current user: public




2o8vB
Query: 2o8v_B mol:protein length:128 Thioredoxin 1, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst MGSSSSGLVPRGSHSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPAKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLALast
1 -83.0002o8v_B mol:protein length:128 Thioredoxin 1  ali model  100  1MGSSSSGLVPRGSHSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPAKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 122
2 -79.5002i1u_A mol:protein length:121 Thioredoxin  ali model follow..  48  7..........TDSEKSATIKVTDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERATDLTVAKLDVDTNPETARNFQVVSIPTLILFKDGQPVKRIVGAKGKAALLRELSDVVP 118
3 -78.0001t00_A mol:protein length:112 Thioredoxin  ali model follow..  52  1...........SHMAGTLKHVTDDSFEQDVLKNDKPVLVDFWAAWCGPCRQIAPSLEAIAAEYGDKIEIVKLNIDENPGTAAKYGVMSIPTLNVYQGGEVAKTIVGAKPKAAIVRDLEDFIA 111
4 -77.8001thx_A mol:protein length:115 THIOREDOXIN  ali model follow..  40  2..........ETAMSKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN 113
5 -77.7003dyr_A mol:protein length:111 Thioredoxin-1  ali model follow..  98  2..............SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGTPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 109
6 -77.6002eir_A mol:protein length:108 Thioredoxin 1  ali model follow..  97  1..............SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKCFLDCNLA 108
7 -77.5001keb_A mol:protein length:108 Thioredoxin 1  ali model follow..  97  1..............SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKLIASILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 108
8 -77.5001srx_A mol:protein length:108 THIOREDOXIN  ali model follow..  95  1..............SDKIIHLTDDSFDTDLVKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYIERGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 108
9 -77.2001zcp_A mol:protein length:108 Thioredoxin 1  ali model follow..  98  1..............SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCACAKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 108
10 -77.2001txx_A mol:protein length:108 PROTEIN (THIOREDOXIN)  ali model follow..  97  1..............SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCVWCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 108
11 -76.5003hz4_A mol:protein length:140 Thioredoxin  ali model follow..  29  5..............GSSIIEFEDMTWSQQVEDSKKPVVVMFYSPACPYCKAMEPYFEEYAKEYGSSAVFGRINIATNPWTAEKYGVQGTPTFKFFCHGRPVWEQVGQIYPSILKNAVRDMLQ 112
12 -76.1002puk_C mol:protein length:106 Thioredoxin M-type, chloroplast (TRX-M)  ali model follow..  46  1................EVQDVNDSSWKEFVLESEVPVMVDFWAPWCGPSKLIAPVIDELAKEYSGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAVPKSTLTDSIEKYLS 106
13 -76.0002i4a_A mol:protein length:107 thioredoxin  ali model follow..  56  1..............SEHTLAVSDSSFDQDVLKASGLVLVDFWAEWCGPCKMIGPALGEIGKEFAGKVTVAKVNIDDNPETPNAYQVRSIPTLMLVRDGKVIDKKVGALPKSQLKAWVESA.. 106
14 -75.9001dby_A mol:protein length:107 CHLOROPLAST THIOREDOXIN M CH2  ali model follow..  43  1...............MEAGAVNDDTFKNVVLESSVPVLVDFWAPWCGPCRIIAPVVDEIAGEYKDKLKCVKLNTDESPNVASEYGIRSIPTIMVFKGGKKCETIIGAVPKATIVQTVEKYLN 107
15 -74.8001uvz_A mol:protein length:119 THIOREDOXIN  ali model follow..  33  2..........RGSGSTTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG 113
16 -74.5002l5l_A mol:protein length:136 Thioredoxin  ali model follow..  31  15..........TKAEFLAKVYNFEKNPEEWKYEGDKPAIVDFYADWCGPCKMVAPILDELAKEYDGQIVIYKVDTEKEQELAGAFGIRSIPSILFIPMEGKPEMAQGAMPKASFKKAIDEFLL 126
17 -73.9003VFI Entity 1(prereleased)  ali follow..  25  1.................LRSLSDSDFQLEVRQHPDPIIIMFTGSWCQPCKKMKPTFEEMASQMEGDIRFAYMDAEDAEKTMAELNIRTLPSLALFVDGMIREVFSGTMNKSDLRYWINNNI. 104
18 -73.7001oaz_A mol:protein length:123 THIOREDOXIN 1  ali model follow..  98  1.............MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 123
19 -73.5003hxs_A mol:protein length:141 Thioredoxin  ali model follow..  40  17..........AEKPQSGTIHLTRAEFLKKIALGDKPAIVDFYADWCGPCKMVAPILEELSKEYAGKIYIYKVNVDKEPELARDFGIQSIPTIWFVPMKGEPQVNMGALSKEQLKGYIDKVL. 138
20 -73.5002cvk_A mol:protein length:110 Thioredoxin  ali model follow..  49  1..............MAKPIEVTDQNFD-ETLGQHPLVLVDFWAEWCAPCRMIAPILEEIAKEYEGKLLVAKLDVDENPKTAMRYRVMSIPTVILFKDGQPVEVLVGAQPKRNYQAKIEKHLP 107
21 -73.2003tco_A mol:protein length:109 Thioredoxin (TrxA-1)  ali model follow..  36  1............KKEDVTLVLTEENFD-EVIRNNKLVLVDCWAEWCAPCHLYEPIYKKVAEKYKGKAVFGRLNVDENQKIADKYSVLNIPTTLIFVNGQLVDSLVGAVDEDTLESTVNKYLK 109
22 -72.9003ul3_B mol:protein length:128 Thioredoxin  ali model follow..  21  23..............KVPRLQQNGSNIINGVNMKNTVIVLYFFAKWCQACTMQSTEMDKLQKYYGKRIYLLKVDLDKNESLARKFSVKSLPTIILLKNKTMLARKDHFVSSNDLIALIKKH.. 128
23 -72.5001nw2_A mol:protein length:105 THIOREDOXIN  ali model follow..  46  1................ATMTLTDANFQ-QAIQGDKPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGEPVKQLIGYQPKEQLEAQLADVLQ 105
24 -72.4001nsw_A mol:protein length:105 THIOREDOXIN  ali model follow..  46  1................ATMTLTDANFQ-QAIQGDGPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGRPVKQLIGYQPKEQLEAQLADVLQ 105
25 -71.9002voc_A mol:protein length:112 THIOREDOXIN  ali model follow..  46  1...............MAIVKATDQSFSAET--SEGVVLADFWAPWCGPSKMIAPVLEELDQEMGDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKDGEVVETSVGFKPKEALQELVNKHLL 105
26 -71.7003gnj_A mol:protein length:111 Thioredoxin domain protein  ali model follow..  18  3..............AMSLEKLDTNTFEQLIYDEGKACLVMFSRKNCHVCQKVTPVLEELRLNYEESFGFYYVDVEEEKTLFQRFSLKGVPQILYFKDGEYKGKMAGDVEDDEVEQMIADVLE 110
27 -71.7002o7k_A mol:protein length:107 Thioredoxin  ali model follow..  49  4...............MAIVKVTDADFDSKVESG--VQLVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL. 107
28 -71.6002o89_A mol:protein length:107 Thioredoxin  ali model follow..  48  4...............MAIVKVTDADFDSKVESG--VQLVDFWATWCGTSKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL. 107
29 -70.2003emx_A mol:protein length:135 Thioredoxin  ali model follow..  18  14.............EDGRLIYITPEEFRQLL---QGDAILAVYSKTCPHCHRDWPQLIQASKEVDVPIVIGERELSAARLEMNKAGVEGTPTLVFYKEGRIVDKLVGATPWSLKVEKAREIYG 126
30 -69.7003hhv_A mol:protein length:110 Thioredoxin (TrxA-2)  ali model follow..  33  1..........KEKVKEPVKHLNSKNFD-EFITKNKIVVVDFWAEWCAPCLILAPVIEELANDY-PQVAFGKLNTEESQDIAMRYGIMSLPTIMFFKNGELVDQILGAVPREEIEVRLKSLL. 109
31 -68.1002e0q_A mol:protein length:104 thioredoxin  ali model follow..  37  1.................VIHLDSKNFD-SFLASHEIAVVDFWAEWCAPCLILAPIIEELAEDY-PQVGFGKLNSDENPDIAARYGVMSLPTVIFFKDGEPVDEIIGAVPREEIEIRIKNLLG 103
32 -67.1003p2a_A mol:protein length:148 Putative thioredoxin-like protein  ali model follow..  35  36.............FDGEVINATAETLD-KLLQDDLPMVIDFWAPWCGPCRSFAPIFAETAAERAGKVRFVKVNTEAEPALSTRFRIRSIPTIMLYRNGKMIDMLNGAVPKAPFDNWLDEQLS 143
33 -66.9002ppt_A mol:protein length:155 thioredoxin-2  ali model follow..  29  40.........CGAGLITGKVAGIDPAILARAERDDLPLLVDFWAPWCGPCRQMAPQFQAAAATLAGQVRLAKIDTQAHPAVAGRHRIQGIPAFILFHKGRELARAAGARPASELVGFVRGKLG 152
34 -66.8002j23_A mol:protein length:121 THIOREDOXIN  ali model follow..  33  7.............PRGSVQVISSYDQFKQVTGGDKVVVIDFWATWCGPCKMIGPVFEKISDTPAGKVGFYKVDVDEQSQIAQEVGIRAMPTFVFFKNGQKIDTVVGADPS-KLQAAITQHSA 115
35 -66.5001v98_A mol:protein length:140 thioredoxin  ali model follow..  40  29...........KTPLPWVVEADEKGFAQEVAGAP-LTLVDFFAPWCGPCRLVSPILEELARDHAGRLKVVKVNVDEHPGLAARYGVRSVPTLVLFRRGAPVATWVGASPRRVLEERLRPYLE 138
36 -66.3003aps_A mol:protein length:122 DnaJ homolog subfamily C member 10  ali model follow..  25  1.............LPQASIDLTPQTFNEKVLQGKTHWVVDFYAPWCGPCQNFAPEFELLARMIKGKVRAGKVDCQAYPQTCQKAGIKAYPSVKLYQYERAKKSIWNSRDAKTIAALIYGKLE 113
37 -65.1001m7t_A mol:protein length:107 Chimera of Human and E. coli thioredoxin  ali model follow..  55  2.................VKQIESKTAFQEALDADKLVVVDFSATWCGPCKMIKPFFHSLSEKYSN-VIFLEVDVDDAQDVAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLV 107
38 -63.4003dxb_A mol:protein length:222 thioredoxin N-terminally fused to Puf60(UHM)  ali model follow..  96  2...........KPMSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 112
39 -63.0001xwa_A mol:protein length:111 thioredoxin  ali model follow..  28  1..........AAAAAMVYQVKDKADLDGQLTKSGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAK-RLEDVIKANI. 111
40 -62.8002fa4_A mol:protein length:111 Thioredoxin II  ali model follow..  30  1..............MMVTQLKSASEYDSALASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQY-SDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPA-AIKQAIASNV. 105
41 -62.7001ep7_A mol:protein length:112 THIOREDOXIN CH1, H-TYPE  ali model follow..  34  2..............GSVIVIDSKAAWDAQLAKEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKVDVDAVAAVAEAAGITAMPTFHVYKDGVKADDLVGA-SQDKLKALVAKHAA 111
42 -62.4001r26_A mol:protein length:125 Thioredoxin  ali model follow..  21  8..........MRARYPSVVDVYSVEQFRNIMSEDILTVAWFTAVWCGPCKTIERPMEKIAYEFP-TVKFAKVDADNNSEIVSKCRVLQLPTFIIARSGKMLGHVIGANPG-MLRQKLRDIIK 117
43 -62.0001syr_A mol:protein length:112 thioredoxin  ali model follow..  30  1..............MAMVKIVTSQAEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECSKTY-TKMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGA-NDSALKQLIEKYAA 106
44 -61.8002l57_A mol:protein length:126 Uncharacterized protein  ali model follow..  15  1........MSLEGIKQINFQSINVVENLEEAKEGIPTIIMFKTDTCPYCVEMQKELSYVSKEREGKFNIYYARLEKNIDLAYKYDANIVPTTVFLKEGNKFYVHQGLMRKNNIETILNSLGV 117
45 -61.7001x5d_A mol:protein length:133 Protein disulfide-isomerase A6  ali model follow..  33  4............GSSGDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFS 117
46 -61.5001faa_A mol:protein length:124 THIOREDOXIN F  ali model follow..  29  13..........MEAIVGKVTEVNKDTFWPIVKAADKPVVLDMFTQWCGPCKAMAPKYEKLAEEYLD-VIFLKLDCNENKTLAKELGIRVVPTFKILKENSVVGEVTGAKYD-KLLEAIQAARS 124
47 -61.5002oe0_A mol:protein length:114 Thioredoxin-3  ali model follow..  28  2...........GSSYTSITKLTNLTEFRNLIKQNDKLVIDFYATWCGPCKMMQPHLTKLIQAY-PDVRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPT-ALEKGIKD... 107
48 -60.8002l6c_A mol:protein length:110 Thioredoxin  ali model follow..  17  1..............MSAIRDITTEAGMAHF-EGLSDAIVFFHKNLCPHCKNMEKVLDKFGARA-PQVAISSVDSEARPELMKELGFERVPTLVFIRDGKVAKVFSGIMNPRELQALYAS... 103
49 -60.8002dj0_A mol:protein length:137 Thioredoxin-related transmembrane protein 2  ali model follow..  21  2..........SSGSSGYIKYFNDKTIDEELERDRVTWIVEFFANWSNDCQSFAPIYADLSLKYNTGLNFGKVDVGRYTDVSTRYKVKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSE.. 119
50 -59.5002f51_A mol:protein length:118 thioredoxin  ali model follow..  27  7.................HFNGTHEALLNRIKEAPGLVLVDFFATWCGPCQRLGQILPSIAEAN-KDVTFIKVDVDKNGNAADAYGVSSIPALFFVKKEGNEIKTLDQFDVSRIKADIEKF.. 111
51 -59.2002xbq_A mol:protein length:117 THIOREDOXIN  ali model follow..  31  12.............MSELIELKQDGDLESLLEQHNKLVVVDFFATWCGPCKTIAPLFKELSEKY--DAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIA-KVEDMIKKFI. 117
52 -59.2003f3q_A mol:protein length:109 Thioredoxin-1  ali model follow..  36  2.................VTQFKTASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYP-QADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPA-AIKQAIAAN.. 102
53 -59.1002dml_A mol:protein length:130 Protein disulfide-isomerase A6  ali model follow..  27  14............SSSDDVIELTPSNFNREVIQSDGLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVNADKHQSLGGQYGVQGFPTIKIFGANKKPEDYQGGRTGEAIVDAALSALR 124
54 -58.2003qdn_A mol:protein length:287 Putative thioredoxin protein  ali model follow..  25  6..............VQNIVNINESNLQQTLEQSTTPVLFYFWSERSQHCLQLTPVLESLAAQYHGQFILAKLDCDAEQMIAAQFGLRAIPTVYLFQNGQPVDGFQGPQPEEAIRALLDKVLP 114
55 -58.0002dj3_A mol:protein length:133 Protein disulfide-isomerase A4  ali model follow..  26  6..............SGPVKVVVGKTFDAIVMDPKKDVLIEFYAPWCGHCKQLEPIYTSLGKKYKGQLVIAKMDATANDITNDQYKVEGFPTIYFAPSGDKIKFEGGNRDLEHLSKFIDEHAT 118
56 -57.8002vim_A mol:protein length:104 THIOREDOXIN  ali model follow..  30  2.................RVLATAADLEKLINENGRLIVVDFFAQWCGPCRNIAPKVEALAKEI-PEVEFAKVDVDQNEEAAAKYSVTAMPTFVFIKDGKEVDRFSGA-NETKLRETITRH.. 103
57 -57.8002xbi_A mol:protein length:108 THIOREDOXIN  ali model follow..  32  1...........GSMSKLIELKQDGDLESLLEQHNKLVVVDFFATWCGPCKTIAPLFKELSEKY--DAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIA-KVEDMIKKFI. 108
58 -57.8003d6i_A mol:protein length:112 Monothiol glutaredoxin-3  ali model follow..  17  2..............VIEINDQEQFTYLTTTAAGDKLIVLYFHTSWAEPCKALKQVFEAISNEPSSNVSFLSIDADENSEISELFEISAVPYFIIIHKGTILKELSGADPK-EYVSLLEDCKN 109
59 -57.7003qou_A mol:protein length:287 protein ybbN  ali model follow..  26  6..............VENIVNINESNLQQVLEQSTTPVLFYFWSERSQHCLQLTPILESLAAQYNGQFILAKLDCDAEQMIAAQFGLRAIPTVYLFQNGQPVDGFQGPQPEEAIRALLDKVLP 114
60 -57.3001x5c_A mol:protein length:121 Protein disulfide-isomerase  ali model follow..  22  6..............SGPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVINGERTLDGFKKFLESGGQ 115
61 -57.0001ti3_A mol:protein length:113 thioredoxin H  ali model follow..  28  7.............IACHTVDTWKEHFE-KGKGSQKLIVVDFTASWCPPCKMIAPIFAELAKKF-PNVTFLKVDVDELKAVAEEWNVEAMPTFIFLKDGKLVDKTVGA-DKDGLPTLVAKHAT 112
62 -55.8002vm1_A mol:protein length:118 THIOREDOXIN H ISOFORM 1.  ali model follow..  27  2..........AAEEGAVIACHTKQEFDTHMANTGKLVIIDFTASWCGPCRVIAPVFAEYAKKFPG-AIFLKVDVDELKDVAEAYNVEAMPTFLFIKDGEKVDSVVGGRKD-DIHTKIVALMG 114
63 -55.5002diy_A mol:protein length:130 Thioredoxin-like protein 2  ali model follow..  24  14..........EAAVAAVEEVGSAGQFEELLLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELP-QVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAP-ELTKKVQRHAS 124
64 -54.9002diz_A mol:protein length:117 Thioredoxin domain-containing protein 5  ali model follow..  28  4............GSSGTVLALTENNFDDTI--AEGITFIKFYAPWCGHCKTLAPTWEELSKKELAGVKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSLHRFVLSQAK 114
65 -54.8003ZZX Entity 1(prereleased)  ali follow..  31  7.....................DQEDFTKQLNEANKLVVIDFYATWCGPCKMIAPKLEELSQSM-SDVVFLKVDVDECEDIAQDNQIACMPTFLFMKNGQKLDSLSGA-NYDKLLELVEKN.. 104
66 -54.6001xfl_A mol:protein length:124 Thioredoxin h1  ali model follow..  29  26...........................QKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKL-PNVLFLKVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGA-KKDELQSTIAKHLA 118
67 -53.9001wmj_A mol:protein length:130 Thioredoxin H-type  ali model follow..  33  21.....................NKDEFDAQMTKAGKVVIIDFTASWCGPCRFIAPVFAEYAKKFPG-AVFLKVDVDELKEVAEKYNVEAMPTFLFIKDGAEADKVVGA-RKDDLQNTIVKHVG 122
68 -53.9002wz9_A mol:protein length:153 GLUTAREDOXIN-3  ali model follow..  24  8..........EAAVAAVEEVGSAGQFEELLLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELP-QVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAP-ELTKKVQRHAS 118
69 -53.8002iwt_A mol:protein length:125 THIOREDOXIN H ISOFORM 2  ali model follow..  24  22.....................SLEQWTEEANTAKKLVVIDFTASWCGPSRIMAPVFADLAKKFPN-AVFLKVDVDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKE-ELTAKVGLHAA 123
70 -53.0003Q6O Entity 1(prereleased)  ali follow..  26  9............SPSDPLTLLQADTVRGAVLGSRSAWAVEFFASWCGHCIAFAPTWXGGSYLAREKGVAVRRVLNTEANVVRKFGVTDFPSCLLFRNGSVSRVPVLMESRSFYTAYLQRLSG 127
71 -52.9003kd0_A mol:protein length:105 Thioredoxin  ali model follow..  27  7.....................SKTAFQEALDAADKLVVVDFSATWCGPSKMIKPFFHSLSEKY-SNVIFLEVDVDDSQDVASESEVKSMPTFQFFKKGQKVGEFSGA-NKEKLEATINELV. 105
72 -52.8001gh2_A mol:protein length:107 THIOREDOXIN-LIKE PROTEIN  ali model follow..  26  8.....................SDPDFQPELSGASRLAVVKFTMRGCGPCLRIAPAFSSMSNKYP-QAVFLEVDVHQCQGTAATNNISATPTFQFFRNKVRIDQYQGA-DAVGLEEKIKQHL. 106
73 -52.7002av4_A mol:protein length:160 Thioredoxin-like protein 4A (DIM1)  ali model follow..  19  1MGSSSSGLVPRGSSFMLQHLNSGWAVDQAIVNEERLVCIRFGHDYDPDCMKMDELLYKVADDIKNFCVIYLVDITEVPDFNTMYELYDPVSVMFFYRNKHMMIDLGTGNNNKINWPMNNK.. 121
74 -52.7001aiu_A mol:protein length:105 THIOREDOXIN  ali model follow..  26  7.....................SKTAFQEALDAADKLVVVDFSATWCGPCKMIKPFFHSLSEKY-SNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGA-NKEKLEATINELV. 105
75 -52.6003qfa_C mol:protein length:116 Thioredoxin  ali model follow..  27  12.....................SKTAFQEALDAADKLVVVDFSATWCGPSKMIKPFFHSLSEKY-SNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGA-NKEKLEATINELV. 110

FFAS is supported by the NIH grant R01-GM087218-01
5 9 8 2 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Damiano JS, Stehlik C, Pio F, Godzik A., Reed JC. CLAN, a novel human CED-4-like gene. Genomics. 2001 Jul;75(1-3):77-83.