current user: public

Query: 2kat_A mol:protein length:115 uncharacterized protein, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
2 -53.3003ma5_A mol:protein length:100 Tetratricopeptide repeat domain protein  ali model follow..  20  3..............DPEDPFTRYALAQEHLKHDNASRALALFEELVETDPDYVGTYYHLGKLYERLDRTDDAIDTYAQGIEVAREEGTQKDLSELQDAKLKAEGLE... 94
13 -44.0002lni_A mol:protein length:133 Stress-induced-phosphoprotein 1  ali model follow..  12  26YPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSS--CKEAADGYQRCMMAQYN..... 127
16 -43.9003fwv_A mol:protein length:128 Hsc70/Hsp90-organizing protein  ali model follow..  10  20FDTALKHYDKAKELDPTNMTYIVNQAAVYFEKGDYNKCRELCEKAIEVGRENAYAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPKVLKKCQQAEKILKE........ 127
19 -42.9003r9a_B mol:protein length:328 Peroxisomal targeting signal 1 receptor  ali model follow..  23  193YDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPNIWSTLRLALSMLGQSDAY. 309
20 -42.5001na3_A mol:protein length:91 designed protein CTPR2  ali model follow..  22  2............AMDPNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNN--AEAKQNLGNAKQKQG...... 91
25 -41.9003cvq_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  22  154YRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGY--VRVMYNMAVSYSNMSQYDLA. 259
26 -41.8003cv0_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  22  154YRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGY--VRVMYNMAVSYSNMSQYDLA. 259
31 -39.7002pl2_A mol:protein length:217 Hypothetical conserved protein TTC0263  ali model follow..  17  100LEQALSVLKDAERVNPRYAPLHLQRGLVYALLGERDKAEASLKQALALEDT-PEIRSALAELYLSMGRLDEALAQYAKALEQAPK--DLDLRVRYASALLLKGKAEEA. 204
32 -39.7002avp_A mol:protein length:70 synthetic consensus TPR protein  ali model follow..  26  1................GSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPR........................ 69
38 -38.8003k9i_A mol:protein length:117 BH0479 protein  ali model follow..  15  6EAQAVPYYEKAIASGKDLAECYLGLGSTFRTLGEYRKAEAVLANGVKQFPNHQALRVFYAMVLYNLGRYEQGVELLLKIIAETSDDETIQSYKQ............... 102
40 -38.4003hym_B mol:protein length:330 Cell division cycle protein 16 homolog  ali model follow..  15  209WKTAEKWFLDALEKVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRD--DTFSVTMLGHCIEMYIGDSEA. 323
42 -38.2001zu2_A mol:protein length:158 Mitochondrial import receptor subunit TOM20-3  ali model follow..  14  18FEQIRQDAENTYKSNPLDADNLTRWGGVLLELSQIQEAITKFEEALLIDPKKDEAVWCIGNAYTSFAFFDLATQFFQQAVDEQPD--NTHYLKSLEMTAKAPQLHAEA. 144
49 -37.3003q47_B mol:protein length:137 STIP1 homology and U box-containing protein 1  ali model follow..  14  25YPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKE--QRLNFGDDIPSALRIAKKKRWN 131
51 -36.0002gw1_A mol:protein length:514 Mitochondrial precursor proteins import recep  ali model follow..  11  286STEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE--APEVPNFFAEILTDKNDFDKA. 391
52 -35.6002l6j_A mol:protein length:111 TPR repeat-containing protein associated with  ali model follow..  20YREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSK-LQYRLELAQGAVGSVQIPVVEVDELPEG.................... 107
53 -35.3002e2e_A mol:protein length:177 Formate-dependent nitrite reductase complex n  ali model follow..  17  26PEAQLQALQDKIRANPQNSEQWALLGEYYLWQNDYSNSLLAYRQALQLRGENAELYAALATVLYYQASTAQTRAMIDKALALDSN--EITALMLLASDAFMQANYAQA. 134
54 -35.2002kc7_A mol:protein length:99 bfr218_protein  ali model follow..  18  1...................MDQLKTIKELINQGDIENALQALEEFLQTEPGKDEAYYLMGNAYRKLGDWQKALNNYQSAIELNPDSPALQARKMVMDILNFYNKYNQLE 93
56 -33.6001tjc_A mol:protein length:108 Prolyl 4-hydroxylase alpha-1 subunit  ali model follow..  18  4.................TAEDSFELGKVAYTEADYYHTELWMEQALRQLDDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPE--HQRANGNLKYFEYIMAKEKDVN 100
65 -31.2002dba_A mol:protein length:148 Smooth muscle cell associated protein-1, isof  ali model follow..  15  45.GGALAAYTQALGLDADQAVLHRNRAACHLKLEDYDKAETEASKAIEKDGGDVKALYRRSQALEKLGRLDQAVLDLQRCVSLEPKN------KVFQEALRNISGPSSG. 148
71 -29.6001iyg_A mol:protein length:133 Hypothetical protein (2010003O14)  ali model follow..  21LKNFERKFQSEQAAGSVSKSTQFEYAWCLVRSEDIRRGIVLLEELLPKGEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQ--NNQAKELERLIDKAMKK..... 127
74 -28.3003ulq_A mol:protein length:383 Response regulator aspartate phosphatase F  ali model follow..  120.LSAIKFFKKAESKRIEKAEFFFKMSESYYYMKQTYFSMDYARQAYEINIRLLQCHSLFATNFLDLKQYEDAISHFQKAYSMAEAEKQGRTLYNIGLCKNSQSQYEDA. 243
75 -27.8003q15_A mol:protein length:378 Response regulator aspartate phosphatase H  ali model follow..  16  164ILQALDIYQNHPLYSIRTIQSLFVIAGNYDDFKHYDKALPHLEAALELDRFIAISLLNIANSYDRSGDDQMAVEHFQKAAKVSREKVPPKVLFGLSWTLCKAGQTQKA. 280

FFAS is supported by the NIH grant R01-GM087218-01
6 1 9 0 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab

Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Bourne PE, Allerston CK, Krebs W, Li W, Shindyalov IN, Godzik A.,Friedberg I, Liu T, Wild D, Hwang S, Ghahramani Z, Chen L, Westbrook J. The status of structural genomics defined through the analysis of current targets and structures. Pac Symp Biocomput. 2004;:375-86.