current user: public




Query: 2o08_A mol:protein length:188 BH1327 protein, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# Score Template Links and tools%idFirst GMNRGKALQLVKPHLTEHRYQHTIGVMETAIDLAKLYGADQQKAELAAIFHDYAKFRDKNEMRTLIREKLSQQDILFYGDELLHAPCGAYYVREEVGIEDEDVLQAIRFHTTGRPNMSLLEKIIFLADYIEPNRQFPGVEKVRTQAKTDLNGAIISSLVNTITFLLKKNQPIYPDTLATYNQLLLEQKLast
1 -104.0002o08_A mol:protein length:188 BH1327 protein  ali model  100  1GMNRGKALQLVKPHLTEHRYQHTIGVMETAIDLAKLYGADQQKAELAAIFHDYAKFRDKNEMRTLIREKLSQQDILFYGDELLHAPCGAYYVREEVGIEDEDVLQAIRFHTTGRPNMSLLEKIIFLADYIEPNRQFPGVEKVRTQAKTDLNGAIISSLVNTITFLLKKNQPIYPDTLATYNQLLLEQK 188
2 -99.7002ogi_A mol:protein length:196 Hypothetical protein SAG1661  ali model follow..  42  9GLDRTELLSKVRHMMSDKRFNHVLGVERAAIELAERYGYDKEKAGLAALLHDYAKELSDDEFLRLIDKYQPDPDLKKWGNNIWHGLVGIYKIQEDLAIKDQDILAAIAKHTVGSAQMSTLDKIVYVADYIEHNRDFPGVEEARELAKVDLNKAVAYETARTVAFLASKAQPIYPKTIETYNAYIPYLD 196
3 -97.6003ccg_A mol:protein length:190 HD superfamily hydrolase  ali model follow..  41  3.WSYDKITDYLMNNLGEKRYKHSLGVMDTAVRLAGIYNEDTEKARIAGLVHDCAKKLPGEKIIEICTNEGYEGDEDIRNSYLLHGLAGRILAKKVIGIDDEDVLNAIEFHTTGRPNMSLLEKIIYIADYIEPGREFKGVDELRKAADEDLNKALLMSFDNTIKFVIDKGGFLHHNTIEARNYLISRK. 189
4 -15.6003tm8_A mol:protein length:328 Uncharacterized protein  ali model follow..  16  155............ENTDKTISHHGVTVSTLSIALAQKLGITDPKLTLGALLHDYGHHHSPLNLNQ--PLDSMSPEDLALWKK--HPIEGAQKVQDKKHFDQTVINIIGQHEETGEKDMDPLAVLVSSANAMDGVPKAEAAKKLMIDHVGKHPLQHIQHLNDILK......................... 320
5 -14.1003m1t_A mol:protein length:275 Putative phosphohydrolase  ali model follow..  20  107...................WGNTFEVAIICQELAKRLGTLPEEAFTCGILHSIGELL-PAVAATISAAVADGADRNLMEKELLNAEIGALLAQS-----TPHLVKGIQFQPKSAEPYSKLAGMLAMAKQI.......................................................... 224
6 -12.9003s4l_A mol:protein length:244 CAS3 Metal dependent phosphohydrolase  ali model follow..  12  5..EIMEVLAFKNQSLID----HVNDMVKYWERIKYRYLKTIKRMKILIKLHDIGKA--SKIYQRAIINDQEKLMGFR------HELVSAYYTYHILLKKFGDGALTVMLH.............................................................................. 123
7 -12.8003hc1_A mol:protein length:305 uncharacterized HDOD domain protein  ali model follow..  18  120...................WAHSLGVARIAKLIAERTGLNPVNVYVAGLLHDVGEFRGKEFSQVVTLVDEEKITFGQAEERLFHCEVGFALAKR-----NEFICDTILYHEAVPYKQAAIVAMVAFADEY.......................................................... 240
8 -12.6002pq7_A mol:protein length:220 Predicted HD superfamily hydrolase  ali model follow..  23  8.MERIPHLREILNIVREA-ISHTFRVMENASEIASREKCDLQKAIIAALLHDIKRPHEALTGVD-------------------HAESGAEYASGLLPTMGAEVSKAIRSHRGGLTPTSLTGKILQDAD--------------------RLDAIGAVAIARVFSYSGKTGTPLHSLQFSPRSSYSGNSR 172
9 -12.5003b57_A mol:protein length:209 Lin1889 protein  ali model follow..  16  1.MNKEEIILSAKNWMHSH-WSHIKRVWKLSKEIQSKEGGDLFTIELAALFHDYSEQEATKTLINWMETKEIPSELIKKIIRIIQSV-KGKNTFKALTIEEKIVQDADRLDAIGAIGIARTDKLLLIKDQLNTETAKTIAKEKQKIMQDFIQA.................................... 194
10 -12.3004s1b_A mol:protein length:222 Lmo1466 protein  ali model follow..  16  19...................YHHSMMVANLAEACADKIGANSLLVRVGCFYHDIGKTLRVENQLQGINPHDRLTPEQSRDIILSHTKDGAEILKEN----PQPIIDIALQH-SGPKPQTKEIAIINISDSVEA-----AVRSSTEPTMAKITEIIDGIIKDRFL......................... 185
11 -11.9003p3q_A mol:protein length:283 MmoQ  ali model follow..  101...................WQKSLARAVALQSITAQASVAPKEAFTLGLLADVGRATAWPEEYSECLRKADGEALIALERERFHDELTRMLLTD-----PQVFIDALQLSIRDEGRTGRFARQLTLAQHI.......................................................... 220
12 -11.8003gw7_A mol:protein length:239 Uncharacterized protein yedJ  ali model follow..  20  1.MDLQHWQAQFENWLKNH-VCHFRRVWATAQKLAADDDVDMLVILTACYFHDIVSLAKNHPQRQR-------------SSILAAEETRRLLREEFEQFPAEAVCHAIAAHSAQIAPLTTEAKIVQDADRLE......................................................... 130
13 -11.8003dto_A mol:protein length:223 BH2835 protein  ali model follow..  15  1.MNEQAILQSAEAWVKKQ-WYHIRRVTLMAKAIGEQEKVDVFVVQIAALFHDLIPETAKQQLIDWMEAAGVPSQKIDH-----------------------DIINTISFKGGHGQSLATREMVVQDADRLDAARTFPELPIRETMTVEEYRHGKSTAINHFYEKLFKLKDLMNTET............ 188
14 -11.8003djb_A mol:protein length:223 Hydrolase, HD family  ali model follow..  15  1.MTKQEKIEKTITFVKHI-WYHIRRVHKMAISLSEQEGGNRFIIEMAALLHDVAEEAGMKKVSDWLEELHVEEEESKH-----------------------HIIANMSYKGGHGGKVESIEKLVQDADRLDAARTFPTIPPREVMTKDEYRKNNDPSLNHFYEKLLKLKDLMNTNA............ 188
15 -11.8005dqv_A mol:protein length:211 Uncharacterized protein  ali model follow..  15  7.MTELKQADQIRTWVQSV-WLHISRVADLAVYIGEKENADLFIVETAALVHDLIIRLSVSEVYNQLVTFGIGKEDADRVIHIITKM-REKLEGEPLSIEGKVVQDADRLDAIGAVGIARAHKLLRLIDMMNTDTARELAEERHEFMLQYIRQ.................................... 198
16 -11.5003ljx_A mol:protein length:288 MmoQ Response regulator  ali model follow..  110...................WQKSLARAVALQSITAQASVAPKEAFTLGLLADVGRATAWPEEYSECLRKADGEALIALERERFHDELTRMLLTD-----PQVFIDALQLSIRDEGRTGRFARQLALAQHI.......................................................... 229
17 -11.0002pjq_A mol:protein length:231 Uncharacterized protein lp_2664  ali model follow..  14  6.MITETQLTAIQTYALQK-RDHLQRVNRLARRLAKDEGANLNLTLAAAWLHDVIPAKAHQDLIVQLNAQNVTADDQTAIFAIIDSFSKSFNGPQKLSLEGQVVQDADRLDAIGAIGIA---RALYYSGHVGEKIYDPAIAPREHMTREQYRHQPGTAINHFYEKLFKLAALMNTDT............ 194
18 -10.8004n71_A mol:protein length:198 Predicted HD phosphohydrolase PhnZ  ali model follow..  17  2SLSNSSKVSVLISLLEKNQLEHSL----QCAYFAQRSGAD-NEMVLAALLHDLGHYCNDTS-----------FEDMGGYGVWQHEKVGADYLRG-----SERVACLIEGHVAAKRYLVSSK................................................................... 115
19 -10.6003i7a_A mol:protein length:281 Putative metal-dependent phosphohydrolase  ali model follow..  11  119...................WRTSIDVTAAACSLLQIYGLNYDTLTLAGLVHNIGALTEAEAHPEMFTTIEHLRSLVRKM----QGPIGRAVLKS-----APEVMEVVERWAD-LGDHVSYLDFIRAAAFYTGELRAELEQRLDVFVKRGLPVSPEDLGSDAFLDSYHSIKASY............... 280
20 -10.4003sk9_A mol:protein length:265 Putative uncharacterized protein TTHB187  ali model follow..  16  23.....................HMLDTAAVALAVAEDWGLPEEGALALVGLHDLGKASPVFQAGWEEGKERVQRAGLPFGELL-HGVFTELFLRRLLKEKGNDLAAALGAHEARPEAVLRVMALASFADWVASDPSLPRRGDYLKEALRLAQEAL.................................. 236
21 -10.2004n6w_A mol:protein length:228 Predicted HD phosphohydrolase PhnZ  ali model follow..  22  62.................NQLEHSL----QCAYFAQRSGAD-NEMVLAALLHDLGHYCNDTS-----------FEDMGGYGVWQHEKVGADYLRG-----SERVACLIEGHVAAKRYLVSSK................................................................... 147
22 -10.1004mcw_A mol:protein length:369 Metal dependent phosphohydrolase  ali model follow..  20  179.....YRLSHATKFKDPETQNHIIRVGLYAEILAREAGLDEEDVELAAPMHDIGKVGIPDRV--LLKPGKLNDE--EWEIMKKHTIYGYEILKG----GDSRLLQAIEHHETGYPEISIYGRMTSISDVFDADRPYKKVRFFKEQKGKHFDPFLTDIFLKNIDQMFS..................... 360
23 -9.9503mem_A mol:protein length:457 Putative signal transduction protein  ali model follow..  16  280...................WQQAIWQAQSAGILASMMPPLFGLAYLAGLLHNFGHQVFPPHFKLVCRSLEVSPHIDSSVIEITREQIAAQLMEN-----PDEVTLAIRYQKN-DGPHNVYARLLWLGRQL.......................................................... 403
24 -9.7902qgs_A mol:protein length:225 Protein SE1688  ali model follow..  13  1.MNSRMKIKKAYEYMKSF-IAHVERVYNNACYIAKRENTDTLVIELSSLLHDTVEILAYDQLKQFLSTLDLSSEISQQVLYIIKHM-AGKNNHVKLSIDGEIVRDADRLDAIGAIGIA---RTFQFSGHFGEPMWTETKLSNEELHTSLVEELDNSAIKHFYEKLFKLKDLMHTPT............ 189
25 -9.5402hek_A mol:protein length:371 Hypothetical protein  ali model follow..  17  34.VKQLGLAYLVFPSAQHTRFEHSLGVYHITERICESLKVKEKEVKLAGLLHDLGHPPFSHTTEVLLPRERSHEDF---TERVIKETEIYEILKQDYSHEDIERLVRITLGKPEDEEEKLLSEII--MDYLRRDAYFCGVSYISTLRVYENKVVVDESGLRALENFLISRYFMYVQVY........... 221
26 -9.4501vqr_A mol:protein length:297 hypothetical protein Cj0248  ali model follow..  120...................LKTCNEEATFIANWLNDEDKLSHLLVPCAMLLRLGINHKDKDFLAFLNKNENLALAENEFLGVDHISFLGFLLHR-----DDVLIESICFVHAAREKVKKSAYALAITDHLFAPHDG-SSPFNAKAAVALLKEAKTQGINFDLNNLLSKLPNKAKENLNKED....... 291

FFAS is supported by the NIH grant R01-GM087218-01
8 3 0 3 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.