidylate kinase  ali model follow..  30  1....MLIAFEGIDGSGKTTQAKKLYEYLKQGYFVSLYREPGGTKVGEVLREILLTEELDERTELLLFEASRSKLIEEKIIPDLKRDKVVILDRFVLSTIAYQGGKGLDVEFIKNLNEFAVKPDITLLLDIPVDIALRRLKEKNR-------------------ENKEFLEKVRKGFLELAKEENVVVIDASGEEEEVFKEILRALSGVLR... 194
5 -72.4003ld9_A mol:protein length:223 Thymidylate kinase  ali model follow..  24  12GPGSMFITFEGIDGSGKTTQSHLLAEYLSEVNNVVLTREPGGTLLNESVRNLLFKQGLDSLSELLFFIAMRREHFVKIIKPSLMQKKIVICDRFIDSTIAYQGGQGIDCSLIDQLNDLVVYPDITFIIDVDINESLSRSCK-----------------NGYEFADMEFYYRVRDGFYDIAKPHRCHVITDKSETYDIDDINFVHLEVI..... 211
6 -71.9002wwf_A mol:protein length:212 THYMIDILATE KINASE, PUTATIVE  ali model follow..  26  7KKKGKFIVFEGLDRSGKSTQSKLLVEYLNNNVEVKHLYFPNRETGIGQIISKYLENSMSNETIHLLFSANRWEHMNE-IKSLLLKGIWVVCDRYAYSGVAYSSGLNLNKTWCMNPDQGLIKPDVVFYLNVPPNYAQNRSDYGEEIYEKVE-----------------TQKKIYETYKHFAHEDYWINIDATRKIEDIHNDIVKEVTKIKVE.. 203
7 -71.4003v9p_A mol:protein length:227 Thymidylate kinase  ali model follow..  22  16MARGKFITFEGIDGAGKTTHLQWFCDRLQEGRHVVVTREPGGTRLGETLREILLNQPMDLETEALLMFAGRREHLALVIEPALARGDWVVSDRFTDATFAYQGGRGLPRDKLEALERWVFQPDLTVLFDVPPQIASARRGAVRMP-------------DKFESESDAFFARTRAEYLRRAQPHRFVIVDSSEPIAQIRKQLEGVLAAL..... 221
8 -69.6003hjn_A mol:protein length:197 Thymidylate kinase  ali model follow..  27  1....MFITFEGIDGSGKSTQIQLLAQYLEKGKKVILKREPGGTETGEKIRKILLEEEVTPKAELFLFLASRNLLVTE-IKQYLSEGYAVLLDRYTDSSVAYQGGRNLGKEIVEELNDFALIPDLTFYIDVDVETALKRKGELNR-------------------EKREFLERVREGYLVLARPERIVVLDGKRSIEEIHRDVVREVKRRWKLDV 197
9 -69.0002v54_A mol:protein length:204 THYMIDYLATE KINASE  ali model follow..  21  1MSRGALIVFEGLDKSGKTTQCMNIMESIPANTIKYLNFPQRSTVTGKMIDDYLTRKTYNDHIVNLLFCANRWEFASF-IQEQLEQGITLIVDRYAFSGVAYAAAKGASMTLSKSYESGLPKPDLVIFLESGSKEINRNVGEEI--------------------EDVTFQQKVLQEYKKMIEDIHWQIISSEFEEDVKKELIKNIVIEAIHT.. 194
10 -69.0004e5u_A mol:protein length:213 Thymidylate kinase  ali model follow..  20  4.MTGLFVTLEGPEGAGKSTNRDYLAERLREGIEVQLTREPGGTPLAERIRELLLAEPMAADTELLLMFAARAQHLAGVIRPALARGAVVLCDRFTDATYAYQGGRGLPEARIAALESFVLRPDLTLVFDLPVEIGLARAAARG-------------RLDRFEQEDRRFFEAVRQTYLQRAAPERYQVLDAGLPLAEVQAGLDRLLPNLLER.. 210
11 -68.9003uwk_A mol:protein length:232 Thymidylate kinase  ali model follow..  20  14HMTGLFVTLEGPEGAGKSTNRDYLAERLREGIEVQLTREPGGTPLAERIRELLLAEPMAADTELLLMFAARAQHLAGVIRPALARGAVVLCDRFTDATYAYQGGRGLPEARIAALESFVLRPDLTLVFDLPVEIGLARAAARG-------------RLDRFEQEDRRFFEAVRQTYLQRAAPERYQVLDAGLPLAEVQAGLDRLLPNLLER.. 221
12 -68.8004tmk_A mol:protein length:213 PROTEIN (THYMIDYLATE KINASE)  ali model follow..  21  2..RSKYIVIEGLEGAGKTTARNVVVETLEQLRDMVFTREPGGTQLAEKLRSLLLDEVITDKAEVLMFYAARVQLVETVIKPALANGTWVIGDRHDLSTQAYQGGRGIDQHMLATLRDAVFRPDLTLYLDVTPEVGLKRARARG-------------ELDRIEQESFDFFNRTRARYLELAQDKSIHTIDATQPLEAVMDAIRTTVTHWVKE.. 210
13 -68.7003lv8_A mol:protein length:236 Thymidylate kinase  ali model follow..  20  18AMNAKFIVIEGLEGAGKSTAIQVVVETLQQNGHITRTREPGGTLLAEKLRALVKEEELQDITELLLVYAARVQLVENVIKPALARGEWVVGDRHDMSSQAYQGGRQIAPSTMQSLKQTAFKPDLTLYLDIDPKLGLERARGRG-------------ELDRIEKMDISFFERARERYLELANDDSVVMIDAAQSIEQVTADIRRALQDWLSQ.. 226
14 -68.0001e9f_A mol:protein length:217 THYMIDYLATE KINASE  ali model follow..  20  6ARRGALIVLEGVDGAGKSTQSRKLVEALCAGHRAELLRFPESTEIGKLLSSYLQKKDVEDHSVHLLFSANR-WEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGRARGELERYENG---------------AFQERALRCFHQLMKTLNWKMVDASKSIEAVHEDIRVLSEDAIAT.. 206
15 -64.7001tmk_A mol:protein length:216 THYMIDYLATE KINASE  ali model follow..  22  2MGRGKLILIEGLDRTGKTTQCNILYKKLQPNC-KLLKFPERSTRIGGLINEYLTDDQLSDQAIHLLFSANRWEIVDK-IKKDLLEGKNIVMDRYVYSGVAYSAAKGMDLDWCLQPDVGLLKPDLTLFLSTQDVDNNAEKSG----------------FGDERYETVKFQEKVKQTFMKLLDDESITIVDVTKGIQEVEALIWQIVEPVLST.. 206
16 -63.1001e9c_A mol:protein length:215 THYMIDYLATE KINASE  ali model follow..  20  6ARRGALIVLEGVDRAGKSTQSRKLVEALCAGHRAELLRFPESTEIGKLLSSYLQKKDVEDHSVHLLFSANRWEQV-PLIKEKLSQGVTLVVDRYAFSGVAYTGAENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGA-----------------FQERALRCFHQLMKDTNWKMVDASKSIEAVHEDIRVLSEDAIAT.. 204
17 -62.1002xx3_A mol:protein length:232 THYMIDYLATE KINASE  ali model follow..  20  17ARRGALIVLEGVDRAGKSTQSRKLVEALCAGHRAELLRFPESTEIGKLLSSYLQKKDVEDHSVHLLFSANRWEQV-PLIKEKLSQGVTLVVDRYAFSGVAFTGAENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGA-----------------FQERALRCFHQLMKDTNWKMVDASKSIEAVHEDIRVLSEDAIRT.. 215
18 -45.6001g3u_A mol:protein length:214 THYMIDYLATE KINASE  ali model follow..  19  1....MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHT-IQGLCRGYDVVILDRYVASNAAYSAAR---AAWVQRIE--LPKPDWQVLLAVSAELAGERSRGRAQR--------DPGRARDNYERDAELQQRTGAVYAELAAQGRWLVVGADVDPGRLAATLAPPDVP...... 213
19 -30.2002axp_A mol:protein length:173 hypothetical protein BSU20280  ali model follow..  17  3.....LIILEGPDCCFKSTVAAKLSKELKYP-----------------------------KGSSFELAKSGNEKLFEHFNKLADEDNVII-DRFVYSNLVYADYSILTERQLRFIEDKIKAKAKVVYLHADPSVIKKRLRVRGD-----------------EYIEGKDIDSILELYREVMSNAGLHTYSGQWSSDEIAKDIIFLVEL...... 166
20 -29.0001ki9_A mol:protein length:192 adenylate kinase  ali model follow..  13  2..KNKLVVVTGVPGVGGTTITQKAMEKLSEEG-INYKMVNFGTVMFEVAQEENLVEDRDQMRKLDPDTQKRIQKLAGRKIAEMVKESPVVVDTHSTIKTPKGYLPGLPVWVLNELN-----PDIIIVVETSGDEILIRRLNDETRNRDLETTAGI-------EEHQIMNRAAAMTYGVLTGATVKIIQNKNNLLDYAVEELISVLR....... 192
21 -28.2001kht_A mol:protein length:192 adenylate kinase  ali model follow..  14  2..KNKVVVVTGVPGVGSTTSSQLAMDNLRKEGVNYKMVSFGSVMFEVAKEENLVSDRDQMRKMDPETQKRIQKMAGRKIAEMAKESPVAV-DTHSTVSTPKGYLPGLPSWVLNELN-----PDLIIVVETTGDEILMRRMSDETRVRDLDTASTI-------EQHQFMNRCAAMSYGVLTGATVKIVQNRNGLLDQAVEELTNVLR....... 192
22 -24.5003h86_B mol:protein length:192 Adenylate kinase  ali model follow..  13  2..KNKVVVVTGVPGVGGTTVTQKAMDILSEE-GLNYKMVNFGSAMFDVANEEGLASDRDQMRKLDPETQKRIQKMAGRKIAEMAKESPVAVDTHSTVKTPKGYLPGLPAWVLTELN-----PDIVIVVETDGDEILMRRLSDESRKRDLETTASI-------EEHQFMNRAAAMSYGVLTGATVKIVKNKNGLVDNAVEELMSVLR....... 192
23 -23.2001nks_A mol:protein length:194 ADENYLATE KINASE  ali model follow..  12  1MK---IGIVTGIPGVGKSTVLAKVKEILDNQG-INNKIINYGDFMLATALKLGYAKDRDEMRKL---SVEKQKKLQIDAAKGIGGEGYLFIDTHAVIRTPSGYLPGLPSYVITEIN-----PSVIFLLEADPKIILSRQKRDTTRNR------NDYSDESVILETINFARYAATASAVLAGSTVKVIVNVEGDPSIAANEIIRSMK....... 194
24 -22.8001z83_A mol:protein length:196 Adenylate kinase 1  ali model follow..  16  6LKKTNIIFVVGGPGSGKGTQCEKIVQKYGSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVL-------DMLRDAMVAKVNTSKGFLIDGY-------------EVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEE-----TIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALLN... 196
25 -22.8002rhm_A mol:protein length:193 Putative kinase  ali model follow..  14  2MQTPALIIVTGHPATGKTTLSQALATGLRL---PLLSKDAFKEVMFDGWSDREWSRRVGATAIMMLY---------HTAATILQSGQSLIMESNFRVDLDTERMQNLHTIAPFTP--------IQIRCVASGDVLVERILSRIAQGARHPGHCDDRSPADLEL-------RSRGDIPPLPLGGPLLTVDTTFPEQIDMNAIVQWVRQHLQS.. 188
26 -22.5002bwj_A mol:protein length:199 ADENYLATE KINASE 5  ali model follow..  15  9LRKCKIIFIIGGPGSGKGTQCEKLVEKYGSTGELLREELASESERSKLIRDIMERGDLVPSGIVL-------ELLKEAMVASLGDTRGFLIDGY-------------EVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQMSRSSLPVDDTTK-----TIAKRLEAYYRASIPVIAYYETKTQLHKINAEGTPEDVFLQLCTAIDSIF.... 198
27 -21.6003adk_A mol:protein length:195 ADENYLATE KINASE  ali model follow..  16  6LKKSKIIFVVGGPGSGKGTQCEKIVQKYGSTGDLLRAEVSSGSARGKMLSEIMEKGQLVPLETVL-------DMLRDAMVAKVDTSKGFLIDGY-------------EVKQGEEFERKIGQPTLLLYVDAGPETMTKRLLKRGETSGRVDDNEE-----TIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDDVFSQVCTHLDTL..... 194
28 -21.5002no0_A mol:protein length:280 Deoxycytidine kinase  ali model follow..  16  33.TRIKKISIEGNIAAGKSTFVNILKQLSEEFEELTMSQKNGGNVLQMMYEKPER-----SFTFQTYACLSRIRAQLASLNGKLKDARSVYSDRYIFASNLYESESMNETEWMNNQFGQSLELDGIIYLQATPETCLHRIYLRG---RNEEQGIPLEYLEKLHYKHESWLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLST.. 273
29 -21.5003umf_A mol:protein length:217 Adenylate kinase  ali model follow..  17  20LAKAKVIFVLGGPGSGKGTQCEKLVQKFHSSGDLLRAEVQSGSPKGKELKAMMERGELVPLEVVL-------ALLKEAMIKLVDKNCHFLIDGY-------------ELDQGIKFEKEVCPCLCVINFDVSEEVMRKRLLKRAETSNRVDDNEE-----TIVKRFRTFNELTKPVIEHYKQQNKVITIDASGTVDAIFDKVNHELQKFGVK.. 211
30 -21.5002qrn_A mol:protein length:280 Deoxycytidine kinase  ali model follow..  16  33.TRIKKISIEGNIAAGKSTFVNILKQLCEEFEELTMSQKNGGNVLQMMYEKPER-----SFTFQTYACLSRIRAQLASLNGKLKDARSVYSDRYIFASNLYESECMNETEWMNNQFGQSLELDGIIYLQATPETCLHRIYLRG---RNEEQGIPLEYLEKLHYKHESWLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLST.. 273
31 -21.4002a2z_A mol:protein length:248 Deoxycytidine kinase  ali model follow..  17  22.TRIKKISIEGNIAAGKSTFVNILKQLCEDPEPVARWCNVQSTNVLQMMYEKPERWSFTFQTYACLQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWMNNQFGQSLELDGIIYLQATPETCLHRIYLRG---RNEEQGIPLEYLEKLHYKHESWLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLST.. 247
32 -20.8001ot3_A mol:protein length:250 Deoxyribonucleoside Kinase  ali model follow..  16  18.TQPFTVLIEGNIGSGKTTYLNHFEKYKN---DICLLTEPGVNLLELMYKDP---KKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMY---EESIHVQADLIIYLRTSPEVAYERIRQRARSEE--------------SCVPLKYLQELHELHEDWLIHQRVLVLDADLNLENIGTEYQRSESSIFD... 227
33 -20.7003qeo_A mol:protein length:279 Deoxycytidine kinase  ali model follow..  15  32.TRIKKISIEGNIAAGKSTFVNILKQLSEDFEELTMEQKNGGNVLQMMYEKPER-----SFTFQTYACLSMIRAQLASLNGKLKDARSVYSARYIFASNLYESESMNETEWMNNQFGQSLELDGIIYLQATPETCLHRIYLRG---RNEEQGIPLEYLEKLHYKHESWLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLST.. 272
34 -20.6001uky_A mol:protein length:203 URIDYLATE KINASE  ali model follow..  11  13.DQVSVIFVLGGPGAGKGTQCEKLVKHLSAGDLLRAEQGRAGSQYGELIKNCIKEGQIVPQEITL-----------ALLRNAISDNVKANKHKFLIDGFPRK------MDQAISFERDIVESKFILFFDCPEDIMLERLLERGKTSGRSDDNIE-----SIKKRFNTFKETSMPVIEYFETKSKVVRVRCDRSVEDVYKDVQDAIRDSL.... 203
35 -20.6003hp1_A mol:protein length:280 Deoxycytidine kinase  ali model follow..  15  33.TRIKKISIEGNIAAGKSTFVNILKQLCEEFEELTMSQKNGGNVLQMMYEKPER-----SFTFQTYACLSMIRAQLASLNGKLKDARSVYSARYIFASNLYESECMNETEWMNNQFGQSLELDGIIYLQATPETCLHRIYLRG---RNEEQGIPLEYLEKLHYKHESWLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLST.. 273
36 -19.8001y63_A mol:protein length:184 Lmaj004144AAA protein  ali model follow..  14  7QPKGINILITGTPGTGKTSMAEMIAAELDGFQHL---------EVGKLVKENHFYTEYDTELDTHIIEEKDEDRLLDFMEPIMVSRGNHVVDYHSSELFPERWF------------------HMVVVLHTSTEVLFERLTKRQYSEAKRAENMEAEIQCICEEEARDAYE------------DDIVLVRENDTLEQMAATVEEIRE....... 173
37 -19.5001p6x_A mol:protein length:334 Thymidine kinase  ali model follow..  10  4MVTIVRIYLDGVYGIGKSTTGRVMASAASGGSPTLYFPEPGNLAVDDAALITAHYQSRFTTPYLILHDHTCTLFGGNSLQRGTQPDLTLVFDRHPVASYLLGDMSMCALMAMVATLPREPQGGNIVVTTLNVEEHIRRLRTRARIGEQID---------------ITLIATLRNVYFMLVNTCHFL........................... 207
38 -19.1002jas_A mol:protein length:206 DEOXYGUANOSINE KINASE  ali model follow..  18  2....MKIAIFGTVGAGKSTISAEISKKL--GYEIFKEPVEENPYFEQYYKDLKK-----VFKMQIYMLTARSKQLKQ-----AKNLENIIFDRTLLEDPTYIDFYNNVVLENLKIPENKLSFDIVIYLRVSTKTAISRIKKRGRSEE--------------LLIGEEYWETLNKNYEEFYKQNPFFVVDAELDVKTQIELIMNKLNSIKNPN. 206
39 -18.9002bdt_A mol:protein length:189 BH3686  ali model follow..  15  1MKK--LYIITGPAGVGKSTTCKRLAAQLDNSAYI------EGDIINHMVVGGYRPPWESDELLALTW-----KNITDLTVNFLLAQNDVVLDYIAFPDEAEALAQTV-------QAKVDDVEIRFIILWTNREELLRRDALRKKDEQMGERCLE-----------------LVEEFESKGIDERYFYNTSHLQPTNLNDIVKNLKTN...... 170
40 -18.8001tev_A mol:protein length:196 UMP-CMP kinase  ali model follow..  12  2..KPLVVFVLGGPGAGKGTQCARIVEHLSAGELLRDERKNPDSQYGELIEKYIKEGKIVPVEITI----SLLKREMDQTMAANAQKNKFLIDGFPRNQ---------NLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRE-----SLEKRIQTYLQSTKPIIDLYEEMGKVKKIDASKSVDEVFDEVVQIFDKE..... 195
41 -18.6001qf9_A mol:protein length:194 PROTEIN (URIDYLMONOPHOSPHATE/CYTIDYLMONOPHOSP  ali model follow..  13  4.SKPNVVFVLGGPGSGKGTQCANIVRDFGSAGDLLRQEQQSGSKDGEMIATMIKNGEIVPSIVTV-------KLLKNAIDANQGKNFLV--DGFPRNE---------NNNSWEENMKDFVDTKFVLFFDCPEEVMTQRLLKRGESSGRSDDNIE-----SIKKRFNTFNVQTKLVIDHYNKFDKVKIIPANRDVNEVYNDVENLFKSM..... 192
42 -17.5002ocp_A mol:protein length:241 Deoxyguanosine kinase  ali model follow..  16  4.....RLSIEGNIAVGKSTFVKLLTKTYPEGNQKACTAQSLGNLLDMMYREPAR-----SYTFQTFSFLSRLKVQLEPFPEKLLQARSVYSDRYIFAKNLFENGSLSDIEWLLWEFASRITLHGFIYLQASPQVCLKRLYQRA---REEEKGIELAYLEQLHGQHEAWIHKTTKLHFEALMNIPVLVLDVNDDFSEEVTKQEDLMREV..... 234
43 -17.4003cm0_A mol:protein length:186 Adenylate kinase  ali model follow..  17  1MDVGQAVIFLGPPGAGKGTQASRLAQELGSTGDILRDHVARGTPLGERVRPIMERGDLVPDDLIL-----------ELIREELAER--VIFDGFPRTLAQAEALDRL-------LSETGTRLLGVVLVEVPEEELVRRILRRAELEGRSDDNEET-----VRRRLEVYREKTEPLVGYYEARGVLKRVDGLGTPDEVYARIRAAL........ 184
44 -17.3001zp6_A mol:protein length:191 hypothetical protein Atu3015  ali model follow..  15  7.LGGNILLLSGHPGSGKSTIAEALANLPGVPKVHF----------SDDLWGYIKHGRIDPLPQSHQQNRMIMQIAADVAGRYAKEGYFVILDGVVRPDWL-------------PAFTALARPLHYIVLRTTAAEAIERCLDRGGDSLSDPL------------------ADLHSQFADLGAFEHHVLPVSGKDTDQALQSAINALQS...... 175
45 -17.1001of1_A mol:protein length:376 THYMIDINE KINASE  ali model follow..  13  46MPTLLRVYIDGPHGMGKTTTTQLLVALGSRD-DIVYVPEP--ANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAALTLIFDRYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLD---------------LAMLAAIRRVYGLLANTVRYL........................... 249
46 -17.0001osn_A mol:protein length:341 Thymidine kinase  ali model follow..  14  10.MGVLRIYLDGAYGIGKTTAAEEFLHHFATPNRILLIGEPGEDAICGIYGTQTRRLNGDVSPEDASLFCSPHAIMHAKISALMDTYKIMLSDRHPIASYLVGDMSPAALPGLLFTLPAEPPGTNLVVCTVSLPSHLSRVSKRARPGETVN---------------LPFVMVLRNVYIMLINTIIFL........................... 216
47 -16.0002p0e_A mol:protein length:207 Nicotinamide riboside kinase 1  ali model follow..  12  13.SKTFIIGISGVTNSGKTTLAKNLQKHLP---NCSVISQDDFFKPESEIEEALNMEKMMSAISCWMESARHSVVSTDQE--SAEEIPILIIEGFL----------------LFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVY---------------QPPDSPGYFDGHVWPMYLKYRQEWEVVYLDGTKSEEDLFLQVYEDLIQEL.... 201
48 -15.9002vli_A mol:protein length:183 ANTIBIOTIC RESISTANCE PROTEIN  ali model follow..  14  4..RSPIIWINGPFGVGKTHTAHTLHERLPGSFVF------EPEEMGQALRKLTPGFSGDPQEHPMWLMLDALQYASREAAGPLIVPVSISDTARHRRLMSGLKDRGLSV--------------HHFTLIAPLNVVLERLRRDGQPQVNVG--------------------TVEDRLNELRGEQFQTHIDTALGTQQVAEQIAAQVG....... 170
49 -15.8002qg6_A mol:protein length:199 Nicotinamide riboside kinase 1  ali model follow..  12  2..KTFIIGISGVTNSGKTTLAKNLQKHLP---NCSVISQDDFFKPESEIEEALNMEKMMSAISCWMESARHSVVSTDQE--SAEEIPILIIEGFL----------------LFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVY---------------QPPDSPGYFDGHVWPMYLKYRQEWEVVYLDGTKSEEDLFLQVYEDLIQELAKQ. 192
50 -15.6004cvn_A mol:protein length:191 PUTATIVE ADENYLATE KINASE  ali model follow..  20  3.AMGMLIAITGTPGVGKTTIAKLLAEKLGYEY-----------NLRDFALEKGCGREVDGEVEVEI------DELAYFVEKELKDRNVVLDGHLSH----------------------LMPVDLVVVLRAHPRIIGERLRERGYSKEKIGENVEAELVDAILIEAIDEHENV-------------IEVDTTKTPEEIVEEIIGLIKSGVKRR. 163
51 -15.6001rz3_A mol:protein length:201 hypothetical protein RBSTP0775  ali model follow..  10  20.AGRLVLGIDGLSRSGKTTLANQLSQTLREQGISVCVFHMDDHIVERAKRYHTGN----EEWFEYYYLQWDVEWLTHQLFRQLKASHQLTLPFYDHETDTHSKRT-LSDSDMIMIEGVFLQ-DFVVYLDCPREIRFARENDQVK---------------QNIQKFINRYWKAEDYYLETEEPIK-VVFDMT...................... 200
52 -15.6003iij_A mol:protein length:180 Coilin-interacting nuclear ATPase protein  ali model follow..  15  14......ILLTGTPGVGKTTLGKELASKSGLKY-----------NVGDLAREEQLYDGYDEEYDCPILDEDR---VVDELDNQMREGGVIV---------DYHGCDFFPERWF----------HIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYK------------EEIVHQLPSNKPEELENNVDQILKWI..... 171
53 -15.5001zak_A mol:protein length:222 ADENYLATE KINASE  ali model follow..  15  8......VMISGAPASGKGTQCELIKTKYQSAGDLLRAEIAAGSENGKRAKEFMEKGQLVPDEIVVNMVKERLRQ------DAQENGWLL--DGYPRS-----------YSQAMALETLEIRPDTFILLDVPDELLVERVVGRRSPPENEEIASRLTQRFDDTEEKVKLRLETYYQNIESL-ENIIVKVQGDATVDAVFAKIDELLGSILEKK. 215
54 -15.4001grq_A mol:protein length:178 CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE  ali model follow..  12  2..TTRMIILNGGSSAGKSGIVRCLQSVLPEPW-LAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRAGAWAEGVVAMARAGARIIIDDVFLGGAAAQER----------RSFVGDLDVLWVGVRCDGAVAEGRETARGDRV----------------------AGMAAKQAYVVHEGVEYVEVDTTHESIECAWAIAAHV........ 176
55 -15.4002rgx_A mol:protein length:206 Adenylate kinase  ali model follow..  17  3......LVFLGPPGAGKGTQAKRLAKEKGSTGDILREAVQKGTPLGKKAKEYMERGELVPDDLII-----------ALIEEVFPKHGNVIFDGFPRTVKQAEALDEM-------LEKKGLKVDHVLLFEVPDEVVIERLSGRR-KYNPPPPGVKVIQREDDKPEVIKYREQTAPLIEYYKKKGILRIIDASKPVEEVYRQVLEVIGD...... 204
56 -15.2002cdn_A mol:protein length:201 ADENYLATE KINASE  ali model follow..  18  17......VLLLGPPGAGKGTQAVKLAEKLGSTGELFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRLNN------PDAANGFIL--DGYPRSVEQAKALHEM-------LERRGTDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYR-----------DQLKTVDAVGTMDEVFARALRALGK...... 195
57 -14.6001ak2_A mol:protein length:233 ADENYLATE KINASE ISOENZYME-2  ali model follow..  18  14.PKGVRAVLLGPPGAGKGTQAPKLAKNFCATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVLELIEKNLET------PPCKNGFLL--DGFPRTVRQAEMLDDL-------MEKRKEKLDSVIEFSIPDSLLIRRITGRKEPMKDDITGEPLIRRSDDNKKALKYHTQTTPLVEYYSKRGIHSAIDASQTPDVVFASILAAFSK...... 230
58 -14.5001aky_A mol:protein length:220 ADENYLATE KINASE  ali model follow..  16  2.SESIRMVLIGPPGAGKGTQAPNLQERFHATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTN-----NPACKNGFIL--DGFPRTIPQAEKLDQM-------LKEQGTPLEKAIELKVDDELLVARITGRKEDMKDDVTGEALVQRSDDNADALKYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADILNKLGK...... 219
59 -14.5002c9y_A mol:protein length:242 ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL  ali model follow..  17  14.PKGIRAVLLGPPGAGKGTQAPRLAENFCATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLET------PLCKNGFLL--DGFPRTVRQAEMLDDL-------MEKRKEKLDSVIEFSIPDSLLIRRITGRKEPMKDDITGEPLIRRSDDNEKALKYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCK.. 234
60 -14.4004mde_A mol:protein length:171 Metallophosphoesterase  ali model follow..  15  6IPELSLVVLIGSSGSGKSTFAKKHFK-------------PTEVISSNFCRGLVSDDENDQTVTGAAF-----DVLHYIVSKRLQLGKLTVVD-------ATNVQESARKPLIEIAKDYHCFP-VAVVFNLPEKVCQERNKNRTDR--------------QVEEYVIRKHTQQMKKSIKGLQREGFRYVYILNSPEEVEEVVFER......... 169
61 -14.4004gp6_A mol:protein length:171 Metallophosphoesterase  ali model follow..  16  6IPELSLVVLIGSSGSGKSTFAKKHFK----PTEVISS---------DFCRGLVSDDENDQTVTGAAF-----DVLHYIVSKRLQLGKLTVVD-------ATNVQESARKPLIEIAKDYHCFP-VAVVFNLPEKVCQERNKNRTDR--------------QVEEYVIRKHTQQLKKSIKGLQREGFRYVYILNSPEEVEE.............. 164
62 -14.2004gp7_A mol:protein length:171 Metallophosphoesterase  ali model follow..  16  6IPELSLVVLIGSSGSGKSTFAKKHFK----PTEVISS---------DFCRGLMSDDENDQTVTGAAF-----DVLHYIVSKRLQLGKLTVVD-------ATNVQESARKPLIEMAKDYHCFP-VAVVFNLPEKVCQERNKNRTDR--------------QVEEYVIRKHTQQMKKSIKGLQREGFRYVYILNSPEEVEE.............. 164
63 -13.9003be4_A mol:protein length:217 Adenylate kinase  ali model follow..  15  3.SKKHNLILIGAPGSGKGTQCEFIKKEYGSTGDMLREAIKNGTKIGLEAKSIIESGNFVGDEIVLGLVKEKFDL------GVCVNGFVL--DGFPRTIPQAEGLAKI-------LSEIGDSLTSVIYFEIDDSEIIERISGRKQPGIDDVTGEPLVWRDDDNAEAVKFHKQTAPLVKFYEDLGILKRVNAKLPPKEVTEQIKKIL........ 217
64 -13.9001uf9_A mol:protein length:203 TT1252 protein  ali model follow..  14  5AKHPIIIGITGNIGSGKSTVAALLRSWLDLDALAARARENKEEELKRLFPEAVVGGRLDRRARLVFSDPERLKALEAVVHPEVRRLLMEELSRLEAPLVFLEIPLLFEKGWEGRL-------HGTLLVAAPLEERVRRVMARSGLSREEVLA-------RERAQMPEEEKRKRATW----------VLENTGSLEDLERALKAVLAELTGG.. 197
65 -13.8003tlx_A mol:protein length:243 Adenylate kinase 2  ali model follow..  18  27.KPDGRYIFLGAPGSGKGTQSLNLKKSHCSTGDLLREAAEKKTELGLKIKNIINEGKLVDDQMVLSLVDEKLKT------PQCKKGFIL--DGYPRNVKQAEDLNKL-------LQKNQTKLDGVFYFNVPDEVLVNRISGRKVPFRDDVTNEPLIQREDDNEDVLKFKSETSPLISYYKNKNLLINLDATQPANDLEKKISQHID....... 242
66 -13.7001z6g_A mol:protein length:218 guanylate kinase  ali model follow..  11  14MNNIYPLVICGPSGVGKGTLIKKLLNEFPNYFYFSVTRKKREKEKEGVDYYFIDKTIFEDKLKDFLEYDNYANNFKSEYDKAKEQNKICLFE--------------MNINGVKQLKKSTHIKNALYIFIKPPSTDVLLSRLLTRNTENQEQ----------------IQKRMEQLNIELANLLNFNLSIINDDLTLTYQQLKNYLLN...... 201
67 -13.6002xb4_A mol:protein length:223 ADENYLATE KINASE  ali model follow..  15  3......ILIFGPNGSGKGTQGNLVKDKYSESGGIFREHIGGGTELGKKAKEFIDRGDLVPDDITIPMVLET-------LESKGKDGWLL--DGFPRNTVQAQKLFEA-------LQEKGMKINFVIEILLPREVAKNRIMGRR-ARADDQDEGAINKRHDIYYNTVDGTLAAAYYYKNMAAKEGYIELDGEGSIDSIKDTLLAQLA....... 223
68 -13.6003a4l_A mol:protein length:260 L-seryl-tRNA(Sec) kinase  ali model follow..  24  1MGDIMLIILTGLPGVGKSTFSKNLAKILSKNNIDVIV--------SDLIRESFPVWKEKYEEFI-------KKSTYRLIDSALKNYWVIVDDTNYYNSMRRD---------LINIAKKYNKNYAIIYLKASLDVLIRRNIERGEKIP--------------NEVIKKMYEKFDEPGKKYKWDEPFLIIDTTKDINEIAKKLIE.......... 169
69 -13.6001lvg_A mol:protein length:198 Guanylate kinase  ali model follow..  12  1MAGPRPVVLSGPSGAGKSTLLKKLFQEHSSIFGFSVSHTTRNPRPGEEFVTREMMQRDIAAGDFIEHAEFSGNLYKEAVRAVQAMNRICVLD------VDLQGVRSIKKTDLCPIYIFVQPPSL--------DVLEQRLRLRN---------------TETEESLAKRLAAARTDMESSKEPGLFDLVIINDDLDKAYATLKQALSE...... 187
70 -13.5003tau_A mol:protein length:208 Guanylate kinase  ali model follow..  13  5TERGLLIVLSGPSGVGKGTVREAVFKDPETSFDYSISMTTRLPREGEQFRSREVFEQAIKDGKMLEYAEYVGNYYLEYVEEKLAAGVDIFLE------IEVQGAMQVRKAMPEGIFIFLTPPDL--------SELKNRIIGRGT------------------ESMEVVEERMETAKKEIEMMASYDYAVVNDVVANAVQKIKGIVET...... 188
71 -13.5004mkh_A mol:protein length:222 Adenylate kinase  ali model follow..  12  5......IVLMGLPGAGKGTLAEKIVEKYGSTGDMFRAAMKEETPLGLEAKSYIDKGELVPDEVTIGIVRERLSK------SDCERGFLL--DGFPRTVAQAEALEEI-------LEEMGRPIDYVINIQVRKEELMERLTGRRICSV-DKDGGELYQRADDNEETVTNMKQMAPLLAFYDSKEVLVNVNGERDIEDVFADVDVILLE...... 216
72 -13.4004tyq_A mol:protein length:217 Adenylate kinase  ali model follow..  13  3......IVLMGLPGAGKGTQAERIVAKYGSTGDMFRAAMKEETPLGLEAKSYIDKGELVPDEVTIGIVRERLSK------SDCERGFLL--DGFPRTVAQAEALEEI-------LEEMGRKLEYVIHIEVRQEELMERLTGRRICSV-DKDGGELYQRADDNEETVANMKQMAPLLAFYDSKEVLVNVNGQQDMEKVFKDLREILQGL..... 215
73 -13.4004qbg_B mol:protein length:217 Adenylate kinase  ali model follow..  13  3......IVLMGLPGAGKGTQAERIVAKYGSTGDMFRAAMKEETPLGLEAKSYIDKGELVPDEVTIGIVRERLSK------SDCERGFLL--DGFPRTVAQAEALEEI-------LEEMGRKLEHVIHIEVRQEELMERLTGRRICSV-DKDGGELYQRADDNEETVANMKQMAPLLAFYDSKEVLRNVNGQQDMEKVFKDLRELLQGL..... 215
74 -13.4001zin_A mol:protein length:217 ADENYLATE KINASE  ali model follow..  15  3......LVLMGLPGAGKGTQAEKIVAAYGSTGDMFRAAMKEGTPLGLQAKQYMDRGDLVPDEVTIGIVRERLSK------DDCQNGFLL--DGFPRTVAQAEALETM-------LADIGRKLDYVIHIDVRQDVLMERLTGRRICRN-DKCGGELYQRADDNEATVANMKQMKPLVDFYEQKGYLRNINGEQDMEKVFADIRELLGGL..... 215
75 -13.4002qor_A mol:protein length:204 Guanylate kinase  ali model follow..  11  3MARIPPLVVCGPSGVGKGTLIKKVLSEFPSRFRFSISCTTRNKREKET-DDFERKLKEGQFLEFDKYANNFYGTLKSEYDLAVGEGKICLFE--------------MNINGVKQLKESKHIQDGIYIFVKPPSIDILLGRLKNRNTEKPEE----------------INKRMQELTREMADKVGFNYFIVNDDLARTYAELREYLLG...... 190

FFAS is supported by the NIH grant R01-GM087218-01
8 5 6 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.