current user: public




Query: 2kat_A mol:protein length:115 uncharacterized protein, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MQAITERLEAMLAQGTDNMLLRFTLGKTYAEHEQFDAALPHLRAALDFDPTYSVAWKWLGKTLQGQGDRAGARQAWESGLAAAQSRGDQQVVKELQVFLRRLAREDALELast
1 -66.5002kat_A mol:protein length:115 uncharacterized protein  ali model  100  1MQAITERLEAMLAQGTDNMLLRFTLGKTYAEHEQFDAALPHLRAALDFDPTYSVAWKWLGKTLQGQGDRAGARQAWESGLAAAQSRGDQQVVKELQVFLRRLAREDALE 109
2 -54.4003ma5_A mol:protein length:100 Tetratricopeptide repeat domain protein  ali model follow..  20  3..............DPEDPFTRYALAQEHLKHDNASRALALFEELVETDPDYVGTYYHLGKLYERLDRTDDAIDTYAQGIEVAREEGTQKDLSELQDAKLKAEGLE... 94
3 -48.2001na0_A mol:protein length:125 designed protein CTPR3  ali model follow..  21  25YDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNN--AEAKQNLGNAKQKQG...... 125
4 -48.2002fo7_A mol:protein length:136 SYNTHETIC CONSENSUS TPR PROTEIN  ali model follow..  20  17YDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS--AEAWYNLGNAYYKQGDYDEA. 122
5 -47.7003kd7_A mol:protein length:125 CTPR390  ali model follow..  20  25YQKAIEYYQKALELDPNNASAWYNLGNAYYKQGDYQKAIEYYQKALELDPNNAKAWYRRGNAYYKQGDYQKAIEDYQKALELDPNN--AKAKQNLGNAKQKQG...... 125
6 -46.7002wqh_A mol:protein length:125 CTPR3Y3  ali model follow..  20  25YDEAIEYYQKALELYPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNN--AEAKQNLGNAKQKQG...... 125
7 -44.2003asd_A mol:protein length:200 MamA  ali model follow..  23  58VDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPN--EGKVHRAIAFSYEQMGRHEEA. 163
8 -44.0004xi0_A mol:protein length:202 Magnetosome protein MamA  ali model follow..  16  57YQRAVTVFDKVLKLRPNHFMASYRKGAVLLKIKQYKLALPVLEAVVAAAPADARAYYLLGLAYDGDEQLEKGIEAMQKAVDLDPE--EIKYHQHLGFMNVRKDDHKTA. 162
9 -43.9003wxx_A mol:protein length:151 AcrH  ali model follow..  13  42HDEAHKIFQALCVLDHYEARFFLGLGACRQALGQFRLAIDSYSYGAMMDLQEPRFPFHAAECLLQLGELEGAESGFHSAQLLAAAKPEAELAARAGIMLEVVKTKKDME 151
10 -43.6002vgy_A mol:protein length:148 CHAPERONE SYCD  ali model follow..  11  37YEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYEEGAVMDIKEPRFPFHAAECLLQKGELAEAESGLFLAQELIANKPEKELSTRVSSMLEAIKLKKEMK 146
11 -43.3003as8_A mol:protein length:186 Magnetosome protein MamA  ali model follow..  21  58VDRGTELLERSIADAPDNIKVATVLGLTYVQVQKYDLAVPLLVKVAEANPVNFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPN--EGKVHRAIAYSYEQMGSHEEA. 163
12 -43.3003vtx_A mol:protein length:184 MamA  ali model follow..  16  55PNDAIESLKKFVVLDTTSAEAYYILGSANFMIDEKQAAIDALQRAIALNTVYADAYYKLGLVYDSMGEHDKAIEAYEKTISIKPGF--IRAYQSIGLAYEGKGLRDEA. 160
13 -43.2002vgx_A mol:protein length:148 CHAPERONE SYCD  ali model follow..  11  37YEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYSYGAVMDIKEPRFPFHAAECLLQKGELAEAESGLFLAQELIANKPEKELSTRVSSMLEAIKLKKEMK 146
14 -42.9003asg_A mol:protein length:186 MamA  ali model follow..  23  58VDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALKNLGRFDEAIDSFKIALGLRPN--EGKVHRAIAFSYEQMGRHEEA. 163
15 -42.3001na3_A mol:protein length:91 designed protein CTPR2  ali model follow..  22  6...............GNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNN--AEAKQNLGNAKQKQG...... 91
16 -42.2002q7f_A mol:protein length:243 YrrB protein  ali model follow..  16  33YEKAAEAFTKAIEENKEDAIPYINFANLLSSVNELERALAFYDKALELDSSAATAYYGAGNVYVVKEMYKEAKDMFEKALRAGMENGD--LFYMLGTVLVKLEQPKLA. 138
17 -41.4002kck_A mol:protein length:112 TPR repeat  ali model follow..  15  1.............MVDQNPEEYYLEGVLQYDAGNYTESIDLFEKAIQLDPEESKYWLMKGKALYNLERYEEAVDCYNYVINVIEDEYNKDVWAAKADALRYIGKEVEA. 96
18 -41.2001hxi_A mol:protein length:121 PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5  ali model follow..  18  33LAEAALAFEAVCQKEPEREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLLSQPQYEQ..................... 120
19 -40.9001w3b_A mol:protein length:388 UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUC  ali model follow..  25  49LDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDL--YCVRSDLGNLLKALGRLEEA. 154
20 -40.4002xcb_A mol:protein length:142 REGULATORY PROTEIN PCRH  ali model follow..  13  34WDDAQKIFQALCMLDHYDARYFLGLGACRQSLGLYEQALQSYSYGALMDINEPRFPFHAAECHLQLGDLDGAESGFYSARALAAAQPAEALAARAGAMLEAVTARKD.. 141
21 -40.1003r9a_B mol:protein length:328 Peroxisomal targeting signal 1 receptor  ali model follow..  23  193YDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPNIWSTLRLALSMLGQSDAY. 309
22 -39.8004j8d_A mol:protein length:175 Hsc70-interacting protein  ali model follow..  13  57LQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAARDLALACKLDYDEDASAMLREVQPRAQKIAEHRRK. 164
23 -39.2003cv0_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  22  154YRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGY--VRVMYNMAVSYSNMSQYDLA. 259
24 -39.1003cvq_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  16  188YDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGGTTPSMWDFFRMLLNVMNRPDLV. 305
25 -39.0005dse_A mol:protein length:837 Tetratricopeptide repeat protein 7B  ali model follow..  15  706PAEATACTQEAANLFPMSHNVLYMRGQIAELRGSMDEARRWYEEALAISPTHVKSMQRLALILHQLGRYSLAEKILRDAVQVNST--AHEVWNGLGEVLQAQGNDAAA. 811
26 -39.0002pl2_A mol:protein length:217 Hypothetical conserved protein TTC0263  ali model follow..  12  21YDAALTLFERALKENPQDPEALYWLARTQLKLGLVNPALENGKTLVARTPRYLGGYMVLSEAYVALGYLEQALSVLKDAERVNPRY--APLHLQRGLVYALLGERDKA. 137
27 -38.8002avp_A mol:protein length:70 synthetic consensus TPR protein  ali model follow..  26  1................GSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPR........................ 69
28 -38.8001fch_A mol:protein length:368 PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR  ali model follow..  23  233YDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPNIWSTLRLALSMLGQSDAY. 349
29 -38.8001zu2_A mol:protein length:158 Mitochondrial import receptor subunit TOM20-3  ali model follow..  14  18FEQIRQDAENTYKSNPLDADNLTRWGGVLLELSQIQEAITKFEEALLIDPKKDEAVWCIGNAYTSFAFFDLATQFFQQAVDEQPD--NTHYLKSLEMTAKAPQLHAEA. 144
30 -38.8004gcn_A mol:protein length:127 Protein STI-1  ali model follow..  17  24FEKAHVHYDKAIELDPSNITFYNNKAAVYFEEKKFAECVQFCEKAVEVGREIAKAMSRAGNAFQKQNDLSLAVQWFHRSLSEFRDPELVKKVKELE............. 126
31 -38.6003urz_A mol:protein length:208 Uncharacterized protein  ali model follow..  12  20NGQAVSYFRQTIALNIDRTEMYYELALAYKKNRNYDKAYLFYKELLQKAPNNVDCLEACAEMQVCRGQEKDALRMYEKILQLEAD--NLAANIFLGNYYYLTAEQEKKK 142
32 -38.5004ga2_A mol:protein length:150 E3 SUMO-PROTEIN LIGASE RANBP2  ali model follow..  12  13VERYIASVQGSTPSPRQKSIKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTDKAVECYRRSVELNPT--QKDLVLKIAELLCKNDVTDGR. 118
33 -38.5002vyi_A mol:protein length:131 SGTA PROTEIN  ali model follow..  15  28FEAAVHFYGKAIELNPANAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPAYSKAYGRMGLALSSLNKHVEAVAYYKKALELDPD--NETYKSNLKIAELKLRE..... 129
34 -38.4004ga0_A mol:protein length:150 E3 SUMO-protein ligase RanBP2  ali model follow..  12  13VERYIASVQGSTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTDKAVECYRRSVELNPT--QKDLVLKIAELLCKNDVTDGR. 118
35 -38.4002ho1_A mol:protein length:252 Type 4 fimbrial biogenesis protein PilF  ali model follow..  13  47TEQAKVPLRKALEIDPSSADAHAALAVVFQTEMEPKLADEEYRKALASDSRNARVLNNYGGFLYEQKRYEEAYQRLLEASQDTLYPERSRVFENLGLVSLQMKKPAQAK 155
36 -38.4003upv_A mol:protein length:126 Heat shock protein STI1  ali model follow..  10  20WPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQLYYKASQQR... 125
37 -38.4003uq3_A mol:protein length:258 Heat shock protein STI1  ali model follow..  155WPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNN--GSSAREIDQLYYKASQ... 258
38 -38.2003sz7_A mol:protein length:164 Hsc70 cochaperone (SGT)  ali model follow..  22  27YSKAIDLYTQALSIAPANPIYLSNRAAAYSASGQHEKAAEDAELATVVDPKYSKAWSRLGLARFDMADYKGAKEAYEKGIEAEGNGGSDAMKRGLETTKRKIEEANRGA 135
39 -38.0004ga1_A mol:protein length:150 E3 SUMO-PROTEIN LIGASE RANBP2  ali model follow..  12  13VERYIASVQGSTPSPRQKSMKGFYFAKLYMEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTDKAVECYRRSVELNPM--QKDLVLKIAELLCKNDVTDGR. 118
40 -38.0004nrh_B mol:protein length:178 Chaperone SycD  ali model follow..  11  42KNIALDTYQKIFKISSEDLEKVYKEGYHAYLDKDYAKSITVFRWLVFFNPFVSKFWFSLGASLHMSEQYSQALHAYGVTAVLRDK--DPYPHYYAYICYTLTNEHEEA. 147
41 -37.8004eqf_A mol:protein length:365 PEX5-related protein  ali model follow..  17  229FNRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREAVSNFLTALSLQRKSRNQNIWAALRIALSLMDQPELFQ 347
42 -37.6001xnf_A mol:protein length:275 Lipoprotein nlpI  ali model follow..  20  22.EVILARMEQILATDDERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYLGIYLTQAGNFDAAYEAFDSVLELDPTY--NYAHLNRGIALYYGGRDKLA. 130
43 -37.5001elw_A mol:protein length:118 TPR1-DOMAIN OF HOP  ali model follow..  16  20IDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEAN--NPQLKEGLQNMEAR........ 118
44 -37.5004gco_A mol:protein length:126 Protein STI-1  ali model follow..  13  29YPTAMRHYNEAVKRDPENAILYSNRAACLTKLMEFQRALDDCDTCIRLDSKFIKGYIRKAACLVAMREWSKAQRAYEDALQVDPSNEEAR................... 118
45 -37.5004cgv_A mol:protein length:136 RNA POLYMERASE II-ASSOCIATED PROTEIN 3  ali model follow..  15  30YDEAIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVLELEPN--NFEATNELRKISQALASKENS. 135
46 -37.5004r7s_A mol:protein length:257 Tetratricopeptide repeat protein  ali model follow..  15  57LQEALISYTSALSGHTKNITILENRASLYTELGETEKALNDYNTLLIENPEHQEALYCRGLLYIQLQNYMWAEQDFDKILEVNEK--SVRARLGHAILEKMRGNYDES. 162
47 -37.4003fwv_A mol:protein length:128 Hsc70/Hsp90-organizing protein  ali model follow..  10  20FDTALKHYDKAKELDPTNMTYIVNQAAVYFEKGDYNKCRELCEKAIEVGRENAYAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPKVLKKCQQAEKILKE........ 127
48 -37.3002vq2_A mol:protein length:225 PUTATIVE FIMBRIAL BIOGENESIS AND TWITCHING MO  ali model follow..  16  24YRQATASIEDALKSDPKNELAWLVRAEIYQYLKVNDKAQESFRQALSIKPDSAEINNNYGWFLGRLNRPAESMAYFDKALADPTYPTPYIANLNKGICSAKQGQFGLAE 133
49 -37.0002hr2_A mol:protein length:159 Hypothetical protein  ali model follow..  14  27YDEAAANCRRAMEISHTDAFCHAGLAEALAGLRSFDEALHSADKALELNQDEGKLWYSRALALDGLGRGAEAMPEFKKVVEMIEER--KGETPGKERMMEVAIDRIAQ. 155
50 -36.9002fi7_A mol:protein length:265 type 4 fimbrial biogenesis protein PilF  ali model follow..  13  60TEQAKVPLRKALEIDPSSADAHAALAVVFQTEMEPKLADEEYRKALASDSRNARVLNNYGGFLYEQKRYEEAYQRLLEASQDTLYPERSRVFENLGLVSLQMKKPAQAK 168
51 -36.3001elr_A mol:protein length:131 TPR2A-DOMAIN OF HOP  ali model follow..  11  20FDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERL.... 131
52 -36.2003hym_B mol:protein length:330 Cell division cycle protein 16 homolog  ali model follow..  15  209WKTAEKWFLDALEKVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRD--DTFSVTMLGHCIEMYIGDSEA. 323
53 -36.1004rg6_A mol:protein length:560 Cell division cycle protein 27 homolog  ali model follow..  18  455YKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDES--QESSMTDADDTQLHAAESDE.. 559
54 -36.0002lni_A mol:protein length:133 Stress-induced-phosphoprotein 1  ali model follow..  12  26YPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSS--CKEAADGYQRCMMAQYN..... 127
55 -36.0004cgw_A mol:protein length:117 RNA POLYMERASE II-ASSOCIATED PROTEIN 3  ali model follow..  21  34YERAIECYTRGIAADGANALLPANRAMAYLKIQKYEEAEKDCTQAILLDGSYSKAFARRGTARTFLGKLNEAKQDFETVLLLEP......................... 117
56 -35.9003fp2_A mol:protein length:537 TPR repeat-containing protein YHR117W  ali model follow..  12  292SQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPT--LPEVPTFFAEILTDRGDFDTA. 397
57 -35.8001wm5_A mol:protein length:208 Neutrophil cytosol factor 2  ali model follow..  11  27WKGALDAFSAVQ---DPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQACEVLYNIAFMYAKKEEWKKA. 145
58 -35.7004i17_A mol:protein length:228 hypothetical protein  ali model follow..  23YAVAFEKYSEYLKLTNNDSVTAYNCGVCADNIKKYKEAADYFDIAIKKNYNLANAYIGKSAAYRDMKNNQEYIATLTEGIKAVPGNATAIYYLKEGQKFQQAGNIEKA. 136
59 -35.7002bug_A mol:protein length:140 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model follow..  12  31YENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALNDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPH--DKDAKMKYQECNKIVKQK.... 133
60 -35.6003u4t_A mol:protein length:272 TPR repeat-containing protein  ali model follow..  91.SLAIQQYQAAVDRDTTRLDMYGQIGSYFYNKGNFPLAIQYMEKQIRPTTTDPKVFYELGQAYYYNKEYVKADSSFVKVLELKPN--IYIGYLWRARANAAQDPDTKQG 196
61 -35.6003ks2_A mol:protein length:151 Chaperone protein ipgC  ali model follow..  13  48IEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSN---DEKLKIKAQSYLDAIQDIKE.. 151
62 -35.4004hou_A mol:protein length:273 Interferon-induced protein with tetratricopep  ali model follow..  20  151YERAKACFEKVLEVDPENPESSAGYAISAYRLNHKPFSLLPLRQAVRLNPDNGYIKVLLALKLQDEGQEAEGEKYIEEALANMSS--QTYVFRYAAKFYRRKGSVDKA. 264
63 -35.3001a17_A mol:protein length:166 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model follow..  12  29YENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPH--DKDAKMKYQECNKIVKQKAFER 135
64 -35.3004uzy_A mol:protein length:651 FLAGELLAR ASSOCIATED PROTEIN  ali model follow..  15  2...AASMAFFQQPARPIAEGQYTQTIYTLIKEQKFAEAIQHLQYQLQNVPESRAALSLLGYCYYYTGQYDMASQMYEQLVTLYPS--NEDYKLYYAQSLYKGGMYPEA. 104
65 -35.0004ui9_J mol:protein length:620 CELL DIVISION CYCLE PROTEIN 16 HOMOLOG  ali model follow..  12  461YAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIISPPWDFREFE 569
66 -34.9003gyz_A mol:protein length:151 Chaperone protein ipgC  ali model follow..  11  52IEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSNDEKLKIKAQSYLDAIQ......... 151
67 -34.9005a31_C mol:protein length:597 CELL DIVISION CYCLE PROTEIN 23 HOMOLOG  ali model follow..  15  348.EKAALYFQRALKLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRPN--DSRMLVALGECYEKLNQLVEA. 452
68 -34.7004kvm_A mol:protein length:734 N-terminal acetyltransferase A complex subuni  ali model follow..  14  26YKKGLKAIEPLLERHPEHGESLAIKGILLHSLGNTKEGYDNVRLGLRNDVGSGVCWHIFGLISRADKDYVQAAKCYINAHKLEKN--NSSLLRDLALLQSQLRQYKAL. 131
69 -34.6004XNH Entity 1(prereleased)  ali follow..  11  36YKKSLKLLDAILKKDGSHVDSLALKGLDLYSVGEKDDAASYVANAIRKASASPICCHVLGIYMRNTKEYKESIKWFTAALNNGST--NKQIYRDLATLQSQIGDFKNA. 144
70 -34.3001hh8_A mol:protein length:213 NEUTROPHIL CYTOSOL FACTOR 2  ali model follow..  11  22WKGALDAFSAVQ---DPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQACEVLYNIAFMYAKKEEWKKA. 140
71 -34.2002gw1_A mol:protein length:514 Mitochondrial precursor proteins import recep  ali model follow..  11  286STEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPE--APEVPNFFAEILTDKNDFDKA. 391
72 -34.1004ui9_F mol:protein length:824 CELL DIVISION CYCLE PROTEIN 27 HOMOLOG  ali model follow..  17  584.DIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQ--SSVLLCHIGVVQHALKKSEKA. 688
73 -34.0003ieg_A mol:protein length:359 DnaJ homolog subfamily C member 3  ali model follow..  17  19LADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIALKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSEQEEKEAESQLVKADEMQR..... 122
74 -33.9004hnw_A mol:protein length:863 N-terminal acetyltransferase A complex subuni  ali model follow..  11  36YKKSLKLLDAILKKDGSHVDSLALKGLDLYSVGEKDDAASYVANAIRKASASPICCHVLGIYMRNTKEYKESIKWFTAALNNGST--NKQIYRDLATLQSQIGDFKNA. 144
75 -33.7004kbq_A mol:protein length:139 E3 ubiquitin-protein ligase CHIP  ali model follow..  14  27YPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLN.................... 115

FFAS is supported by the NIH grant R01-GM087218-01
8 2 9 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Jaroszewski L, Ye Y, Godzik A. The interplay of fold recognition and experimental structure determination in structural genomics. Curr Opin Struct Biol. 2004 Jun;14(3):307-12.