current user: public

anford Burnham Prebys Medical Discovery Institute

Query: 2kat_A mol:protein length:115 uncharacterized protein, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
2 -54.4003ma5_A mol:protein length:100 Tetratricopeptide repeat domain protein  ali model follow..  20  3..............DPEDPFTRYALAQEHLKHDNASRALALFEELVETDPDYVGTYYHLGKLYERLDRTDDAIDTYAQGIEVAREEGTQKDLSELQDAKLKAEGLE... 94
15 -42.3001na3_A mol:protein length:91 designed protein CTPR2  ali model follow..  22  6...............GNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNN--AEAKQNLGNAKQKQG...... 91
21 -40.1003r9a_B mol:protein length:328 Peroxisomal targeting signal 1 receptor  ali model follow..  23  193YDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPNIWSTLRLALSMLGQSDAY. 309
23 -39.2003cv0_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  22  154YRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGY--VRVMYNMAVSYSNMSQYDLA. 259
27 -38.8002avp_A mol:protein length:70 synthetic consensus TPR protein  ali model follow..  26  1................GSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPR........................ 69
29 -38.8001zu2_A mol:protein length:158 Mitochondrial import receptor subunit TOM20-3  ali model follow..  14  18FEQIRQDAENTYKSNPLDADNLTRWGGVLLELSQIQEAITKFEEALLIDPKKDEAVWCIGNAYTSFAFFDLATQFFQQAVDEQPD--NTHYLKSLEMTAKAPQLHAEA. 144
44 -37.5004gco_A mol:protein length:126 Protein STI-1  ali model follow..  13  29YPTAMRHYNEAVKRDPENAILYSNRAACLTKLMEFQRALDDCDTCIRLDSKFIKGYIRKAACLVAMREWSKAQRAYEDALQVDPSNEEAR................... 118
47 -37.4003fwv_A mol:protein length:128 Hsc70/Hsp90-organizing protein  ali model follow..  10  20FDTALKHYDKAKELDPTNMTYIVNQAAVYFEKGDYNKCRELCEKAIEVGRENAYAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPKVLKKCQQAEKILKE........ 127
52 -36.2003hym_B mol:protein length:330 Cell division cycle protein 16 homolog  ali model follow..  15  209WKTAEKWFLDALEKVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRD--DTFSVTMLGHCIEMYIGDSEA. 323
53 -36.1004rg6_A mol:protein length:560 Cell division cycle protein 27 homolog  ali model follow..  18  455YKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDES--QESSMTDADDTQLHAAESDE.. 559
54 -36.0002lni_A mol:protein length:133 Stress-induced-phosphoprotein 1  ali model follow..  12  26YPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSS--CKEAADGYQRCMMAQYN..... 127
62 -35.4004hou_A mol:protein length:273 Interferon-induced protein with tetratricopep  ali model follow..  20  151YERAKACFEKVLEVDPENPESSAGYAISAYRLNHKPFSLLPLRQAVRLNPDNGYIKVLLALKLQDEGQEAEGEKYIEEALANMSS--QTYVFRYAAKFYRRKGSVDKA. 264
68 -34.7004kvm_A mol:protein length:734 N-terminal acetyltransferase A complex subuni  ali model follow..  14  26YKKGLKAIEPLLERHPEHGESLAIKGILLHSLGNTKEGYDNVRLGLRNDVGSGVCWHIFGLISRADKDYVQAAKCYINAHKLEKN--NSSLLRDLALLQSQLRQYKAL. 131
71 -34.2002gw1_A mol:protein length:514 Mitochondrial precursor proteins import recep  ali model follow..  11  286STEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE--APEVPNFFAEILTDKNDFDKA. 391
74 -33.9004hnw_A mol:protein length:863 N-terminal acetyltransferase A complex subuni  ali model follow..  11  36YKKSLKLLDAILKKDGSHVDSLALKGLDLYSVGEKDDAASYVANAIRKASASPICCHVLGIYMRNTKEYKESIKWFTAALNNGST--NKQIYRDLATLQSQIGDFKNA. 144
75 -33.7004kbq_A mol:protein length:139 E3 ubiquitin-protein ligase CHIP  ali model follow..  14  27YPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLN.................... 115

FFAS is supported by the NIH grant R01-GM087218-01
9 5 5 2 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Dunbrack RL Jr, Dunker K, Godzik A. Protein structure prediction in biology and medicine. Pac Symp Biocomput. 2000;(12):93-4.