current user: public




Query: 2o8v_B mol:protein length:128 Thioredoxin 1, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst MGSSSSGLVPRGSHSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPAKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLALast
1 -84.9002o8v_B mol:protein length:128 Thioredoxin 1  ali model  100  1MGSSSSGLVPRGSHSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPAKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 122
2 -79.8002i1u_A mol:protein length:121 Thioredoxin  ali model follow..  48  7..........TDSEKSATIKVTDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERATDLTVAKLDVDTNPETARNFQVVSIPTLILFKDGQPVKRIVGAKGKAALLRELSDVVP 118
3 -79.2001t00_A mol:protein length:112 Thioredoxin  ali model follow..  52  1...........SHMAGTLKHVTDDSFEQDVLKNDKPVLVDFWAAWCGPCRQIAPSLEAIAAEYGDKIEIVKLNIDENPGTAAKYGVMSIPTLNVYQGGEVAKTIVGAKPKAAIVRDLEDFIA 111
4 -79.2003dxb_A mol:protein length:222 thioredoxin N-terminally fused to Puf60(UHM)  ali model follow..  96  2...........KPMSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 112
5 -79.1001keb_A mol:protein length:108 Thioredoxin 1  ali model follow..  97  1..............SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKLIASILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 108
6 -79.0004hu7_A mol:protein length:108 Thioredoxin-1  ali model follow..  95  1..............SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGACKMIAAILDEIADEYQGKLTVAKLNIDQNAGTAAKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 108
7 -79.0003dyr_A mol:protein length:111 Thioredoxin-1  ali model follow..  98  2..............SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGTPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 109
8 -79.0002eir_A mol:protein length:108 Thioredoxin 1  ali model follow..  97  1..............SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKCFLDCNLA 108
9 -78.9001txx_A mol:protein length:108 PROTEIN (THIOREDOXIN)  ali model follow..  97  1..............SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCVWCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 108
10 -78.9001zcp_A mol:protein length:108 Thioredoxin 1  ali model follow..  98  1..............SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCACAKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 108
11 -78.9001srx_A mol:protein length:108 THIOREDOXIN  ali model follow..  95  1..............SDKIIHLTDDSFDTDLVKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYIERGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 108
12 -78.8001thx_A mol:protein length:115 THIOREDOXIN  ali model follow..  40  2..........ETAMSKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN 113
13 -78.1002i4a_A mol:protein length:107 thioredoxin  ali model follow..  56  1..............SEHTLAVSDSSFDQDVLKASGLVLVDFWAEWCGPCKMIGPALGEIGKEFAGKVTVAKVNIDDNPETPNAYQVRSIPTLMLVRDGKVIDKKVGALPKSQLKAWVESAQ. 107
14 -77.2004wxt_A mol:protein length:125 Thioredoxin  ali model follow..  49  11................ATIEVSDASFSTDVLASNKPVLVDFWATWCGPCKMVAPVLEEIASERGDHLTVAKLDVDANPETAQNFQVVSIPTLILFKDGQPVKRIVGAKGKAALLRELSDAVP 116
15 -76.8004xhm_A mol:protein length:137 Thioredoxin (Trx-3)  ali model follow..  45  18MMQKMSGEEKARKVLDSPVKLNSSNFD-ETLKNNENVVVDFWAEWCHPCKMIAPVIEELAKEYAGKVVFGKLNTDENPTIAARYGISAIPTLIFFKKGKPVDQLVGAMPKSELKRWVQRNL. 137
16 -76.8002yn1_A mol:protein length:106 LGPCA THIOREDOXIN  ali model follow..  84  2................SIIHVTDDSFDQDVLKADKPVLVDFWAEWCGPCKMIAPILDEIAEEYEGKLKVAKVNIDENPETAAKYGIRGIPTLMLFKNGEVAATKVGALSKSQLKEFLDANL. 106
17 -76.7004knd_A mol:protein length:112 Thioredoxin  ali model follow..  46  1.........SNAMASNDVVVLQDSTFEQEVLKSDTPVLVDFWAVWCGPCKAIAPVVDDLAARYKGKLKVAKMDVDQHQGVPQQYGIRSIPTLLVFKGGRVVDTVIGA-DKTRLEDSVKKAIG 112
18 -76.3004pob_A mol:protein length:117 Thioredoxin  ali model follow..  48  5..............DHATVTVTDDSFQEDVVSSNKPVLVDFWATWCGPCKMVAPVLEEIAKDHGEALTIAKLDVDANPETARAFQVTSIPTLILFQNGEATKRIVGAKSKSALLRELDGVV. 111
19 -75.9002puk_C mol:protein length:106 Thioredoxin M-type, chloroplast (TRX-M)  ali model follow..  46  1................EVQDVNDSSWKEFVLESEVPVMVDFWAPWCGPSKLIAPVIDELAKEYSGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAVPKSTLTDSIEKYLS 106
20 -75.8002yj7_A mol:protein length:106 LPBCA THIOREDOXIN  ali model follow..  58  2................SVIEVTDENFEQEVLKSDKPVLVDFWAPWCGPCRMIAPIIEELAKEYEGKVKVVKVNVDENPNTAAQYGIRSIPTLLLFKNGQVVDRLVGAQPKEALKERIDKHL. 106
21 -75.7001dby_A mol:protein length:107 CHLOROPLAST THIOREDOXIN M CH2  ali model follow..  44  2................EAGAVNDDTFKNVVLESSVPVLVDFWAPWCGPCRIIAPVVDEIAGEYKDKLKCVKLNTDESPNVASEYGIRSIPTIMVFKGGKKCETIIGAVPKATIVQTVEKYLN 107
22 -75.5003hz4_A mol:protein length:140 Thioredoxin  ali model follow..  29  5..............GSSIIEFEDMTWSQQVEDSKKPVVVMFYSPACPYCKAMEPYFEEYAKEYGSSAVFGRINIATNPWTAEKYGVQGTPTFKFFCHGRPVWEQVGQIYPSILKNAVRDMLQ 112
23 -75.4004ba7_A mol:protein length:106 LBCA THIOREDOXIN  ali model follow..  57  2................SVIEINDENFEEEVLKSDKPVLVDFWAPWCGPCRMIAPIIEELAEEYEGKVKFAKVNVDENPETAAKYGIMSIPTLLLFKNGEVVDKLVGARPKEALKERIEKHL. 106
24 -74.8002mcs_A mol:protein length:128 Thioredoxin  ali model follow..  34  9.........QTQGPGSMIEQIGDSEFDNKVTSDNILILVDFWAPWCGPCRSLEPQLEKLAQQYTENVKIYKINIEDNQDVATQYGVSAIPTILMFKNGKKLSQVIGADISKIISEINNN... 120
25 -74.7003ziv_A mol:protein length:106 AECA THIOREDOXIN  ali model follow..  52  2................SVIEINDENFDEVIKKSDKVVVVDFWAEWCGPCRMIAPIIEELAEEYAGKVVFGKVNVDENPEIAAKYGIMSIPTLLFFKNGKVVDQLVGARPKEALKERIKKYL. 106
26 -74.6002ynx_A mol:protein length:106 LACA THIOREDOXIN  ali model follow..  52  2................SVVQLNDENFDEVIKKNNKVVVVDFWAEWCGPCRMIAPIIEELAKEYAGKVVFGKLNVDENPEIAAKYGIMSIPTLLFFKNGKVVDQLVGAMPKEALKERIKKYL. 106
27 -74.2003vfi_A mol:protein length:104 thioredoxin  ali model follow..  25  1.................LRSLSDSDFQLEVRQHPDPIIIMFTGSWCQPCKKMKPTFEEMASQMEGDIRFAYMDAEDAEKTMAELNIRTLPSLALFVDGMIREVFSGTMNKSDLRYWINNNI. 104
28 -73.8001oaz_A mol:protein length:123 THIOREDOXIN 1  ali model follow..  98  1.............MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 123
29 -73.1003tco_A mol:protein length:109 Thioredoxin (TrxA-1)  ali model follow..  37  2.............KEDVTLVLTEENFD-EVIRNNKLVLVDCWAEWCAPCHLYEPIYKKVAEKYKGKAVFGRLNVDENQKIADKYSVLNIPTTLIFVNGQLVDSLVGAVDEDTLESTVNKYLK 109
30 -72.7002cvk_A mol:protein length:110 Thioredoxin  ali model follow..  50  2...............AKPIEVTDQNFD-ETLGQHPLVLVDFWAEWCAPCRMIAPILEEIAKEYEGKLLVAKLDVDENPKTAMRYRVMSIPTVILFKDGQPVEVLVGAQPKRNYQAKIEKHLP 107
31 -72.3001nw2_A mol:protein length:105 THIOREDOXIN  ali model follow..  46  1................ATMTLTDANFQ-QAIQGDKPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGEPVKQLIGYQPKEQLEAQLADVLQ 105
32 -72.1001nsw_A mol:protein length:105 THIOREDOXIN  ali model follow..  46  1................ATMTLTDANFQ-QAIQGDGPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGRPVKQLIGYQPKEQLEAQLADVLQ 105
33 -71.3004o32_A mol:protein length:138 Thioredoxin  ali model follow..  22  26.............MFKKVLQQNGSNIINGVNMKNTVIVLYFFAKWCQACTMQSTEMDKLQKYYGKRIYLLKVDLDKNESLARKFSVKSLPTIILLKNKTMLARKDHFVSSNDLIALIKKHLV 136
34 -71.1001uvz_A mol:protein length:119 THIOREDOXIN  ali model follow..  32  4.............SGSTTFNIQDPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG 113
35 -70.7002voc_A mol:protein length:112 THIOREDOXIN  ali model follow..  47  2................AIVKATDQSFSAET--SEGVVLADFWAPWCGPSKMIAPVLEELDQEMGDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKDGEVVETSVGFKPKEALQELVNKHLL 105
36 -70.7002o7k_A mol:protein length:107 Thioredoxin  ali model follow..  49  5................AIVKVTDADFDSKVESG--VQLVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL. 107
37 -70.6002o89_A mol:protein length:107 Thioredoxin  ali model follow..  48  5................AIVKVTDADFDSKVESG--VQLVDFWATWCGTSKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL. 107
38 -70.3003gnj_A mol:protein length:111 Thioredoxin domain protein  ali model follow..  18  5................SLEKLDTNTFEQLIYDEGKACLVMFSRKNCHVCQKVTPVLEELRLNYEESFGFYYVDVEEEKTLFQRFSLKGVPQILYFKDGEYKGKMAGDVEDDEVEQMIADVLE 110
39 -69.3003hhv_A mol:protein length:110 Thioredoxin (TrxA-2)  ali model follow..  32  1..........KEKVKEPVKHLNSKNFD-EFITKNKIVVVDFWAEWCAPCLILAPVIEELANDY-PQVAFGKLNTEESQDIAMRYGIMSLPTIMFFKNGELVDQILGAVPREEIEVRLKSLLE 110
40 -67.4002e0q_A mol:protein length:104 thioredoxin  ali model follow..  37  1.................VIHLDSKNFD-SFLASHEIAVVDFWAEWCAPCLILAPIIEELAEDY-PQVGFGKLNSDENPDIAARYGVMSLPTVIFFKDGEPVDEIIGAVPREEIEIRIKNLLG 103
41 -67.3003hxs_A mol:protein length:141 Thioredoxin  ali model follow..  38  8.STTATDTVQAEKPQSGTIHLTRAEFLKKIYLGDKPAIVDFYADWCGPCKMVAPILEELSKEYAGKIYIYKVNVDKEPELARDFGIQSIPTIWFVPMKGEPQVNMGALSKEQLKGYIDKVL. 138
42 -66.9002l5l_A mol:protein length:136 Thioredoxin  ali model follow..  36  1.......MSLATEGNGKVIHLTKAEFLAKVYEGDKPAIVDFYADWCGPCKMVAPILDELAKEYDGQIVIYKVDTEKEQELAGAFGIRSIPSILFIPMEGKPEMAQGAMPKASFKKAIDEFL. 125
43 -65.1003aps_A mol:protein length:122 DnaJ homolog subfamily C member 10  ali model follow..  25  1.............LPQASIDLTPQTFNEKVLQGKTHWVVDFYAPWCGPCQNFAPEFELLARMIKGKVRAGKVDCQAYPQTCQKAGIKAYPSVKLYQYERAKKSQINSRDAKTIAALIYGKLE 113
44 -64.9001m7t_A mol:protein length:107 Chimera of Human and E. coli thioredoxin  ali model follow..  55  2.................VKQIESKTAFQEALDADKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVI-FLEVDVDDAQDVAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLV 107
45 -63.2002j23_A mol:protein length:121 THIOREDOXIN  ali model follow..  33  8..............RGSVQVISSYDQFKQVTGGDKVVVIDFWATWCGPCKMIGPVFEKISDTPAGKVGFYKVDVDEQSQIAQEVGIRAMPTFVFFKNGQKIDTVVGADPS-KLQAAITQHSA 115
46 -61.0003emx_A mol:protein length:135 Thioredoxin  ali model follow..  18  1MSLSYVKEGLAVLEDGRLIYITPEEFRQLL---QGDAILAVYSKTCPHCHRDWPQLIQASKEVDVPIVIGERELSAARLEMNKAGVEGTPTLVFYKEGRIVDKLVGATPWSLKVEKAREIYG 126
47 -60.5002yoi_A mol:protein length:106 LECA THIOREDOXIN  ali model follow..  38  6....................TNKEEFEAILSEADKLVVVDFFATWCGPCKMIAPFFEELSEEYPDKVVFIKVDVDEVPDVAAKYGITSMPTFKFFKNGKKVDELVGA-NQEKLKQMILKHAP 106
48 -59.8001v98_A mol:protein length:140 thioredoxin  ali model follow..  41  34................WVVEADEKGFAQEVAGAP-LTLVDFFAPWCGPCRLVSPILEELARDHAGRLKVVKVNVDEHPGLAARYGVRSVPTLVLFRRGAPVATWVGASPRRVLEERLRPYLE 138
49 -59.8002lrc_A mol:protein length:114 Probable thioredoxin  ali model follow..  20  2................KTRYSAEAPARDELDRLAGPTLVEFGTDWCGHCQAAQPLLAEVFSDYPE-VGHLKVEDGPGRRLGRSFQVKLWPTFVFLRDGREVARVVRPGSASVLEEAFESLVG 106
50 -58.9002f51_A mol:protein length:118 thioredoxin  ali model follow..  29  1.............MSDPIVHFTHEALLNRIKEAPGLVLVDFFATWCGPCQRLGQILPSIAEAN-KDVTFIKVDVDKNGNAADAYGVSSIPALFFVKKEGNEIKTLDQFDVSRIKADIEKF.. 111
51 -58.8004kca_A mol:protein length:692 Endo-1,5-alpha-L-arabinanase  ali model follow..  98  1.............MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 109
52 -58.7002l57_A mol:protein length:126 Uncharacterized protein  ali model follow..  17  2................SLEGIKQINFQSEEAKEGIPTIIMFKTDTCPYCVEMQKELSYVSKEREGKFNIYYARLEENIDLAYKYDANIVPTTVFLKEGNKFYVHQGLMRKNNIETILNSLGV 117
53 -57.4002l6c_A mol:protein length:110 Thioredoxin  ali model follow..  17  2...............SAIRDITTEAGM-AHFEGLSDAIVFFHKNLCPHCKNMEKVLDKFGARA-PQVAISSVDSEARPELMKELGFERVPTLVFIRDGKVAKVFSGIMNPRELQALYAS... 103
54 -56.3002dj0_A mol:protein length:137 Thioredoxin-related transmembrane protein 2  ali model follow..  21  2..........SSGSSGYIKYFNDKTIDEELERDRVTWIVEFFANWSNDCQSFAPIYADLSLKYNTGLNFGKVDVGRYTDVSTRYKVKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSE.. 119
55 -54.5003p2a_A mol:protein length:148 Putative thioredoxin-like protein  ali model follow..  33  32.........GHSLFDGEVINATAETLDK-LLQDDLPMVIDFWAPWCGPCRSFAPIFAETAAERAGKVRFVKVNTEAEPALSTRFRIRSIPTIMLYRNGKMIDMLNGAVPKAPFDNWLDEQLS 143
56 -53.1002ppt_A mol:protein length:155 thioredoxin-2  ali model follow..  33  53......................DPAILARAERDDLPLLVDFWAPWCGPCRQMAPQFQAAAATLAGQVRLAKIDTQAHPAVAGRHRIQGIPAFILFHKGRELARAAGARPASELVGFVRGKLG 152
57 -53.1004ruv_A mol:protein length:114 Thioredoxin  ali model follow..  25  1...............GSMQSIKSNESFKSVINSDTPVIVKFEAGWCPDCRAMDLWIDPIVEQY-NDYQWYTVNRDELEDVVVENEVMGIPSLLVFKNGDKIAHLHSANAKSQVESFLAETF. 107
58 -51.6003qdn_A mol:protein length:287 Putative thioredoxin protein  ali model follow..  25  6..............VQNIVNINESNLQQTLEQSTTPVLFYFWSERSQHCLQLTPVLESLAAQYHGQFILAKLDCDAEQMIAAQFGLRAIPTVYLFQNGQPVDGFQGPQPEEAIRALLDKVLP 114
59 -51.6003qou_A mol:protein length:287 protein ybbN  ali model follow..  26  6..............VENIVNINESNLQQVLEQSTTPVLFYFWSERSQHCLQLTPILESLAAQYNGQFILAKLDCDAEQMIAAQFGLRAIPTVYLFQNGQPVDGFQGPQPEEAIRALLDKVLP 114
60 -48.9001r26_A mol:protein length:125 Thioredoxin  ali model follow..  24  14................SVVDVYSVEQFRNIMSEDILTVAWFTAVWCGPCKTIERPMEKIAYEFP-TVKFAKVDADNNSEIVSKCRVLQLPTFIIARSGKMLGHVIGA-NPGMLRQKLRDIIK 117
61 -48.3002fa4_A mol:protein length:111 Thioredoxin II  ali model follow..  32  8.....................SASEYDSALASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQYS-DAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGA-NPAAIKQAIASNV. 105
62 -47.9002ypm_A mol:protein length:106 LAFCA THIOREDOXIN  ali model follow..  37  7.....................NKDEFESILSEADKLVVVDFTATWCGPCKMIAPKFEELSEEYPDNVVFLKVDVDEVEDVAAEYGISAMPTFQFFKNGKKVDELTGA-NQEKLKAMIKKHAA 106
63 -47.5001qgv_A mol:protein length:142 SPLICEOSOMAL PROTEIN U5-15KD  ali model follow..  15  1.............MSYMLPHLNGWQVDQAILSEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDK.. 109
64 -47.3003f3q_A mol:protein length:109 Thioredoxin-1  ali model follow..  36  2.................VTQFKTASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYP-QADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGA-NPAAIKQAIAAN.. 102
65 -47.2004dss_B mol:protein length:112 Thioredoxin-2  ali model follow..  30  1.............MGMVTQLKSASEYDSALASGDKLVVVDFFATWCGPSKMIAPMIEKFAEQYS-DAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGA-NPAAIKQAIASNV. 106
66 -47.0001faa_A mol:protein length:124 THIOREDOXIN F  ali model follow..  28  5..ELALGTQEMEAIVGKVTEVNKDTFWPIVKAADKPVVLDMFTQWCGPCKAMAPKYEKLAEEYLD-VIFLKLDCNENKTLAKELGIRVVPTFKILKENSVVGEVTGA-KYDKLLEAIQAARS 124
67 -47.0001xbs_A mol:protein length:149 Dim1-like protein  ali model follow..  14  1.............MSFLLPKLSKKEVDQAIKTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTK.. 109
68 -46.6002av4_A mol:protein length:160 Thioredoxin-like protein 4A (DIM1)  ali model follow..  11  9.........VPRGSSFMLQHLSGWAVDQAIVNEERLVCIRFGHDYDPDCMKMDELLYKVADDIKNFCVIYLVDITEVPDFNTMYELYDPVSVMFFYRNKHMMIDLGTGNNNKINWPMNNK.. 121
69 -45.8001xwa_A mol:protein length:111 thioredoxin  ali model follow..  32  12.....................DKADLDGQLTKAGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGA-NAKRLEDVIKANI. 111
70 -45.6004cw9_A mol:protein length:109 THIOREDOXIN  ali model follow..  29  3.................VLHINALDQLTALLSTEKVIVIDFFATWCGPSRSISPYFEELAGQYN-NIKFVKVDVDQAEEICVNYKVRSMPTFVLVKDGIEQKRFSGA-DRNALKQMVETA.. 103
71 -45.5004j56_E mol:protein length:114 Thioredoxin  ali model follow..  31  3..............SGSVKIVTSQAEFDSIISQNELVIVDFFAEWCGPSKRIAPFYEECSKTYT-KMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGA-NDSALKQLIEKYAA 108
72 -45.2001syr_A mol:protein length:112 thioredoxin  ali model follow..  30  2...............AMVKIVTSQAEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECSKTYT-KMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGA-NDSALKQLIEKYAA 106
73 -45.2004ef0_A mol:protein length:123 Protein disulfide-isomerase A6  ali model follow..  23  2.................VIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYGGRTGEAIVDAALSALR 107
74 -45.2001ep7_A mol:protein length:112 THIOREDOXIN CH1, H-TYPE  ali model follow..  35  9.....................SKAAWDAQLAKGHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKVDVDAVAAVAEAAGITAMPTFHVYKDGVKADDLVGA-SQDKLKALVAKHAA 111
75 -45.1002mmn_A mol:protein length:104 Thioredoxin  ali model follow..  31  1................SVKIVTSQSEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECSKTYT-KMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGA-NDSALKQLIEKYAA 104

FFAS is supported by the NIH grant R01-GM087218-01
8 5 8 4 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zmasek CM, Zhang Q, Ye Y, Godzik A. Surprising complexity of the ancestral apoptosis network. Genome Biol. 2007 Oct 24;8(10):R226 [Epub ahead of print]