current user: public

Query: 2p22_D mol:protein length:79 Hypothetical 12.0 kDa protein in ADE3-SER2 in, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
1 -66.4002p22_D mol:protein length:79 Hypothetical 12.0 kDa protein in ADE3-SER2 in  ali model  100  1MNVEELLRRIPLYNKYGKDFPQETVTRFQMPEFKLPALQPTRDLLCPWYEECDNITKVCQLHDSSNKKFDQWYKEQYLS 79
2 -6.3803qtm_A mol:protein length:346 Uncharacterized protein C4B3.07  ali model follow..  12  1......METMLVYTEEDNISQLWGLYEMSREKLENDDIDASVSLVFGTIHEADRILRNTEDISTLPKDFHAAYSSALLA 73
3 -5.9802lak_A mol:protein length:160 AHSA1-like protein RHE_CH02687  ali model follow..  18  100....................EQGGGTLLRLTHSGLPSAEQCAGHEEGWAHYLGRLTEVAAGRDPGPDPFYGRRLE.... 154
4 -5.9402d7e_A mol:protein length:105 Primosomal protein N`  ali model follow..  13  1MPVAHVALPVPLPRTFDYLLPEGMTCRVRVP---VVSVSDASELPLNELKAVVEVLDSEPVFTHSVWRLLLWAADYYHH 90
5 -5.9202l5o_A mol:protein length:153 Putative thioredoxin  ali model follow..  12  5................SKTAPAFSLPDLHGKTVSNADLQGKVTLINFWFPSCPGCVSEMPKIIKTANDYKN........ 59
6 -5.5603ha9_A mol:protein length:165 uncharacterized Thioredoxin-like protein  ali model follow..  12  12..............EVLEREASFSLTTIDGEVISLNNVGGDVVILWFMAAWCPSCVYMADLLDRLTEKYRE........ 68
7 -5.5303c71_A mol:protein length:143 Thiol-disulfide oxidoreductase resA  ali model follow..  19  1..............SEGSDAPNFVLEDTNGKRIELSDLKGKGVFLNFWGTWCPHCKKEFPYMANQYKHFKS........ 57
8 -5.5202h1g_A mol:protein length:143 Thiol-disulfide oxidoreductase resA  ali model follow..  17  1..............SEGSDAPNFVLEDTNGKRIELSDLKGKGVFLNFWGTWAEPAKKEFPYMANQYKHFKS........ 57
9 -5.5201m4a_A mol:protein length:133 interleukin-2  ali model follow..  20  14..LEHLLLDLQMILNGINNCKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRP........ 82
10 -5.4801irl_A mol:protein length:133 INTERLEUKIN-2  ali model follow..  20  13.QLEHLLLDLQMILNGINNYKNPKLTRMLTAKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLR......... 81

FFAS is supported by the NIH grant R01-GM087218-01
7 1 8 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Sikora S, Godzik A. Combination of multiple alignment analysis and surface mapping paves a way for a detailed pathway reconstruction--the case of VHL (von Hippel-Lindau) protein and angiogenesis regulatory pathway. Protein Sci. 2004 Mar;13(3):786-96. Epub 2004 Feb 06.