current user: public




2o08A
Query: 2o08_A mol:protein length:188 BH1327 protein, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# Score Template Links and tools%idFirst GMNRGKALQLVKPHLTEHRYQHTIGVMETAIDLAKLYGADQQKAELAAIFHDYAKFRDKNEMRTLIREKLSQQDILFYGDELLHAPCGAYYVREEVGIEDEDVLQAIRFHTTGRPNMSLLEKIIFLADYIEPNRQFPGVEKVRTQAKTDLNGAIISSLVNTITFLLKKNQPIYPDTLATYNQLLLEQKLast
1 -95.3002o08_A mol:protein length:188 BH1327 protein  ali model  100  1GMNRGKALQLVKPHLTEHRYQHTIGVMETAIDLAKLYGADQQKAELAAIFHDYAKFRDKNEMRTLIREKLSQQDILFYGDELLHAPCGAYYVREEVGIEDEDVLQAIRFHTTGRPNMSLLEKIIFLADYIEPNRQFPGVEKVRTQAKTDLNGAIISSLVNTITFLLKKNQPIYPDTLATYNQLLLEQK 188
2 -90.3002ogi_A mol:protein length:196 Hypothetical protein SAG1661  ali model follow..  42  9GLDRTELLSKVRHMMSDKRFNHVLGVERAAIELAERYGYDKEKAGLAALLHDYAKELSDDEFLRLIDKYQPDPDLKKWGNNIWHGLVGIYKIQEDLAIKDQDILAAIAKHTVGSAQMSTLDKIVYVADYIEHNRDFPGVEEARELAKVDLNKAVAYETARTVAFLASKAQPIYPKTIETYNAYIPYLD 196
3 -85.1003ccg_A mol:protein length:190 HD superfamily hydrolase  ali model follow..  41  3.WSYDKITDYLMNNLGEKRYKHSLGVMDTAVRLAGIYNEDTEKARIAGLVHDCAKKLPGEKIIEICTNEGYLGDEDIRNSYLLHGLAGRILAKKVIGIDDEDVLNAIEFHTTGRPNMSLLEKIIYIADYIEPGREFKGVDELRKAADEDLNKALLMSFDNTIKFVIDKGGFLHHNTIEARNYLISRK. 189
4 -23.9002pq7_A mol:protein length:220 Predicted HD superfamily hydrolase  ali model follow..  29  13..HLREILNIVREAFKDHDISHTFRVMENASEIASREKCDLQKAIIAALLHDIKRPHEALTGVD-------------------HAESGAEYASGTMGFDISFVSKAIRSHSGGLTPTSLTGKILQDADRLD......................................................... 135
5 -22.7003b57_A mol:protein length:209 Lin1889 protein  ali model follow..  17  1.MNKEEIILSAKNWMHSHDWSHIKRVWKLSKEIQSKEGGDLFTIELAALFHDYSDIKLTT-----------------------DEQEATKTLINWMETKEKKIIRIIQSVSNTFKALTIEEKIVQDADRLD......................................................... 126
6 -22.6003djb_A mol:protein length:223 Hydrolase, HD family  ali model follow..  19  1.MTKQEKIEKTITFVKHHDWYHIRRVHKMAISLSEQEGGNRFIIEMAALLHDVADEKLNE-----------------------SEEAGMKKVSDWLEELHKHVLHIIANMSHGGKVESIEGKLVQDADRLD......................................................... 125
7 -22.4003dto_A mol:protein length:223 BH2835 protein  ali model follow..  14  1.MNEQAILQSAEAWVKKHDWYHIRRVTLMAKAIGEQEKVDVFVVQIAALFHDLIDDKLVD-----------------------DPETAKQQLIDWMEAAGDHTMDIINTISHGQSLATREAMVVQDADRLD......................................................... 125
8 -21.9003gw7_A mol:protein length:239 Uncharacterized protein yedJ  ali model follow..  21  1.MDLQHWQAQFENWLKNHDVCHFRRVWATAQKLAADDDVDMLVILTACYFHDIVSLAKNHP--------------QRQRSSILAAEETRRLLREEFEQFPAEVCHAIAAHSAQIAPLTTEAKIVQDADRLE......................................................... 130
9 -21.0002pjq_A mol:protein length:231 Uncharacterized protein lp_2664  ali model follow..  16  5PMITETQLTAIQTYALQHGRDHLQRVNRLARRLAKDEGANLNLTLAAAWLHDVIDDKLMA-----------------------NPAKAHQDLIVQLNAQNTAIFAIIDHMSNGPQKLSLEGQVVQDADRLD......................................................... 131
10 -19.2003tm8_A mol:protein length:328 Uncharacterized protein  ali model follow..  15  155............ENTDKTISHHGVTVSTLSIALAQKLGITTQLLTLGALLHDYGHHHSPLNLNQPLDS-----SPEDLALWKKHPIEGAQKVQDKKHFDQTVINIIGQHEELREKDMDPLAVLVSSANAMDGVPKAEAAKKLMIDHVGKHPLQHIQHLNDILKGL....................... 322
11 -18.4002qgs_A mol:protein length:225 Protein SE1688  ali model follow..  17  1.MNSRMKIKKAYEYMKSHDIAHVERVYNNACYIAKRENIDTLVIELSSLLHDTVDS------------------------KLTDEILAYDQLKQFLSTLDQQVLYIIKHMSNNHVKLSIDGEIVRDADRLD......................................................... 126
12 -18.2003sk9_A mol:protein length:265 Putative uncharacterized protein TTHB187  ali model follow..  14  1.MSSMAALALWAKSGNPFHLAHMLDTAAVALAVLRMEPPRTRAAAALVGLHDLGKVFQAGWEEGKERVQRAGLPFGELLDWVAHGVFTELFLRRLLKEKGLPLAAALGAHHGFPANAERVMALASFADWVASDPSLDYLKEALRLAQEALNRL................................... 239
13 -18.1003m1t_A mol:protein length:275 Putative phosphohydrolase  ali model follow..  15  88ASAVVGAVPKVEGFDLADFWGNTFEVAIICQELAKRLGTLPEEAFTCGILHSIGELLVAATISAAVADGADRNLMEKELLGYDNAEIGALLAQS-----TPHLVKGIQFQNH-AEPYSKLAGMLAMAKQI.......................................................... 224
14 -17.4003s4l_A mol:protein length:244 CAS3 Metal dependent phosphohydrolase  ali model follow..  11  1.MILGEIMEVLAFK-NQSLIDHVNDMVKYWERIKYRYLKTIKRMKILIKLHDIGKASKIYQRA--------IINDQEKLMGFRHELVSAYYTYHILLKKFGDGALTVMLH.............................................................................. 123
15 -15.1003i7a_A mol:protein length:281 Putative metal-dependent phosphohydrolase  ali model follow..  13  116................DEVWRTSIDVTAAACSLLQIYNLNYDTLTLAGLVHNIGALPVLTEAEAHPEM--TTIEHLRSLVRKMQGPIGRAVLKS-----APEVMEVVERWAD-LGDHVSYLDFIRAAAFY.......................................................... 235
16 -14.9003hc1_A mol:protein length:305 uncharacterized HDOD domain protein  ali model follow..  15  117................STLWAHSLGVARIAKLIAERTGLNPVNVYVAGLLHDVGEVF-SQVVTLVDEEKITFGQAEERLFGTSHCEVGFALAKR-----NEFICDTILYHEAVPYKQAAIVAMVAFADEY.......................................................... 240
17 -14.9003p3q_A mol:protein length:283 MmoQ  ali model follow..  101...................WQKSLARAVALQSITAQASVAPKEAFTLGLLADVGRLAEEYSECLRKADGEALIALERERFATDHDELTRMLLTD-----PQVFIDALQLSIRDEGRTGRFARQLTLAQHI.......................................................... 220
18 -14.5003ljx_A mol:protein length:288 MmoQ Response regulator  ali model follow..  110...................WQKSLARAVALQSITAQASVAPKEAFTLGLLADVGRLAEEYSECLRKADGEALIALERERFATDHDELTRMLLTD-----PQVFIDALQLSIRDEGRTGRFARQLALAQHI.......................................................... 229
19 -14.2001vqr_A mol:protein length:297 hypothetical protein Cj0248  ali model follow..  120...................LKTCNEEATFIANWLNDEDKLSHLLVPCAMLLRLGINHKDKDFLAFLNKNENLALAENEFLGVDHISFLGFLLHR-----DDVLIESICFVHAAREKVKKSAYALAITDHL.......................................................... 241
20 -13.1002gz4_A mol:protein length:207 Hypothetical protein Atu1052  ali model follow..  29.VEIADIAHGLARVARFTVAQHCLIVETIFCRMCP---GATPDEMQMALLHDAPEYVIGDMISPF-----------------------KSVVGGGYKTVEKRLEAAVLRFGLPPHASRELKDRIKKADTVAAFFEATELAGFSTAEAQKFFGLPRGITRDMFDIIPLPSTEAQRLFIARFEAIETLRV 200
21 -12.9003mem_A mol:protein length:457 Putative signal transduction protein  ali model follow..  14  277................VDYWQQAIWQAQSAGILASMMPPLFGLAYLAGLLHNFGHHFKLVCRSLEVSPHIDSSVIEHYLLGITREQIAAQLMEN-----PDEVTLAIRYQKN-DGPHNVYARLLWLGRQL.......................................................... 403
22 -12.2002paq_A mol:protein length:201 5`-deoxynucleotidase YfbR  ali model follow..  12  15.LKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNVNAERIALLAMYHDASEVLTGD----------TPVKYFNSQIAQEYKAIEKIAQQKLVDMVPEELRDIFAPLIDEHAYSDEEKSLVKQADALCA........................................................ 143
23 -12.2003kh1_A mol:protein length:200 Predicted metal-dependent phosphohydrolase  ali model follow..  11  38...............RENDAEHSWHIATMAFLLAEYADVQIGRVARMLLIHDIVEIDAGDTFIHDEAGNEDKEERERKAAARLFGLLPPDQAAEYSALWQE------------EARETADARFADALDRLQP........................................................ 145
24 -12.2003mzo_A mol:protein length:216 Lin2634 protein  ali model follow..  11  1GMGIHQYFQSLSDLENIYRCEHSYKVTSIAQFFGAV-EVNWRALYEKALNHDYSELFIGDIKTPVKYATTELREMLSEVEESMTKNFISREIPATFQPIYRHLLKEGKDSTLEGKILAISDKVDLLYESFGEIQKGNPENIFVEIYSEALATIYEYREMASVKYFLKE.................... 185
25 -11.7004DMB Entity 1(prereleased)  ali follow..  13  43...............PESVSDHMYRMAVMAMVIKDD-RLNKDRCVRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLPEDLRKELYELWEE------------ETQSSAEAKFVKQLDQCEM........................................................ 147
26 -11.6002dqb_A mol:protein length:376 Deoxyguanosinetriphosphate triphosphohydrolas  ali model follow..  17  74................RTRLTHTLEVAQVSRSIARALGLNEDLTEAIALSHDLGH--TGEHVLNALMQDHGGFEHNAQALRILTHLEVRYPGFRGLNLT--EVLEGIATHEAAYSPGTLEAQVVDLSDAI-------------AYAAHDLDDGFRAGL.............................. 213
27 -10.9001xx7_A mol:protein length:184 oxetanocin-like protein  ali model follow..  15  29...............PESVADHSYRVAFITLLLAEELEIDVEKALKIAIIHDLGEAIITDYLNKEEAEAKALKDVLPEYTELFEEYSKALTLEGQLVKIADKLDMIIQAYEYELSGAKNLSEFWNALEDLEKLEISRYLREIIEEVRRLKDD.................................... 177
28 -10.9002hek_A mol:protein length:371 Hypothetical protein  ali model follow..  14  39......LAYLVFPSAQHTRFEHSLGVYHITERICESLKVEKELVKLAGLLHDLGRERSHEDFTERVIKETEIYEILKQDYS--EEKLLSEIITGEFGSDRMDYLRRDAYFCGVSYGFFDYDRLISTLRVYENKSGLRALENFVQVYFHKVVRILSIHLVEFLKKLISQEDFTDINNFLRLN....... 256
29 -10.7002cqz_A mol:protein length:177 177aa long hypothetical protein  ali model follow..  18  30...............PESIADHSFGVAFITLVLADVLRIDVEKALKMAIVHDLAEAIITD-----IPLSAQEFVDKDKAEALVFKKVFPEFYELYREYQECSSPEA---------------QLVRIADKLDM........................................................ 131
30 -10.4001yoy_A mol:protein length:175 hypothetical protein AF1432  ali model follow..  17  38...............PESVAEHSFRAAIIAFILALKSGEKACKAATAALFHDLHEARTMDLHKIARRYVSCDEEGAREEQLSWMESKPDFSDVEVY----ELAFQGVEYSQQVSYAIRFAENVELKTDAAKE........................................................ 160
31 -9.9002o6i_A mol:protein length:480 HD domain protein  ali model follow..  12  78...............EHSRFSHSLGVYEITRRICEIFQRERLITLCAALLHDVG--------------HGPYSHTFEHIFDTNHEAITVQIITSPETEVYEKVASVITKQYPNPQVVQMIDRMDYLLDAYFTGTEYGTFDLTR............................................. 224
32 -9.8102q14_A mol:protein length:410 Phosphohydrolase  ali model follow..  14  53...............QHTRFQHSLGAFYLMSEAITQLTSEAEAVQAAILLHDIGHGPFSHVLEDTIVQGVSHEEISLMLMERMNKEMNGQLSLAIQIFKDEYPKRFLHQLVSGQLDMDRLDYLR--RDSFYTGVTEGNIGSAR............................................. 186
33 -9.5903nr1_A mol:protein length:178 HD domain-containing protein 3  ali model follow..  20  24...........KDPEGTPYINHPIGVARI---LTHEAGITDIVVLQAALLHDTVEDTD----------------------------TTLDEVELHFGAQVRRLVEEVRLQVEQAPHSSPGAKLVKLADKLYNLRD..................................................... 128

FFAS is supported by the NIH grant R01-GM087218-01
5 9 8 5 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Godzik A. Fragnostic: walking through protein structure space. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W249-51.