current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

2katA
Query: 2kat_A mol:protein length:115 uncharacterized protein, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MQAITERLEAMLAQGTDNMLLRFTLGKTYAEHEQFDAALPHLRAALDFDPTYSVAWKWLGKTLQGQGDRAGARQAWESGLAAAQSRGDQQVVKELQVFLRRLAREDALELast
1 -66.8002kat_A mol:protein length:115 uncharacterized protein  ali model  100  1MQAITERLEAMLAQGTDNMLLRFTLGKTYAEHEQFDAALPHLRAALDFDPTYSVAWKWLGKTLQGQGDRAGARQAWESGLAAAQSRGDQQVVKELQVFLRRLAREDALE 109
2 -53.3003ma5_A mol:protein length:100 Tetratricopeptide repeat domain protein  ali model follow..  20  3..............DPEDPFTRYALAQEHLKHDNASRALALFEELVETDPDYVGTYYHLGKLYERLDRTDDAIDTYAQGIEVAREEGTQKDLSELQDAKLKAEGLE... 94
3 -49.2002fo7_A mol:protein length:136 SYNTHETIC CONSENSUS TPR PROTEIN  ali model follow..  20  17YDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS--AEAWYNLGNAYYKQGDYDEA. 122
4 -48.2001na0_A mol:protein length:125 designed protein CTPR3  ali model follow..  21  25YDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNN--AEAKQNLGNAKQKQG...... 125
5 -48.0003kd7_A mol:protein length:125 CTPR390  ali model follow..  20  25YQKAIEYYQKALELDPNNASAWYNLGNAYYKQGDYQKAIEYYQKALELDPNNAKAWYRRGNAYYKQGDYQKAIEDYQKALELDPNN--AKAKQNLGNAKQKQG...... 125
6 -47.9002wqh_A mol:protein length:125 CTPR3Y3  ali model follow..  20  25YDEAIEYYQKALELYPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNN--AEAKQNLGNAKQKQG...... 125
7 -45.6001elr_A mol:protein length:131 TPR2A-DOMAIN OF HOP  ali model follow..  11  20FDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGREIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERL.... 131
8 -45.3002kck_A mol:protein length:112 TPR repeat  ali model follow..  14  1.............MVDQNPEEYYLEGVLQYDAGNYTESIDLFEKAIQLDPEESKYWLMKGKALYNLERYEEAVDCYNYVINVIEDEYNKDVWAAKADALRYIEGKEVE. 95
9 -45.1002vyi_A mol:protein length:131 SGTA PROTEIN  ali model follow..  15  28FEAAVHFYGKAIELNPANAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPAYSKAYGRMGLALSSLNKHVEAVAYYKKALELDPD--NETYKSNLKIAELKLREA.... 130
10 -44.8003asg_A mol:protein length:186 MamA  ali model follow..  23  58VDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALKNLGRFDEAIDSFKIALGLRPN--EGKVHRAIAFSYEQMGRHEEA. 163
11 -44.6003as8_A mol:protein length:186 Magnetosome protein MamA  ali model follow..  21  58VDRGTELLERSIADAPDNIKVATVLGLTYVQVQKYDLAVPLLVKVAEANPVNFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPN--EGKVHRAIAYSYEQMGSHEEA. 163
12 -44.2003asd_A mol:protein length:200 MamA  ali model follow..  23  58VDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPN--EGKVHRAIAFSYEQMGRHEEA. 163
13 -44.0002lni_A mol:protein length:133 Stress-induced-phosphoprotein 1  ali model follow..  12  26YPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSS--CKEAADGYQRCMMAQYN..... 127
14 -43.9002vgy_A mol:protein length:148 CHAPERONE SYCD  ali model follow..  11  37YEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYEEGAVMDIKEPRFPFHAAECLLQKGELAEAESGLFLAQELIANKPEKELSTRVSSMLEAIKLKKEMK 146
15 -43.9002vgx_A mol:protein length:148 CHAPERONE SYCD  ali model follow..  11  37YEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYSYGAVMDIKEPRFPFHAAECLLQKGELAEAESGLFLAQELIANKPEKELSTRVSSMLEAIKLKKEMK 146
16 -43.9003fwv_A mol:protein length:128 Hsc70/Hsp90-organizing protein  ali model follow..  10  20FDTALKHYDKAKELDPTNMTYIVNQAAVYFEKGDYNKCRELCEKAIEVGRENAYAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPKVLKKCQQAEKILKE........ 127
17 -43.4002q7f_A mol:protein length:243 YrrB protein  ali model follow..  13  67LERALAFYDKALELDSSAATAYYGAGNVYVVKEMYKEAKDMFEKALRAGMENGDLFYMLGTVLVKLEQPKLALPYLQRAVELNEN--DTEARFQFGMCLANEGMLDEA. 172
18 -43.3001hxi_A mol:protein length:121 PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5  ali model follow..  18  33LAEAALAFEAVCQKEPEREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLLSQPQYEQ..................... 120
19 -42.9003r9a_B mol:protein length:328 Peroxisomal targeting signal 1 receptor  ali model follow..  23  193YDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPNIWSTLRLALSMLGQSDAY. 309
20 -42.5001na3_A mol:protein length:91 designed protein CTPR2  ali model follow..  22  2............AMDPNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNN--AEAKQNLGNAKQKQG...... 91
21 -42.4003sz7_A mol:protein length:164 Hsc70 cochaperone (SGT)  ali model follow..  22  27YSKAIDLYTQALSIAPANPIYLSNRAAAYSASGQHEKAAEDAELATVVDPKYSKAWSRLGLARFDMADYKGAKEAYEKGIEAEGNGGSDAMKRGLETTKRKIEEANRG. 134
22 -42.3002xcb_A mol:protein length:142 REGULATORY PROTEIN PCRH  ali model follow..  13  34WDDAQKIFQALCMLDHYDARYFLGLGACRQSLGLYEQALQSYSYGALMDINEPRFPFHAAECHLQLGDLDGAESGFYSARALAAAQPAEALAARAGAMLEAVTARKD.. 141
23 -42.0001fch_A mol:protein length:368 PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR  ali model follow..  23  233YDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPNIWSTLRLALSMLGQSDAY. 349
24 -41.9001w3b_A mol:protein length:388 UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUC  ali model follow..  19  117MEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNF--LDAYINLGNVLKEARIFDRA. 222
25 -41.9003cvq_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  22  154YRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGY--VRVMYNMAVSYSNMSQYDLA. 259
26 -41.8003cv0_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  22  154YRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGY--VRVMYNMAVSYSNMSQYDLA. 259
27 -41.2003upv_A mol:protein length:126 Heat shock protein STI1  ali model follow..  10  20WPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQLYYKASQQR... 125
28 -40.6003uq3_A mol:protein length:258 Heat shock protein STI1  ali model follow..  155WPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEV--NNGSSAREIDQLYYKASQ... 258
29 -40.2003urz_A mol:protein length:208 Uncharacterized protein  ali model follow..  12  20NGQAVSYFRQTIALNIDRTEMYYELALAYKKNRNYDKAYLFYKELLQKAPNNVDCLEACAEMQVCRGQEKDALRMYEKILQLEAD--NLAANIFLGNYYYLTAEQEKKK 142
30 -40.2001xnf_A mol:protein length:275 Lipoprotein nlpI  ali model follow..  20  21QEVILARMEQILATDDERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYLGIYLTQAGNFDAAYEAFDSVLELDPTY--NYAHLNRGIALYYGGRDKLA. 130
31 -39.7002pl2_A mol:protein length:217 Hypothetical conserved protein TTC0263  ali model follow..  17  100LEQALSVLKDAERVNPRYAPLHLQRGLVYALLGERDKAEASLKQALALEDT-PEIRSALAELYLSMGRLDEALAQYAKALEQAPK--DLDLRVRYASALLLKGKAEEA. 204
32 -39.7002avp_A mol:protein length:70 synthetic consensus TPR protein  ali model follow..  26  1................GSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPR........................ 69
33 -39.6002vq2_A mol:protein length:225 PUTATIVE FIMBRIAL BIOGENESIS AND TWITCHING MO  ali model follow..  16  24YRQATASIEDALKSDPKNELAWLVRAEIYQYLKVNDKAQESFRQALSIKPDSAEINNNYGWFLGRLNRPAESMAYFDKALADPTYPTPYIANLNKGICSAKQGQFGLAE 133
34 -39.3002hr2_A mol:protein length:159 Hypothetical protein  ali model follow..  14  27YDEAAANCRRAMEISHTDAFCHAGLAEALAGLRSFDEALHSADKALHYFNRWISAVYSRALALDGLGRGAEAMPEFKKVVEMIEER--KGETPGKERMMEVAIDRIAQ. 155
35 -39.2003fp2_A mol:protein length:537 TPR repeat-containing protein YHR117W  ali model follow..  12  292SQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPT--LPEVPTFFAEILTDRGDFDTA. 397
36 -39.1002ho1_A mol:protein length:252 Type 4 fimbrial biogenesis protein PilF  ali model follow..  13  47TEQAKVPLRKALEIDPSSADAHAALAVVFQTEMEPKLADEEYRKALASDSRNARVLNNYGGFLYEQKRYEEAYQRLLEASQDTLYPERSRVFENLGLVSLQMKKPAQAK 155
37 -39.0001elw_A mol:protein length:118 TPR1-DOMAIN OF HOP  ali model follow..  16  20IDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEAN--NPQLKEGLQNMEAR........ 118
38 -38.8003k9i_A mol:protein length:117 BH0479 protein  ali model follow..  15  6EAQAVPYYEKAIASGKDLAECYLGLGSTFRTLGEYRKAEAVLANGVKQFPNHQALRVFYAMVLYNLGRYEQGVELLLKIIAETSDDETIQSYKQ............... 102
39 -38.6001hh8_A mol:protein length:213 NEUTROPHIL CYTOSOL FACTOR 2  ali model follow..  11  22WKGALDAFSAVQ---DPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQACEVLYNIAFMYAKKEEWKKA. 140
40 -38.4003hym_B mol:protein length:330 Cell division cycle protein 16 homolog  ali model follow..  15  209WKTAEKWFLDALEKVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRD--DTFSVTMLGHCIEMYIGDSEA. 323
41 -38.4001wm5_A mol:protein length:208 Neutrophil cytosol factor 2  ali model follow..  11  27WKGALDAFSAVQ---DPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNFACEVLYNIAFMYAKKEEWKKA. 145
42 -38.2001zu2_A mol:protein length:158 Mitochondrial import receptor subunit TOM20-3  ali model follow..  14  18FEQIRQDAENTYKSNPLDADNLTRWGGVLLELSQIQEAITKFEEALLIDPKKDEAVWCIGNAYTSFAFFDLATQFFQQAVDEQPD--NTHYLKSLEMTAKAPQLHAEA. 144
43 -37.9003u4t_A mol:protein length:272 TPR repeat-containing protein  ali model follow..  91.SLAIQQYQAAVDRDTTRLDMYGQIGSYFYNKGNFPLAIQYMEKQIRPTTTDPKVFYELGQAYYYNKEYVKADSSFVKVLELKPNIYIGEANEYIAYYYTINRDKVKA. 240
44 -37.8003ks2_A mol:protein length:151 Chaperone protein ipgC  ali model follow..  13  48IEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSN---DEKLKIKAQSYLDAIQDIKE.. 151
45 -37.8002fi7_A mol:protein length:265 type 4 fimbrial biogenesis protein PilF  ali model follow..  13  60TEQAKVPLRKALEIDPSSADAHAALAVVFQTEMEPKLADEEYRKALASDSRNARVLNNYGGFLYEQKRYEEAYQRLLEASQDTLYPERSRVFENLGLVSLQMKKPAQAK 168
46 -37.7003ieg_A mol:protein length:359 DnaJ homolog subfamily C member 3  ali model follow..  17  19LADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIALKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSEQEEQRLRSQALDAFDGADYTAA. 139
47 -37.4001a17_A mol:protein length:166 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model follow..  12  29YENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPH--DKDAKMKYQECNKIVKQKAFER 135
48 -37.3002bug_A mol:protein length:140 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model follow..  12  31YENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALNDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPH--DKDAKMKYQECNKIVKQ..... 132
49 -37.3003q47_B mol:protein length:137 STIP1 homology and U box-containing protein 1  ali model follow..  14  25YPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKE--QRLNFGDDIPSALRIAKKKRWN 131
50 -36.4003gyz_A mol:protein length:151 Chaperone protein ipgC  ali model follow..  14  20..NSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKN--DYTPVFHTGQCQLRLKAPLKA. 123
51 -36.0002gw1_A mol:protein length:514 Mitochondrial precursor proteins import recep  ali model follow..  11  286STEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE--APEVPNFFAEILTDKNDFDKA. 391
52 -35.6002l6j_A mol:protein length:111 TPR repeat-containing protein associated with  ali model follow..  20YREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSK-LQYRLELAQGAVGSVQIPVVEVDELPEG.................... 107
53 -35.3002e2e_A mol:protein length:177 Formate-dependent nitrite reductase complex n  ali model follow..  17  26PEAQLQALQDKIRANPQNSEQWALLGEYYLWQNDYSNSLLAYRQALQLRGENAELYAALATVLYYQASTAQTRAMIDKALALDSN--EITALMLLASDAFMQANYAQA. 134
54 -35.2002kc7_A mol:protein length:99 bfr218_protein  ali model follow..  18  1...................MDQLKTIKELINQGDIENALQALEEFLQTEPGKDEAYYLMGNAYRKLGDWQKALNNYQSAIELNPDSPALQARKMVMDILNFYNKYNQLE 93
55 -34.7002y4t_A mol:protein length:450 DNAJ HOMOLOG SUBFAMILY C MEMBER 3  ali model follow..  16  36LADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSENEEQRLRSQALNAFGSGDYTAA. 156
56 -33.6001tjc_A mol:protein length:108 Prolyl 4-hydroxylase alpha-1 subunit  ali model follow..  18  4.................TAEDSFELGKVAYTEADYYHTELWMEQALRQLDDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPE--HQRANGNLKYFEYIMAKEKDVN 100
57 -33.6004abn_A mol:protein length:474 TETRATRICOPEPTIDE REPEAT PROTEIN 5  ali model follow..  12  189VMDSVRQAKLAVQMDVLDGRSWYILGNAYLNPKISQQALSAYAQAEKVDRSNPDLHLNRATLHKYEESYGEALEGFSQAAALDPAW--PEPQQREQQLLEFLSRLTSL. 305
58 -33.4002v5f_A mol:protein length:104 PROLYL 4-HYDROXYLASE SUBUNIT ALPHA-1  ali model follow..  18  4.................TAEDCFELGKVAYTEADYYHTELWMEQALRQLDDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPE--HQRANGNLKYFEYIMAKEKDVN 100
59 -33.2002xpi_A mol:protein length:597 ANAPHASE-PROMOTING COMPLEX SUBUNIT CUT9  ali model follow..  12  356.NKLYLISNDLVDRHPEKAVTWLAVGIYYLCVNKISEARRYFSKSSTMDPQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLFQG--THLPYLFLGMQHMQLGNILLAN 461
60 -32.8003mkr_A mol:protein length:291 Coatomer subunit epsilon  ali model follow..  12  146LDLARKELKKMQDQDEDATLTQLATAWVSLAAGKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGVLQEALDKDSG--HPETLINLVVLSQHLGKPPEV. 253
61 -32.7003v6t_A mol:protein length:499 dHax3  ali model follow..  13  354VQRLLPVLCQAHGLTPEQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPQQ--VVAIASNGGGRPALESIVAQ. 459
62 -32.0003ro3_A mol:protein length:164 G-protein-signaling modulator 2  ali model follow..  19  26.RDAVIAHEQRLLIKAAERIAYSNLGNAYIFLGEFETASEYYKKTLLLRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQELKDGRACWSLGNAYTALGNHDQA. 148
63 -31.9002r5s_A mol:protein length:176 Uncharacterized protein VP0806  ali model follow..  16  22HAQALNVIQTLSDELQSRGDVKLAKADCLLETKQFELALKRLEQELAANPDNFELACELAVQYNQVGRDEEALELLWNILKVNLGAQDGEVKKTFMDILSALGQGNAI. 163
64 -31.6001nzn_A mol:protein length:126 Fission protein Fis1p  ali model follow..  17LLKFEKKFQSEKAAGSVSKSTQFEYAWCLVYNDDIRKGIVLLEELLPKGEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQ--NNQAKELERLIDKAMKK..... 123
65 -31.2002dba_A mol:protein length:148 Smooth muscle cell associated protein-1, isof  ali model follow..  15  45.GGALAAYTQALGLDADQAVLHRNRAACHLKLEDYDKAETEASKAIEKDGGDVKALYRRSQALEKLGRLDQAVLDLQRCVSLEPKN------KVFQEALRNISGPSSG. 148
66 -31.1002c2l_A mol:protein length:281 CARBOXY TERMINUS OF HSP70-INTERACTING PROTEIN  ali model follow..  14  20YPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFG.................. 110
67 -30.5003v6p_A mol:protein length:442 dHax3  ali model follow..  12  4..EAVHAWRNALNLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPQQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPE--QVVAIASHDGGKQALETVQAL. 112
68 -30.0003gw4_A mol:protein length:203 Uncharacterized protein  ali model follow..  18  9.ALAERQAQALLAHPATASGARFMLGYVYAFMDRFDEARASFQALQQQHTAEHRALHQVGMVERMAGNWDAARRCFLEERELLASLPESANAYEVATVALHFGDLAGA. 126
69 -29.7001pc2_A mol:protein length:152 mitochondria fission protein  ali model follow..  14LLKFEKKFQSEKAAGSVSKSTQFEYAWCLVYNDDIRKGIVLLEELLPKGSKQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQ--NNQAKELERLIDKAMKK..... 120
70 -29.7003ro2_A mol:protein length:338 G-protein-signaling modulator 2  ali model follow..  19  22.RAGVSFFEAAVQVGTEDSAIYSQLGNAYFYLHDYAKALEYHHHDLTLQLGEAKASGNLGNTLKVLGNFDEAIVCCQRHLDISRELNDARALYNLGNVYHAKGKSFGC. 142
71 -29.6001iyg_A mol:protein length:133 Hypothetical protein (2010003O14)  ali model follow..  21LKNFERKFQSEQAAGSVSKSTQFEYAWCLVRSEDIRRGIVLLEELLPKGEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQ--NNQAKELERLIDKAMKK..... 127
72 -29.0003ly7_A mol:protein length:372 Transcriptional activator cadC  ali model follow..  11  209LNRASELLGEIVQSSPEFTYAYQIKAVSALVKGKTDESYQAINTGIDLEMSWL-NYVLLGKVYEMKGMNREAADAYLTAFNLRPGANTLYWQTSVPYVVPYLDKFLASE 366
73 -28.5003sf4_A mol:protein length:406 G-protein-signaling modulator 2  ali model follow..  19  163LQAAVDFYEENLSLRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIKAAERRAYSNLGNAYIFLGEFETASEYYKKTLLLARQLKDAQSCYSLGNTYTLLQDYEKA. 286
74 -28.3003ulq_A mol:protein length:383 Response regulator aspartate phosphatase F  ali model follow..  120.LSAIKFFKKAESKRIEKAEFFFKMSESYYYMKQTYFSMDYARQAYEINIRLLQCHSLFATNFLDLKQYEDAISHFQKAYSMAEAEKQGRTLYNIGLCKNSQSQYEDA. 243
75 -27.8003q15_A mol:protein length:378 Response regulator aspartate phosphatase H  ali model follow..  16  164ILQALDIYQNHPLYSIRTIQSLFVIAGNYDDFKHYDKALPHLEAALELDRFIAISLLNIANSYDRSGDDQMAVEHFQKAAKVSREKVPPKVLFGLSWTLCKAGQTQKA. 280

FFAS is supported by the NIH grant R01-GM087218-01
6 1 0 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ginalski K, Grishin NV, Godzik A., Rychlewski L. Practical lessons from protein structure prediction. Nucleic Acids Res. 2005 Apr 1;33(6):1874-91.