current user: public

anford Burnham Prebys Medical Discovery Institute

Query: 2p22_D mol:protein length:79 Hypothetical 12.0 kDa protein in ADE3-SER2 in, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
1 -60.1002p22_D mol:protein length:79 Hypothetical 12.0 kDa protein in ADE3-SER2 in  ali model  100  1MNVEELLRRIPLYNKYGKDFPQETVTRFQMPEFKLPALQPTRDLLCPWYEECDNITKVCQLHDSSNKKFDQWYKEQYLS 79
2 -6.3101bcp_F mol:protein length:99 PERTUSSIS TOXIN  ali model follow..  12  2...................LPTHLYKNFTVQELALKLKGKNQEFCLTAFMSGRSLVRAC--LSDAGHEHDTWFDTML.. 57
3 -6.2804xhr_N mol:protein length:86 Mitochondrial distribution and morphology pro  ali model follow..  21  2........................................GNIMSASFAPECTDLKTKYDS-------FNEWYSEKFLK 34
4 -6.2201ydx_A mol:protein length:406 type I restriction enzyme specificity protein  ali model follow..  10  132..............AFGTTIQNIRISDLKELEIPFTSNKNEQHAIANTLSVFDERLENLASLIEINRKLRDEYAHKLFS 196
5 -6.2004ytv_A mol:protein length:84 Mitochondrial distribution and morphology pro  ali model follow..  21  6.........................................NIMSASFAPECTDLKTKYDS-------FNEWYSEKFLK 37
6 -6.1202mhk_A mol:protein length:250 Penicillin-binding protein activator LpoA  ali model follow..  167......................QALSSMTQEQANTLVINADENILQGWLDLQRVWFDNRNDPDMMKAGIADWQKR.... 219
7 -5.7202lkg_A mol:protein length:140 Acetylcholine receptor  ali model follow..  17  33LSQEGGGGGGPLYFVVNVIEPCKKFSELTGLVFYLPTDSGEKMTE.................................. 77
8 -5.4701o4x_A mol:protein length:167 transcription factor Oct-1  ali model follow..  25  36.........LAMGKLYGNDFSQTTISRFEALNLSFKNMAKLKPLLEKWLNDAENLSS...................... 83
9 -5.4501gt0_C mol:protein length:159 OCTAMER-BINDING TRANSCRIPTION FACTOR 1  ali model follow..  25  32.........LAMGKLYGNDFSQTTISRFEALNLSFKNMSKLKPLLEKWLNDAENLSS...................... 79
10 -5.3904yqx_A mol:protein length:130 Interleukin-2  ali model follow..  17  6..LEQLLMDLQELLSRMENYRNLKLPRMLTFKFYLPKQATELKDLQCLEDELGPLRHVLDLTQSKSFQLED........ 74

FFAS is supported by the NIH grant R01-GM087218-01
9 4 2 5 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Grynberg M, Topczewski J, Godzik A., Paszewski A. The Aspergillus nidulans cysA gene encodes a novel type of serine O-acetyltransferase which is homologous to homoserine O-acetyltransferases. Microbiology. 2000 Oct;146 ( Pt 10):2695-703.