current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

2jf2A
Query: 2jf2_A mol:protein length:264 ACYL-[ACYL-CARRIER-PROTEIN]--UDP-N-ACETYLGLUC, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst GSMIDKSAFVHPTAIVEEGASIGANAHIGPFCIVGPHVEIGEGTVLKSHVVVNGHTKIGRDNEIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHRGTVQGGGLTKVGSDNLLMINAHIAHDCTVGNRCILANNATLAGHVSVDDFAIIGGMTAVHQFCIIGAHVMVGGCSGVAQDVPPYVIAQGNHATPFGVNIEGLKRRGFSREAITAIRNAYKLIYRSGKTLDEVKPEIAELAETYPEVKAFTDFFARSTRGLIRLast
1 -112.0002jf2_A mol:protein length:264 ACYL-[ACYL-CARRIER-PROTEIN]--UDP-N-ACETYLGLUC  ali model  100  1GSMIDKSAFVHPTAIVEEGASIGANAHIGPFCIVGPHVEIGEGTVLKSHVVVNGHTKIGRDNEIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHRGTVQGGGLTKVGSDNLLMINAHIAHDCTVGNRCILANNATLAGHVSVDDFAIIGGMTAVHQFCIIGAHVMVGGCSGVAQDVPPYVIAQGNHATPFGVNIEGLKRRGFSREAITAIRNAYKLIYRSGKTLDEVKPEIAELAETYPEVKAFTDFFARSTRGLIR 264
2 -108.0001j2z_A mol:protein length:270 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  39  2.......SKIAKTAIISPKAEINKGVEIGEFCVIGDGVKLDEGVKLHNNVTLQGHTFVGKNTEIFPFAVLGTQPQDLKYKGEYSELIIGEDNLIREFCMINPGTEGGIKKTLIGDKNLLMAYVHVAHDCVIGSHCILANGVTLAGHIEIGDYVNIGGLTAIHQFVRIAKGCMIAGKSALGKDVPPYCTVEGNRAFIRGLNRHRMRQ-LLESKDIDFIYALYKRLFRPIPSLRESAKLELEEHANNPFVKEICSFILESSRGVAY 257
3 -107.0003hsq_A mol:protein length:259 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  41  2........KIHPTAIIDPKAELHESVEVGPYSIIEGNVSIQEGTIIEGHVKICAGSEIGKFNRFHQGAVIGVMPQDLGFNQQLTKTVIGDHNIFREYSNIHKGTKED-SPTVIGNKNYFMGNSHVGHDCILGNNNILTHGAVLAGHVTLGNFAFISGLVAVHQFCFVGDYSMVAGLAKVVQDVPPYSTVDGNPSTVVGLNSVGMKRAGFSPEVRNAIKHAYKVIYHSGISTRKALDELEASGNLIEQVKYIIKFFRDSDRGVTN 257
4 -105.0003r0s_A mol:protein length:266 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  35  2....NAMKKIHPSAVIEEGAQLGDDVVIEAYAYVSKDAKIGNNVVIKQGARILSDTTIGDHSRVFSYAIVGDIPQDISYKEEQSGVVIGKNATIREFATINSGTAKGDGFTRIGDNAFIMAYCHIAHDCLLGNNIILANNATLAGHVELGDFTVVGGLTPIHQFVKVGEGCMIAGASALSQDIVPFCLAEGNRASIRSLNLVGIRRR-FDKDEVDRLSRAFKTLFRQGDLKENAKNLLEN--QESENVKKMCHFILETKRGIPV 259
5 -40.1003fs8_A mol:protein length:273 QdtC  ali model follow..  16  2......PNNISKSAIIKEGVIIGENVTIEDNVYIDYGCIIRDNVHIKKGSFIGARSILGEYLVDFYNDRINKKHPLIIGENA-DNFQTGHKVTIRENTKIGNNVKIGTLSVYIGNYVNIHSNVFVGEKSIIKDFVWLFPHVVLTNDVTIELFAVIAARSVVLPGIHINEDALVGAGAVVTKDVPKETVVVGNPAREIC------SIRKIKNKITGEQVYPWRYTFKRGMPWEETDYDTWIKNISIENLE............... 267
6 -34.8002iu8_A mol:protein length:374 UDP-3-O-[3-HYDROXYMYRISTOYL] GLUCOSAMINE N-AC  ali model follow..  23  130TAIIEDHVCIEPYAVVCQHAHVGSACHIGSGSVIGAYSTVGEHSYIHPRVVIRERVSIGKRVIIQPGAVIGSCGFGYVTSAFGQKVIIEDDVEIGANTTIDRGRFKH---SVVREGSKIDNLVQIAHQVEVGQHSMIVAQAGIAGSTKIGNHVIIGGQAGITGHICIADHVIMMAQTGVTKSITSPGIYGGAPARPYQ-QVAKVRNLPRLEERIAALEKLVQKLEAL..................................... 364
7 -34.3003pmo_A mol:protein length:372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac  ali model follow..  23  125DAEVDPSASVGAYAVIESGARIGAGVSIGAHCVIGARSVIGEGGWLAPRVTLYHDVTIGARVSIQSGAVIGGEGFGFANEKQIGGVTIGDDVEIGANTTIDRGALSD---TLIGNGVKLDNQIMIAHNVQIGDHTAMAACVGISGSAKIGRHCMLAGGVGLVGHIEICDNVFVTGMTMVTRSITPGSYSSGTAMQPAA-SAARIRQLDDMARRLQQLEKRLAAVTSSGDASSDA.............................. 366
8 -33.8003eh0_A mol:protein length:341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac  ali model follow..  22  109TAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIGQNCLIQSGTVVGADGFGYANDRQIGRVIIGDRVEIGACTTIDRGALDD---TIIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMRPITPGVYSSGIPLQPNK-TAALVMNIDDMSKRLKSLERKVNQQ........................................ 340
9 -30.5003mqg_A mol:protein length:192 Lipopolysaccharides biosynthesis acetyltransf  ali model follow..  28  1....GHMATIHPTAIVDEGARIGAHSRIWHWVHICGGAEIGEGCSLGQNVFVGNRVRIGNR-------------------------------------------------VKIQNNVSVYDNVFLEDDVFCGPSMVFTNRKSEYRDTIVRQGATLGANCTVVCGATIGRYAFVGAGAVVNKDVPDFALVVGVPARQIG.................................................................. 154
10 -26.5003vbi_A mol:protein length:205 Galactoside O-acetyltransferase  ali model follow..  19  27...................LSVGKNVLISKKASIPGVISIGNNVRIDDFCILSGKVTIGSYSHIAAYTAL---------YGGEVGIEMYDFANISSRTIVYAAIDD------------------FSGNALMGPTIPNQYKNVKTGKVILKKHVIIGAHSIIFPNVVIGEGVAVGAMSMVKESLDDWYIYVGVPVRK.................................................................... 178
11 -25.8003bss_A mol:protein length:198 Acetyltransferase  ali model follow..  19  89................................................................................SPSAIVEENAGILIMPYVVINAK-------AKIEKGVILNTSSVIEHECVIGEFSHVSVGAKCAGNVKIGKNCFLGINSCVLPNLSLADDSILGGGATLVKNQDEKGVFVGVPAKR.................................................................... 197
12 -25.7003TV0 Entity 1(prereleased)  ali follow..  17  10................QKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIAGPIVIGEGNLIEEQALIINAYPD-TEDPEPKPMIIGTNNVFEVGCYSQAMK--------MGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNY.............................................................................. 178
13 -25.3002npo_A mol:protein length:207 Acetyltransferase  ali model follow..  19  88................................................................................SPSAIVEENAGILIMPYVVINAK-------AKIEKGVILNTSSVIEHECVIGEFSHVSVGAKCAGNVKIGKNCFLGINSCVLPNLSLADDSILGGGATLVKNQDEKGVFVGVPAKR.................................................................... 196
14 -23.4003cj8_A mol:protein length:236 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  22  106.......................................................................................IGDQAVIMMGAILNIGA-------VVGAGTMIDMGAVLGGRATVGKHCHIGAGTVLAGPVVIENEVVIGANAVVLEGVRVGEGAVVAAGAVVVEDVPAHTVVAGVPAKV-------IKQIDDKTKSKTEILEELRKL........................................ 236
15 -22.3003r8y_A mol:protein length:240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  25  88...KGIKARIEPGAIIRDHVEIGDNAVIMMNATINIGAVIGEGSMIDMNAVLGGRATVGKNCHVGAGAVLAGVIEPPS-----------------------------------------------------------------AKPVIVEDDVVIGANVVVLEGVTVGKGAVVAAGAVVTEDVPPYTVVAGTPARV-------IKEIDEKTKAKTEIKQELRQLNPEK.................................... 240
16 -20.7003vnp_A mol:protein length:183 Hypothetical conserved protein  ali model follow..  18  4..............................YPYKGKTPQIAASAFIADYVTITGDVVIGEETSIWFNTVI---------RGDVAPTVIGNRVNIQDNSILH---------------------QSPNNPLIIEDGVTVGHQVILHS-AIVRKNALIGMGSIILDRAEIGEGAFIGAGSLVPKKIPPNTLALGRPAKVV---------RELTEDDIREMERIRREYVEKGQYYKALQQQRTSCADKKE.................. 181
17 -20.4001v3w_A mol:protein length:173 ferripyochelin binding protein  ali model follow..  19  4..............................YEINGKKPRIHPSAFVDENAVVIGDVVLEEKTSVWPSAVL---------RGDIEQIYVGKYSNVQDNVSIH---------------------TSHGYPTEIGEYVTIGHNAMVHG-AKVGNYVIIGISSVILDGAKIGDHVIIGAGAVVPKEIPDYSLVLGVPGKVV---------RQLTEEEIEWTKKNAEIYVELAEKHIKGRKRI.......................... 173
18 -20.1003ixc_A mol:protein length:191 Hexapeptide transferase family protein  ali model follow..  16  25..................................GVSPSVDSTAFIAGNARIIGDVCIGKNASIWYGTVL---------RGDVDKIEVGEGTNIQDNTVVH--TDSMHGDTVIGKF-VTIGHSCILHACTLGNNAFVGMGSIVMDRAVMEEGSMLAAGSLLTRGKIVKSGELWAGRPA...................................................................................... 156
19 -20.0003r3r_A mol:protein length:187 ferripyochelin binding protein  ali model follow..  18  17......................................GIGQRVMIDTSSVVIGDVRLADDVGIWPLVVI---------RGDVNYVAIGARTNIQDGSVLHVTHKSSSNPH--------------GNPLIIGEDVTVGHKVMLHG-CTIGNRVLVGMGSIVLDGAIIEDDVMIGAGSLVPKRLESGYLYLGSPVKQI---------RPLSDAERSGLQYSANNYVKWKDDYLSQDNHIQ......................... 186
20 -19.6001xhd_A mol:protein length:173 putative acetyltransferase/acyltransferase  ali model follow..  18  10..................................EKKPKIASSAFIADYVTITGDVYVGEESSIWFNTVI---------RGDVSPTIIGDRVNVQDQCTLH---------------------QSPQYPLILEDDVTVGHQVILHS-CHIKKDALIGMGSIILDGAEIGEGAFIGAGSLVSKKIPPNTLAFGRPAKVI---------RELTAEDRKDMERIRTQYVEKGQYYKSLQK............................ 173
21 -19.3003r1w_A mol:protein length:189 carbonic anhydrase  ali model follow..  16  17..................................GISPKLGERVFVDRSSVIIGDVELGDDCSVWPLAVI---------RGDMHHIRIGARTSVQDGSVLHITHASDYNPG--------------GYPLIIGDDVTIGHQAMLHG-CTIGNRVLIGMKSMIMDGAIVEDEVIVAAGATVSKVLESGFVYMGTPAKKV---------RPITEKERSFFTYGAGNYVRLKDKHLAEGYD........................... 188
22 -19.0003eev_A mol:protein length:212 Chloramphenicol acetyltransferase  ali model follow..  16  11.........................................FSGIPLDQQVTNPNIIVGKHSYYSGYYHGHSFDDCVRYRDDVDKLVIGSFCSIGSGAVFMMAGNQGHRSDWISTFPFFYQDNDNFAD--------ARDGFTRSGDTIIGHDVWIGTEAMIMPGVKIGHGAIIASRSVVTKDVAPYEVVGSNPAKHI--------KFRFSDVEIAMLLEM............................................ 177
23 -19.0003kwc_A mol:protein length:229 Carbon dioxide concentrating mechanism protei  ali model follow..  19  35......................................EIAPTAYVHSFSNLIGDVRIKDYVHIAPGTSIRAD--------EGTPFHIGSRTNIQDGVVIH-----------GLQQGRVIGDDGQEYSVWIGDNVSITHMALIHGPAYIGDGCFIGFRSTVFN-ARVGAGCVVMMHVLIQDEIPPGKYVPSGMVITTQQQADRLPNVEESDIHFAQHVVGINEALLSGYQCAENIACIAPIRNELQ.................. 223
24 -19.0003jqy_B mol:protein length:252 Polysialic acid O-acetyltransferase  ali model follow..  20  58.........................................................NGNNNKLIIEDDVECRWLTVIFRGDNNYVRIHKNSKIKGDIVATKGS-----KVIIGRRTTIGAGFEVVTDVTIGHDCMIARDVILDGHIIISSYVWVGRNVSIMKGVSVGSGSVIGYGSIVTKDVPSMCAAAGNPAKI.................................................................... 213
25 -18.9001xat_A mol:protein length:212 XENOBIOTIC ACETYLTRANSFERASE  ali model follow..  19  1.................................MGNYFESPFRGKLLSEQVSNPNIRVGRYSYYSGYYHGHSFDDCARYRDDVDKLVIGSFCSIGSGAAFIMAGNQGHRAEWASTFPFHFMHEEPAFA--------AVNGYQPAGDTLIGHEVWIGTEAMFMPGVRVGHGAIIGSRALVTGDVEPYAIVGGNPARTI--------RKRFSDGDIQNLLEM............................................ 176
26 -18.4001khr_A mol:protein length:209 STREPTOGRAMIN A ACETYLTRANSFERASE  ali model follow..  18  18...............................QFIKPILEKLENVEVGEYSYYDSKNGETFDKQIL-----------YHYPILNDKLKIGKFCSIGPGVTIIMN----------GANHRMDGSTYNLFGNGWEKHMPKLDQLPIKGDTIIGNDVWIGKDVVIMPGVKIGDGAIVAANSVVVKDIAPYMLAGGNPANEI--------KQRFDQDTINQLLDI............................................ 179
27 -18.1003tk8_A mol:protein length:316 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  14  144...................................................................................GGFRVVPPAIARRGSFIAKNVVLMPSYTNIGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGPVIIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVTYGR-IPAGSVVVAGNLPAKDGTHSLYCAVIVKKVDAKTRAKVGLNELLRGD................... 316
28 -17.6001qq0_A mol:protein length:247 CARBONIC ANHYDRASE  ali model follow..  15  23GCISEGAEDNVAQEITVDEFSNIRENPVTPWNPEPSAPVIDPTAYIDPQASVIGEVTIGANVMVSPMASIRSD--------EGMPIFVGDRSNVQDGVVLHALETINEEGEPIEDN--IVEVDGKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFK-SKVGNNCVLEPRSAAIRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVYVNVHLAEGYKE..................................... 245
29 -16.7003gos_A mol:protein length:276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  16  105.....................................................................................FRVVPPATVRKGAFIARNTVLMPSYAFVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGPTIIEDNCFVGARSEVVEGVIVEEGSVISMGVFIGQSTRIYDRETGEPAGSVVVSGNLPSKDGSYSLYCAVIVKKVDAKTRSKVGINELLRTID......................... 276
30 -16.4003eg4_A mol:protein length:304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  16  139.........................................................................................APNAILMPSFVNLGA-------YVDKGAMIDTWATVGSCAQIGKNVHLSGGVGIGGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRATGEVFYPYSVVVAGTMPGKNVPGENWGPSLYCAVIVKRADEKTRSKTSINELLRD.................... 298
31 -16.4003hjj_A mol:protein length:190 Maltose O-acetyltransferase  ali model follow..  15  56....................................................................LLGSSADGKAQINPDFRCDYGYNIHVGKSFFANFNVILDVCEVRIGDHCMFAPGVHIYTATHPLHPVERNSGKEYGKPVKIGNNVWVGGGAIINPGVSIGDNAVIASGAVVTKDVPNNVVVGGNPAKV.................................................................... 184
32 -16.3003bxy_A mol:protein length:285 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  16  84ESRYFDKVPMKFADYDE-ARFQKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIG--------------------------------------------------------AYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGD........................................................................ 226
33 -16.0001kgq_A mol:protein length:274 2,3,4,5-TETRAHYDROPYRIDINE-2-CARBOXYLATE N-SU  ali model follow..  15  79ETRYYDKVPMKFADYDE-ARFQKEGFRVVPPATVRQGAFIARNTVLMPSYVNIG-AYVDEGTMVDTWATVGSCAQ-------------------------------------------------------IGKNVHLSGGVGIGGVTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTRIYDRETGEPAGSVVVSGNLPSKDGSYSLYCAVIVKKVDAKTRGKVGINELLRTID......................... 274
34 -15.7002v0h_A mol:protein length:456 BIFUNCTIONAL PROTEIN GLMU  ali model follow..  20  266.LEHGKDVEIDVNVIIEGNVKLGDRVKIGTGCVL-KNVVIGNDVEIKPYSVLED-SIVGEKAAIGPFSRL------------RPGAELAAETHVGNFVEIKKSTVGKGSLTYVGD-------SEIGSNCNIGAGVITCNYDGANKFTIIGDDVFVGSDTQLVAPVKVANGATIGAGTTITRDVGENELVITR........................................................................ 440
35 -15.7003fww_A mol:protein length:456 Bifunctional protein glmU  ali model follow..  16  266.LTHGRDITIDTNVIIEGHVILGDRVRIGTGCVL-KNCVIGDDSEISPYTVLED-ARLDANCTVGPFARL------------RPGAELAEGAHVGNFVEIKKARLGKGSLSYLGD-------AEIGAGVNIGAGTITCNYDGANKFTIIGDDVFVGSDTQLVAPVTVANGATIGAGTTVTRDVAENELVISR........................................................................ 440
36 -15.6001hv9_A mol:protein length:456 UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE  ali model follow..  17  266.LTHGRDVEIDTNVIIEGNVTLGHRVKIGTGCVI-KNSVIGDDCEISPYTVVED-ANLAAACTIGPFARL------------RPGAELLEGAHVGNFVEMKKARLGKGSLTYLGD-------AEIGDNVNIGAGTITCNYDGANKFTIIGDDVFVGSDTQLVAPVTVGKGATIAAGTTVTRNVGENALAISR........................................................................ 440
37 -15.6001ocx_A mol:protein length:182 MALTOSE O-ACETYLTRANSFERASE  ali model follow..  21  73.....................................................................................IFLGNNFFANFDCVM------DVCPIRIGDNCMLAPGVHIYTATHPIDPVARNSGAELGKPVTIGNNVWIGGRAVINPGVTIGDNVVVASGAVVTKDVPDNVVVGGNPARI.................................................................... 178
38 -15.6003foq_A mol:protein length:503 Bifunctional protein glmU  ali model follow..  20  280.VTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTL-TDVAVGDGASVVRTHG--SSSSIGDGAAVGPFTYL------------RPGTALGADGKLGAFVEVKNSTIGTGTLTYVGD-------ADIGEYSNIGASSVFVNYDGTSKRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQASK................................................ 477
39 -15.5003ect_A mol:protein length:195 Hexapeptide-repeat containing-acetyltransfera  ali model follow..  25  77.....................................................................................IRIGDHTFINMNVVM------DGAPITIGDHVLIGPSTQFYTASHSLDYRRRQAWETICKPIVIEDDVWIGGNVVINQGVTIGARSVVAANSVVNQDVPPDTLVGGTPARI.................................................................... 182
40 -15.3003c8v_A mol:protein length:496 Putative acetyltransferase  ali model follow..  10  232.ISQEAGSCPTGVLMEFVEVRQEDFEEVFASGHMASGAGSASGASVSGYAVIKGDTVIGENVLVSQRAYL-------------DNAWMGKGSNAQENCYIINSRLERN--CVTAHGG-------KIINAHLGDMIFTGFNSFLQGSESSP--------------LKIGDGCVVMPHTIIDLEIPAGHLVWGYIRNKADLAAHSISFEEFAKVDGEV-KRIKRILSENGAFFDGSEGTGHAQKGKNFTFNIIQPYQDGDPRGM.. 478
41 -15.2002f9c_A mol:protein length:334 Hypothetical protein YDCK  ali model follow..  15  71GTEITGNARITQPCTLYNNVRIGDNVWIDR-ADISDGARISDNVTIQSSSVREECAIYGDARVLNQSEILAIQ-LQIYDRATVNHSRIVHQVQLYGNATITHAFIEHRAEVDKDNNVWICDCAKVYGHARVIAGTEEDAIPTLRYSSQVAEHALIEGNCVLKHHVLVGGHAEVRGGPILLDD.................................................................................. 267
42 -15.1002ic7_A mol:protein length:185 Maltose transacetylase  ali model follow..  16  75.....................................................................................IHVGENFFMNFDGVI------DVCEVRIGDHCFIGPGVHIYTATHPLDPHERNSGLEYGKPVVIGHNVWIGGRAVINPGVTIGDNAVIASGAVVTKDVPANAVVGGNPAKV.................................................................... 180
43 -15.1003srt_A mol:protein length:188 Maltose O-acetyltransferase  ali model follow..  20  77.....................................................................................IHVGENFFANYDCIF------DVCKIEIGDNVMLAPNVQIYTAYHPIDAQLRNSGIEYGSPVKIGDNVWIGGGVIITPGITIGDNVVIGAGSVVTKDIPPNTVAVGNPCRV.................................................................... 182
44 -15.0002wlc_A mol:protein length:215 POLYSIALIC ACID O-ACETYLTRANSFERASE  ali model follow..  18  29.......................................................TVIGNNNSVYIGNNCKIVSSNIRLKGNNITLFIADDVEIMGLVC-SDCSLQIQAKTTMGNGEITIGKISIGKDCMLAHGYEIGERINHGKDVIIGNHVWLGRNVTILKGVCIPNNVVVGSHTVLYKSFKPNCVIAGSPAKI.................................................................... 188
45 -14.9002ggo_A mol:protein length:401 401aa long hypothetical glucose-1-phosphate t  ali model follow..  13  227.VFSQNLGNVEDNVKIKGKVIIEEDAEIKSGTYIEGPVYIGKGSEIGPNSYLRPYTILVEKNKIGASVEV-------------KESVIMEGSKIPHLSYVGDSVIAED--VNFGAGTLIANLRFDEKEVKVNVKGKRISSGRRKLGAFIGGHVRTGINVTILPGVKIGAYARIYPGAVVNRDVGYGEFF........................................................................... 399
46 -14.9001kqa_A mol:protein length:203 GALACTOSIDE O-ACETYLTRANSFERASE  ali model follow..  21  58.......................................................................................VGENAWVEPPVYFSYGSNIHIGRNFYANFNLTIVDD----TVTIGDNVLIAPNVTLTGHITIGNNVWIGSHVVINPGVTIGDNSVIGAGSIVTKDIPPNVVAAGVPCRV-----------------IREINDRDKHYYFKDYKVESSV............................. 203
47 -14.8001hm0_A mol:protein length:468 N-ACETYLGLUCOSAMINE 1-PHOSPHATE URIDYLTRANSFE  ali model follow..  18  268DVEIAPEVQIEANVILKGQTKIGAETVLTNGTYV-VDSTIGAGAVITNSMI--EESSVADGVTVGPYAHI------------RPNSSLGAQVHIGNFVEVKGSSIGENTLTYIGN-------CEVGSNVNFGAGTITVNYDGKNKYTVIGDNVFVGSNSTIIAPVELGDNSLVGAGSTITKDVPADAIAIGR........................................................................ 442
48 -14.7001g95_A mol:protein length:459 N-ACETYLGLUCOSAMINE-1-PHOSPHATE URIDYLTRANSFE  ali model follow..  17  265DVEIASEVQIEANVTLKGQTKIGAETVLTNGTYV-VDSTIGAGAVITNSMI--EESSVADGVIVGPYAHI------------RPNSSLGAQVHIGNFVEVKGSSIGENTLTYIGN-------CEVGSNVNFGAGTITVNYDGKNKYTVIGNNVFVGSNSTIIAPVELGDNSLVGAGSTITKDVPADAIAIGR........................................................................ 439
49 -14.6003v4e_A mol:protein length:202 Galactoside O-acetyltransferase  ali model follow..  21  78.....................................................................................VKLGKNVYVNTNCYF------DGGQITIGDNVFIGPNCGFYTATHPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKV-----------------VRKIDNDLPSETLNDETIK................................ 202
50 -13.1001s80_A mol:protein length:278 Serine acetyltransferase  ali model follow..  20  140.................................................................................................VDIHPAA-------KIGHGIMF-TGIVVGETSVIENDVSILQGVTLGGHPKVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVPEYATAAGVPARIVSQDKAAKPAFDMNQYFI.................................................. 259
51 -12.9003fsx_A mol:protein length:332 Tetrahydrodipicolinate N-succinyltransferase  ali model follow..  11  176.......................................................................................LAPGTTVMHEGFVNYNAGTLGAS---------MVEGRISAGVVVGDGSDVGGGASIMG-ISIGKRCLLGANSGL---ISLGDDCVVEAGLYVTAGTRVTMPDSNSVKALSGSSNLLFRRNSVSGAVEVLARDGQGIALNEDLHANGVPRGLE......................... 326
52 -12.8002rij_A mol:protein length:387 Putative 2,3,4,5-tetrahydropyridine-2-carboxy  ali model follow..  15  202.....................................................................VDKFPRFLAHIIPEDNTRILESSKVRMGASLAAGTTIMPGASYVNFNAGTMVEGRISSSAIVGEGSDVGGGASILG-ISVGKACLLGANSVT---IPLGDNCIVDAGIAVLEGTKFLLKDAEELAKLNP.................................................................. 340
53 -12.8001ssq_A mol:protein length:267 Serine acetyltransferase  ali model follow..  22  138.................................................................................................VDIHPAA-------KIGHGIMF-TGIVVGETSVIENDVSILQGVTLGGHPKVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVPEYATAAGVPARIVS.................................................................. 241
54 -12.8003mc4_A mol:protein length:287 WW/Rsp5/WWP domain:Bacterial transferase hexa  ali model follow..  19  159.................................................................................................TDIHPAA-------RLGSGLFL-TGLVVGETAVVEDNVSILHGVTLGGHPKIRQGVLIGAGAKILGNIQVGQCSKIAAGSVVLKSVPHNVTVAGVPARIIGETGCTEPSRVMDQMLGDGI............................................... 281
55 -12.6003gvd_A mol:protein length:276 Serine acetyltransferase  ali model follow..  24  145.................................................................................................VDIHPAA-------TIGCGIML-TGIVIGETAVVENDVSILQSVTLGGHPKIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQSVPAHTTAAGVPARIVG.................................................................. 248
56 -12.6001t3d_A mol:protein length:289 Serine acetyltransferase  ali model follow..  24  152.................................................................................................VDIHPAA-------KIGRGIML-TGIVVGETAVIENDVSILQSVTLGGHPKIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQPVPPHTTAAGVPARIVG.................................................................. 255
57 -12.1003r5a_A mol:protein length:347 Tetrahydrodipicolinate N-succinyletransferase  ali model follow..  14  199.......................................................................................IGEGTTVMHEGFVNFNAGTEGPG---------MIEGRVSAGVFVGKGSDLGGGCSTMG-ISVGEGCLIGANAGI---IPLGDRNIVEAGLYITAGTKVALLDEQNAKVVKARDLAGQPDLLFRRNSQNGAVECKTN--KTAIELNEALHA........................... 345
58 -11.4003f1x_A mol:protein length:310 Serine acetyltransferase  ali model follow..  20  183.............................................................................EMAHSETGIDIHPGAQIGHHFTIDHGT-----------------GVVIGATSIIGNNVKLYQGVTLGAHPILEDDVIVYSNATILGRVTIGKGATVGGNIWVTENVPAGSRIVQRKNKDEL.................................................................. 303
59 -10.6003p47_A mol:protein length:315 Serine acetyltransferase  ali model follow..  19  158.............................................................................ESVHSYTSIDIHPGASIKGHFFIDHGV-----------------GVVIGETAIIGEWCRIYQSVTLGAHPTVGDYVTIGTGAKVLGNIIVGSHVRIGANCWIDRDVDS-VYISEHPTHFVK.................................................................. 279

FFAS is supported by the NIH grant R01-GM087218-01
6 1 2 5 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Slabinski L, Wooley J, Deacon AM, Lesley SA, Wilson IA, Godzik A. Genome pool strategy for structural coverage of protein families. Structure. 2008 Nov 12;16(11):1659-67.