current user: public




Query: 2jf2_A mol:protein length:264 ACYL-[ACYL-CARRIER-PROTEIN]--UDP-N-ACETYLGLUC, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst GSMIDKSAFVHPTAIVEEGASIGANAHIGPFCIVGPHVEIGEGTVLKSHVVVNGHTKIGRDNEIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHRGTVQGGGLTKVGSDNLLMINAHIAHDCTVGNRCILANNATLAGHVSVDDFAIIGGMTAVHQFCIIGAHVMVGGCSGVAQDVPPYVIAQGNHATPFGVNIEGLKRRGFSREAITAIRNAYKLIYRSGKTLDEVKPEIAELAETYPEVKAFTDFFARSTRGLIRLast
1 -119.0002jf2_A mol:protein length:264 ACYL-[ACYL-CARRIER-PROTEIN]--UDP-N-ACETYLGLUC  ali model  100  1GSMIDKSAFVHPTAIVEEGASIGANAHIGPFCIVGPHVEIGEGTVLKSHVVVNGHTKIGRDNEIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHRGTVQGGGLTKVGSDNLLMINAHIAHDCTVGNRCILANNATLAGHVSVDDFAIIGGMTAVHQFCIIGAHVMVGGCSGVAQDVPPYVIAQGNHATPFGVNIEGLKRRGFSREAITAIRNAYKLIYRSGKTLDEVKPEIAELAETYPEVKAFTDFFARSTRGLIR 264
2 -117.0005dem_A mol:protein length:258 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  54  2.......SLIDPRAIIDPSARLAADVQVGPWSIVGAEVEIGEGTVIGPHVVLKGPTKIGKHNRIYQFSSVGEDTPDLKYKGEPTRLVIGDHNVIREGVTIHRGTVQDRAETTIGDHNLIMAYAHIGHDSVIGNHCILVNNTALAGHVHVDDWAILSGYTLVHQYCRIGAHSFSGMGSAIGKDVPAYVTVFGNPAEARSMNFEGMRRRGFSSEAIHALRRAYKVVYRQGHTVEEALAELAESAAQFPEVAVFRDSIQSATRGITR 258
3 -110.0004eqy_A mol:protein length:283 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  51  11.QGPGSMSRIHPTAIIEPGAQLHETVEVGPYAIVGSNVTIGARTTIGSHSVIEGHTTIGEDNRIGHYASVGGRPQDMKYKDEPTRLVIGDRNTIREFTTIHTGTVQDAGVTTLGDDNWIMAYVHIGHDCRVGSHVVLSSNAQMAGHVEIGDWAIVGGMSGVHQYVRIGAHSMLGGASALVQDIPPFVIAAGNKAEPHGINVEGLRRRGFSPDAISALRSAYRILYKNSLSLEEAKVQLSELAQADAAVKALVDFVESSQRGIIR 277
4 -110.0004e6t_A mol:protein length:294 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  51  24GAGTSNHDLIHSTAIIDPSAVIASDVQIGPYCIIGPQVTIGAGTKLHSHVVVGGFTRIGQNNEIFQFASVGEVCQDLKYKGEETWLEIGNNNLIREHCSLHRGTVQDNALTKIGSHNLLMVNTHIAHDCIVGDHNIFANNVGVAGHVHIGDHVIVGGNSGIHQFCKIDSYSMIGGASLILKDVPAYVMASGNPAHAFGINIEGMRRKGWSKNTIQGLREAYKLIFKSGLTSVQAIDQIKEILPSVPEAQLLIDSLEQSERGIVR 288
5 -109.0001j2z_A mol:protein length:270 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  39  2.......SKIAKTAIISPKAEINKGVEIGEFCVIGDGVKLDEGVKLHNNVTLQGHTFVGKNTEIFPFAVLGTQPQDLKYKGEYSELIIGEDNLIREFCMINPGTEGGIKKTLIGDKNLLMAYVHVAHDCVIGSHCILANGVTLAGHIEIGDYVNIGGLTAIHQFVRIAKGCMIAGKSALGKDVPPYCTVEGNRAFIRGLNRHRM-RQLLESKDIDFIYALYKRLFRPIPSLRESAKLELEEHANNPFVKEICSFILESSRGVAY 257
6 -108.0003r0s_A mol:protein length:266 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  35  2....NAMKKIHPSAVIEEGAQLGDDVVIEAYAYVSKDAKIGNNVVIKQGARILSDTTIGDHSRVFSYAIVGDIPQDISYKEEKSGVVIGKNATIREFATINSGTAKGDGFTRIGDNAFIMAYCHIAHDCLLGNNIILANNATLAGHVELGDFTVVGGLTPIHQFVKVGEGCMIAGASALSQDIVPFCLAEGNRASIRSLNLVGIRRR-FDKDEVDRLSRAFKTLFRQGDLKENAKNLLEN--QESENVKKMCHFILETKRGIPV 259
7 -108.0003hsq_A mol:protein length:259 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  41  2........KIHPTAIIDPKAELHESVEVGPYSIIEGNVSIQEGTIIEGHVKICAGSEIGKFNRFHQGAVIGVMPQDLGFNQQLTKTVIGDHNIFREYSNIHKGTKED-SPTVIGNKNYFMGNSHVGHDCILGNNNILTHGAVLAGHVTLGNFAFISGLVAVHQFCFVGDYSMVAGLAKVVQDVPPYSTVDGNPSTVVGLNSVGMKRAGFSPEVRNAIKHAYKVIYHSGISTRKALDELEASGNLIEQVKYIIKFFRDSDRGVTN 257
8 -108.0004r36_A mol:protein length:275 Putative acyl-[acyl-carrier-protein]--UDP-N-a  ali model follow..  41  7GLVPRGSHMISPLAYIHPEAKIGENVEIAPFVYIDRNVVIGDNNKIMANANILYGSRIGNGNTIFPGAVIGAIPQDLKFKGEESTAEIGDNNLIRENVTINRGTAAK-GRTIVGNNNLLMEGVHVAHDALIGNGCIVGNSTKMAGEIIIDDNAIISANVLMHQFCRVGGYVMIQGGCRFSKDIPPYIIAGREPIAYSGINIIGLRRRGFSNEIIENIHNAYRIIYQSGLNTSDALTKVEAEVPASPEIEYIVDFIRNSERGIIR 269
9 -101.0003t57_A mol:protein length:305 UDP-N-acetylglucosamine O-acyltransferase dom  ali model follow..  39  2.DSRDSEVLIHPSAVVHPNAVIGKGVSVGPYCTIGSSVKLGNGCKLYPSSHVFGNTELGENNIIGHHAVVGVKCQDLKYKGDECFLCIGNNNEIREFCSIHRSS-KPSDKTVIGDNNLIMGSCHIAHDCKIGDRNIFANNTLLAGHVVVEDNTHTAGASVVHQFCHIGSFAFIGGGSVVSQDVPKYMMVAGERAELRGLNLEGLRRNGFTMSEMKSLRAAYRKIFMSTETVSLSFEERLTELEQDQELQSIRDSFTESRRGICK 296
10 -28.4002iu8_A mol:protein length:374 UDP-3-O-[3-HYDROXYMYRISTOYL] GLUCOSAMINE N-AC  ali model follow..  21  130TAIIEDHVCIEPYAVVCQHAHVGSACHIGSGSVIGAYSTVGEHSYIHPRVVIRERVSIGKRVIIQPGAVIGSCGFGYVTSAFGQKVIIEDDVEIGANTTIDRGRFKH---SVVREGSKIDNLVQIAHQVEVGQHSMIVAQAGIAGSTKIGNHVIIGGQAGITGHICIADHVIMMAQTGVTKSITSPGIYGGAPARPY----QEIHRQVAKVRNLPRLEERIAALEKLVQKLEALSEQ........................... 367
11 -27.7003pmo_A mol:protein length:372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac  ali model follow..  20  116.........IHPTAIVAADAEVDPSASVGAYAVIESGARIGAGVSIGAHCVIGARSVIGEGGWLAPRVTLGFANEKGVWQKIAQGVTIGDDVEIGANTTIDRGALSD---TLIGNGVKLDNQIMIAHNVQIGDHTAMAACVGISGSAKIGRHCMLAGGVGLVGHIEICDNVFVTGMTMVTRSITPGSYSSGTAMQPAA-SAARIRQLDDMARRLQQLEKRLAAVTSSGDASSDA.............................. 366
12 -27.6004ihf_A mol:protein length:348 UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acy  ali model follow..  22  101.........IAPSAVIDATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIGYANDRGNWVKIPQRVIIGDRVEIGACTTIDRGALDD---TIIGNGVIIDNQCQIAANVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMRPITPGVYSSGIPLQPNK-TAALVMNIDDMSKRLKSLERKVNQQ........................................ 341
13 -26.9003fs8_A mol:protein length:273 QdtC  ali model follow..  20  3.NNISKSAIIKEGVIIGENVTIEDNVYIDYGCIIRDNVHIKKGSFIGARSIIGENALIRTENVIYGDTIIGD------------NFQTGHKVTIRENTKIGNNVKIGTLSVYIGNYVNIHSNVFVGEKSIIKDFVWLFPHVVLTNDVTIELFAVIAARSVVLPGIHINEDALVGAGAVVTKDVPKETVVVGNPAREIC--------RKIKNKITGEQVYPWRYTFKRGMPWEET.............................. 252
14 -26.8004e75_A mol:protein length:357 UDP-3-O-acylglucosamine N-acyltransferase  ali model follow..  21  101.....SSTGIESTARIHPSAVISETAYIGHYVVIGENCVVGDNTVIQSHTKLDDNVEVGKDCFIDSYVTIGFAPYQGKWH-QLGSVLIGNDVRIGSNCSIDRGALDN---TILEDGVIIDNLVQIAHNVHIGSNTAIAAKCGIAGSTKIGKNCILAGACGVAGHLSIADNVTLTGMSMVTKNISAGTYSSGTGLFENN-KKTIVRLRQLADVPLTQITKRLDHIQAQIESLESTFNL........................... 356
15 -26.2005adx_U mol:protein length:190 DYNACTIN 5  ali model follow..  20  3.EKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAE---------AGPIVIGEGNLIEEQALIINAHPDNAEDSEPKPMIIGTNNVFEVGCYSQA--------MKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNY.............................................................................. 174
16 -25.8003tv0_A mol:protein length:194 Dynactin subunit 6  ali model follow..  20  7.EKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAE---------AGPIVIGEGNLIEEQALIINAYPDNTEDPEPKPMIIGTNNVFEVGCYSQ---------MKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNY.............................................................................. 178
17 -24.0005afu_U mol:protein length:168 DYNACTIN  ali model follow..  21  1...........PGAVVCVESEIRGDVTIGPRTVIHPKARIIAEA---------GPIVIGEGNLIEEQALIINAYPDNITPDTEKPMIIGTNNVFEVGCYSQ---------MKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRR..................................................................................................... 135
18 -22.9004m98_A mol:protein length:208 Pilin glycosylation protein  ali model follow..  23  91......PVLIHPDATVSPSAIIGQGSVVMAKAVVQAGSVLKDGVIVNTAATVD-------------------------------------------------------------------------HDCLLDAFVHISPGAHLSGNTRIGEESRIGTGACSRQQTTVGSGVTAGAGAVIVCDIPDGMTVAGNPAKP.................................................................... 207
19 -22.8003vbi_A mol:protein length:205 Galactoside O-acetyltransferase  ali model follow..  19  27...................LSVGKNVLISKKASIPGVISIGNNVRIDDFCILSGKVTIGSYSHIAAYTAL---------YGGEVGIEMYDFANISSRTIVYAAIDD------------------FSGNALMGPTIPNQYKNVKTGKVILKKHVIIGAHSIIFPNVVIGEGVAVGAMSMVKESLDDWYIYVGVPVR..................................................................... 177
20 -22.2004m9c_A mol:protein length:216 Bacterial transferase hexapeptide (Three repe  ali model follow..  28  94...........................QSTNTVILDEVEIGEGSLLCPFTCLTSNIKIGKFFHANIYSYVA-------------------------------------------------------HDCVIGDYVTFAPGAKCNGNIHIEDHAYIGTGAVIKQ-LIIGKGAIVGMGAVVTKSVPAGVTVVGNPARI.................................................................... 212
21 -22.2002npo_A mol:protein length:207 Acetyltransferase  ali model follow..  22  79.......NLIHKSALISPSAIV----------------EENAGILIMPYVVINAKAKIEKG------------------------------------VILNTSSV-------------------IEHECVIGEFSHVSVGAKCAGNVKIGKNCFLGINSCVLPNLSLADDSILGGGATLVKNQDEKGVFVGVPAK..................................................................... 195
22 -22.2003bss_A mol:protein length:198 Acetyltransferase  ali model follow..  22  80.......NLIHKSALISPSAIV----------------EENAGILIMPYVVINAKAKIEKG------------------------------------VILNTSSV-------------------IEHECVIGEFSHVSVGAKCAGNVKIGKNCFLGINSCVLPNLSLADDSILGGGATLVKNQDEKGVFVGVPAK..................................................................... 196
23 -21.9003mqg_A mol:protein length:192 Lipopolysaccharides biosynthesis acetyltransf  ali model follow..  29  1....GHMATIHPTAIVDEGARIGAHSRIWHWVHICGGAEIGEGCSLGQNVFVGNRVRIGNRVKIQNNVSV--------YDN-----------------------------------------VFLEDDVFCGPSMVFTNVYNPRAAIEVRQGATLGANCTVVCGATIGRYAFVGAGAVVNKDVPDFALVVGVPARQIG.................................................................. 154
24 -21.7004ea7_A mol:protein length:220 Perosamine N-acetyltransferase  ali model follow..  31  100.......NAIHPSAVVSPSVRLGEGVAVMAGVAINADSWIGDLAIINTGAVVD-------------------------------------------------------------------------HDCRLGAACHLGPASALAGGVSVGERAFLGVGARVIPGVTIGADTIVGAGGVVVRDLPDSVLAIGVPAK..................................................................... 214
25 -19.2004mzu_A mol:protein length:312 WxcM-like protein  ali model follow..  25  1........MIHKLADVQ-SQNIGDNTKVWQFCVILAGAVIGRNCNICANSLIEN------------------------------DVVIGDNVTIKSGVQIWDG-------------------IHIQDDVFIGPNVTFTNDKQPRSKIYVKKGASIGANSTILPGILIGENAMVGAGAVITKNVPDNAIVIGNPGRITG.................................................................. 148
26 -18.5003vnp_A mol:protein length:183 Hypothetical conserved protein  ali model follow..  18  4..............................YPYKGKTPQIAASAFIADYVTITGDVVIGEETSIWFNTVI---------RGDVAPTVIGNRVNIQDNSILH----QSPNNPLIIEDGVTVGHQVILHSAIVRKNALIGMGSIILDRAEIGEGAFIGAGSLVPP----------------GKKIPPNTLALGRPAKVV---------RELTEDDIREMERIRREYVEKGQYYKALQQQRTSCADK.................... 179
27 -18.2004mfg_A mol:protein length:168 Putative acyltransferase  ali model follow..  20  6..............................RDYLEDKPLIDESVFVAKSADVIGNVKIGKDSSIWYNAVV---------RGDEGPITIGENTNIQDCSIV-----------------------HGDTETIIGNNVTVGHRSIVHG-CKISDNVLIGMGSIILDNAEIGEYTLIGAGTLITKKFPPGVLIMGSPGKVRELTEEDKKYIDESYEWYLEAAQNQK.......................................... 167
28 -18.0003ixc_A mol:protein length:191 Hexapeptide transferase family protein  ali model follow..  17  25..................................GVSPSVDSTAFIAGNARIIGDVCIGKNASIWYGTVL---------RGDVDKIEVGEGTNIQDNTVVH--TDSMHGDTVIGKF-VTIGHSCILHACTLGNNAFVGMGSIVMDRAVMEEGSMLAAGSLLTR----------------GKIVKSGELWAGRPAKLRMMTEEEILYLQKSAENYIALSRGY........................................... 184
29 -17.8003tio_A mol:protein length:183 Protein YrdA  ali model follow..  19  9..................................DLFPQIGQRVMIDDSSVVIGDVRLADDVGIWPLVVI---------RGDVHYVQIGARTNIQDGSMLHKSSYNPDGNPLTIGEDVTVGHKVMLHGCTIGNRVLVGMGSILLDGAIVEDDVMIGAGSLVPQ----------------NKRLESGYLYLGSPVKIRPLSDEEKAGLRYSANNYVKWKDEYL.......................................... 175
30 -17.7001xhd_A mol:protein length:173 putative acetyltransferase/acyltransferase  ali model follow..  18  6..............................YPYKEKKPKIASSAFIADYVTITGDVYVGEESSIWFNTVI---------RGDVSPTIIGDRVNVQDQCTLH----QSPQYPLILEDDVTVGHQVILHSCHIKKDALIGMGSIILDGAEIGEGAFIGAGSLVSQ----------------GKKIPPNTLAFGRPAKVI---------RELTAEDRKDMERIRTQYVEKGQYYKSLQK............................ 173
31 -17.6003r3r_A mol:protein length:187 ferripyochelin binding protein  ali model follow..  17  13..................................NLFPGIGQRVMIDTSSVVIGDVRLADDVGIWPLVVI---------RGDVNYVAIGARTNIQDGSVLHKSSSNPHGNPLIIGEDVTVGHKVMLHGCTIGNRVLVGMGSIVLDGAIIEDDVMIGAGSLVPQ----------------HKRLESGYLYLGSPVKIRPLSDAERSGLQYSANNYVKWKDDYL.......................................... 179
32 -17.6003r1w_A mol:protein length:189 carbonic anhydrase  ali model follow..  17  17..................................GISPKLGERVFVDRSSVIIGDVELGDDCSVWPLAVI---------RGDMHHIRIGARTSVQDGSVLHASDYNPGGYPLIIGDDVTIGHQAMLHGCTIGNRVLIGMKSMIMDGAIVEDEVIVAAGATVSP----------------GKVLESGFVYMGTPAKVRPITEKERSFFTYGAGNYVRLKDKHL.......................................... 183
33 -17.5001v3w_A mol:protein length:173 ferripyochelin binding protein  ali model follow..  17  4..............................YEINGKKPRIHPSAFVDENAVVIGDVVLEEKTSVWPSAVL---------RGDIEQIYVGKYSNVQDNVSIHT----SHGYPTEIGEYVTIGHNAMVHGAKVGNYVIIGISSVILDGAKIGDHVIIGAGAVVPP----------------NKEIPDYSLVLGVPGKVV---------RQLTEEEIEWTKKNAEIYVELAEKHIKGRKRI.......................... 173
34 -17.1003jqy_B mol:protein length:252 Polysialic acid O-acetyltransferase  ali model follow..  20  59..........................................................GNNNKLIIEDDVECRWLTVIFRGDNNYVRIHKNSKIKGDIVATKGS-----KVIIGRRTTIGAGFEVVTDVTIGHDCMIARDVILDGHIIISSYVWVGRNVSIMKGVSVGSGSVIGYGSIVTKDVPSMCAAAGNPAKIIKRNIIWARTD......................................................... 224
35 -16.7003r8y_A mol:protein length:240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  24  86.DLKGIKARIEPGAIIRDHVEIGDNAVIMMNATINIGAVIGEGSMIDMNAVLGGRATVGKNCHVGAGAVLAGVIEPPS-----------------------------------------------------------------AKPVIVEDDVVIGANVVVLEGVTVGKGAVVAAGAVVTEDVPPYTVVAGTPARVIKEIDEKTKAKTEIKQELRQLNP............................................. 238
36 -16.5003cj8_A mol:protein length:236 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  21  86.DLKDINARIEPGALIREKVEIGDQAVIMMGAILNIGAVVGAGTMIDMGAVLGGRATVGKHCHIGAGTVLAGVIEPPS-----------------------------------------------------------------AAPVVIENEVVIGANAVVLEGVRVGEGAVVAAGAVVVEDVPAHTVVAGVPAKVIKQIDDKTKSKTEILEELRKL............................................... 236
37 -16.5003kwc_A mol:protein length:229 Carbon dioxide concentrating mechanism protei  ali model follow..  15  35....................EIAPTAYVHSFSNLIGDVRIKDYVHIAPGTSIRA--------------------------DEGTPFHIGSRTNIQDGVVIH-----------GLQQGRVIGDDGQEYSVWIGDNVSITHMALIHGPAYIGDGCFIGFRSTVFN-ARVGAGCVVMMHVLIQEIPPGKYVPSGMVITTQQ-----------QADRLPNVEESDIHFAQHVVGINEALLSGYQCAENIACIAPIRNELQ........ 223
38 -16.0005adx_V mol:protein length:165 DYNACTIN SUBUNIT 6  ali model follow..  12  1.........................................SGNKVSRQSVLCGSQNINGKTIVMNDCII---------RGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVA-------------FFPLHIGDHVFIEEDCVVNA-AQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPEVPPFTVFSGCPGLFS---------GELPECTQELMIDVTKSYYQKFLPLTQV.............................. 165
39 -15.6001qq0_A mol:protein length:247 CARBONIC ANHYDRASE  ali model follow..  16  61....................VIDPTAYIDPQASVIGEVTIGANVMVSPMASIRS--------------------------DEGMPIFVGDRSNVQDGVVLH--ALETINEEGEPIEDNIVEVDGKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFK-SKVGNNCVLEPRSAAIRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVYVNVHLAEGYKE..................................... 245
40 -15.0003eev_A mol:protein length:212 Chloramphenicol acetyltransferase  ali model follow..  16  17...............................................DQQVTNPNIIVGKHSYYSGYYHGHSFDDCVRYRDDVDKLVIGSFCSIGSGAVFMMAGNQGHRSDWISTFPFFYQDNDNFAD--------ARDGFTRSGDTIIGHDVWIGTEAMIMPGVKIGHGAIIASRSVVTKDVAPYEVVGSNPAKHI--------KFRFSDVEIAMLLEM............................................ 177
41 -15.0002wlc_A mol:protein length:215 POLYSIALIC ACID O-ACETYLTRANSFERASE  ali model follow..  18  10..........................................................GINNTINISTTSLTNATQLTVIGNNNSVYIGNNCKIVSSNIRLKGSLHSDCSLQIQAKTTMGNGEITIAEISIGKDCMLAHGYEIDMHVIIGNHVWLGRNVTILKGVCIPNNVVVGSHTVLYKSFKPNCVIAGSPAKIVKENIVWGRK.......................................................... 198
42 -14.4004n27_A mol:protein length:195 Bacterial transferase hexapeptide repeat  ali model follow..  18  25...................................PQFADRESNWIAPDATLIGKVVVGENAGFWFGAVL---------RGDNEPITIGADTNVQEQTIMHT----DIGFPLTIGAGCTIGHRAILHGCTIGENTLIGMGAIVLNGAKVGKNCLIGAGTLVKE----------------GMEIPDNSLVVGSPARVL---------RQLDDAAVEKLRASAKHYVERGHSFMRGME............................ 187
43 -14.4003hjj_A mol:protein length:190 Maltose O-acetyltransferase  ali model follow..  15  57.....................................................................LGSSADGKAQINPDFRCDYGYNIHVGKSFFANFNVILDVCEVRIGDHCMFAPGVHIYTATHPLHPVERNSGKEYGKPVKIGNNVWVGGGAIINPGVSIGDNAVIASGAVVTKDVPNNVVVGGNPAKV.................................................................... 184
44 -14.4001xat_A mol:protein length:212 XENOBIOTIC ACETYLTRANSFERASE  ali model follow..  19  15...............................................SEQVSNPNIRVGRYSYYSGYYHGHSFDDCARYRDDVDKLVIGSFCSIGSGAAFIMAGNQGHRAEWASTFPFHFMHEEPAFA--------AVNGYQPAGDTLIGHEVWIGTEAMFMPGVRVGHGAIIGSRALVTGDVEPYAIVGGNPARTI--------RKRFSDGDIQNLLEM............................................ 176
45 -13.9003foq_A mol:protein length:503 Bifunctional protein glmU  ali model follow..  19  262..QLAGVTVVDPTTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTD-VAVGDGASVVR-SSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTLTYVGD-------ADIGEYSNIGASSVFVNYDGTSKRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQASK................................................ 477
46 -13.9003ect_A mol:protein length:195 Hexapeptide-repeat containing-acetyltransfera  ali model follow..  25  76....................................................................................TIRIGDHTFINMNVVM------DGAPITIGDHVLIGPSTQFYTASHSLDYRRRQAWETICKPIVIEDDVWIGGNVVINQGVTIGARSVVAANSVVNQDVPPDTLVGGTPARI.................................................................... 182
47 -13.7001ocx_A mol:protein length:182 MALTOSE O-ACETYLTRANSFERASE  ali model follow..  21  72....................................................................................NIFLGNNFFANFDCVM------DVCPIRIGDNCMLAPGVHIYTATHPIDPVARNSGAELGKPVTIGNNVWIGGRAVINPGVTIGDNVVVASGAVVTKDVPDNVVVGGNPARI.................................................................... 178
48 -13.5001kqa_A mol:protein length:203 GALACTOSIDE O-ACETYLTRANSFERASE  ali model follow..  21  57......................................................................................TVGENAWVEPPVYFSYGSNIHIGRNFYANFNLTIVDD----TVTIGDNVLIAPNVTLTGHITIGNNVWIGSHVVINPGVTIGDNSVIGAGSIVTKDIPPNVVAAGVPCRV-----------------IREINDRDKHYYFKDYKVESSV............................. 203
49 -13.5002ic7_A mol:protein length:185 Maltose transacetylase  ali model follow..  16  74....................................................................................NIHVGENFFMNFDGVI------DVCEVRIGDHCFIGPGVHIYTATHPLDPHERNSGLEYGKPVVIGHNVWIGGRAVINPGVTIGDNAVIASGAVVTKDVPANAVVGGNPAKV.................................................................... 180
50 -13.5003srt_A mol:protein length:188 Maltose O-acetyltransferase  ali model follow..  20  76....................................................................................NIHVGENFFANYDCIF------DVCKIEIGDNVMLAPNVQIYTAYHPIDAQLRNSGIEYGSPVKIGDNVWIGGGVIITPGITIGDNVVIGAGSVVTKDIPPNTVAVGNPCRV.................................................................... 182
51 -13.4001khr_A mol:protein length:209 STREPTOGRAMIN A ACETYLTRANSFERASE  ali model follow..  16  6.MKMYPIEGNKSVQFIKPILEKLENVEVGEYSYYDSKNGETFDKQILYHYPILNDKLK-----IGKFCSIGPG----------VTIIMNGANHRMDGSTYPFNLFGNG-----------------------EKHMPKLDQLPIKGDTIIGNDVWIGKDVVIMPGVKIGDGAIVAANSVVVKDIAPYMLAGGNPANEI--------KQRFDQDTINQLLDI............................................ 179
52 -13.2004hur_A mol:protein length:220 Virginiamycin A acetyltransferase  ali model follow..  19  21..........NRNLQFIKPTITNENILVGEYSYYDSKRGESFEDQVLYHYEVIGDKLI-----IGRFCSIGPG----------TTFIMNGANHRMDGSTYPFHLFRMG-----------------------EKYMPSLKDLPLKGDIEIGNDVWIGRDVTIMPGVKIGDGAIIAAEAVVTKNVAPYSIVGGNPLKFI--------RKRFSDGVIEEWLAL............................................ 185
53 -13.0003v4e_A mol:protein length:202 Galactoside O-acetyltransferase  ali model follow..  21  77....................................................................................NVKLGKNVYVNTNCYF------DGGQITIGDNVFIGPNCGFYTATHPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKVVRKIDNDLPSETLNDETIK................................................. 202
54 -13.0001hm0_A mol:protein length:468 N-ACETYLGLUCOSAMINE 1-PHOSPHATE URIDYLTRANSFE  ali model follow..  20  251..MVNGVSFVNPATYIDIDVEIAPEVQIEANVILKGQTKIGAETVLTNGTYVVD-STIGAGAVITN-SSVADGVTVGPYAHIRPNSSLGAQVHIGNFVEVKGSSIGENTLTYIGN-------CEVGSNVNFGAGTITVNYDGKNKYTVIGDNVFVGSNSTIIAPVELGDNSLVGAGSTITKDVPADAIA----GRGRQINKDEYATR......................................................... 454
55 -12.9001g95_A mol:protein length:459 N-ACETYLGLUCOSAMINE-1-PHOSPHATE URIDYLTRANSFE  ali model follow..  19  248..MVNGVSFVNPATYIDIDVEIASEVQIEANVTLKGQTKIGAETVLTNGTYVVD-STIGAGAVITN-SSVADGVIVGPYAHIRPNSSLGAQVHIGNFVEVKGSSIGENTLTYIGN-------CEVGSNVNFGAGTITVNYDGKNKYTVIGNNVFVGSNSTIIAPVELGDNSLVGAGSTITKDVPADAIA----GRGRQINKDEYATR......................................................... 451
56 -12.8004fce_A mol:protein length:459 Bifunctional protein GlmU  ali model follow..  18  271...HGRDITIDTNVIIEGHVILGDRVRIGTGCVL-KNCVIGDDSEISPYTVLED-ARLDANCTVGPFARL------------RPGAELAEGAHVGNFVEIKKARLGKGSLSYLGD-------AEIGAGVNIGAGTITCNYDGANKFTIIGDDVFVGSDTQLVAPVTVANGATIGAGTTVTRDVAENELV----SRVKQVHIQGWKR.......................................................... 454
57 -12.8002v0h_A mol:protein length:456 BIFUNCTIONAL PROTEIN GLMU  ali model follow..  21  268...HGKDVEIDVNVIIEGNVKLGDRVKIGTGCVL-KNVVIGNDVEIKPYSVLED-SIVGEKAAIGPFSRL------------RPGAELAAETHVGNFVEIKKSTVGKGSLTYVGD-------SEIGSNCNIGAGVITCNYDGANKFTIIGDDVFVGSDTQLVAPVKVANGATIGAGTTITRDVGENELV----TRVAQRHIQGWQR.......................................................... 451
58 -12.8001hv9_A mol:protein length:456 UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE  ali model follow..  18  268...HGRDVEIDTNVIIEGNVTLGHRVKIGTGCVI-KNSVIGDDCEISPYTVVED-ANLAAACTIGPFARL------------RPGAELLEGAHVGNFVEMKKARLGKGSLTYLGD-------AEIGDNVNIGAGTITCNYDGANKFTIIGDDVFVGSDTQLVAPVTVGKGATIAAGTTVTRNVGENALA----SRVPQTQKEGWRR.......................................................... 451
59 -12.7004dcl_A mol:protein length:207 Putative acetyltransferase SACOL2570  ali model follow..  22  74....................................................................................NVKLGKNVYVNTNCYF------DGGQITIGDNVFIGPNCGFYTATHPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKV.................................................................... 180
60 -12.6004egg_A mol:protein length:207 Putative acetyltransferase SACOL2570  ali model follow..  22  74....................................................................................NVKLGKNVYVNTNCYF------DGGQITIGDNVFIGPNCGFYTATHPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKV.................................................................... 180
61 -12.2002ggo_A mol:protein length:401 401aa long hypothetical glucose-1-phosphate t  ali model follow..  16  220............KWALDNLVFSQNLGNVEDNVKIKGKVIIEEDAEIKSGTYIEGPVYIGKGSEIGPNSYLRP------------YTILVEKNKIGASVEVKESVIMEG--SKIPHLSYVGDSV-IAEDVNFGAGTLIANLRFDEKEVKIGGHVRTGINVTILPGVKIGAYARIYPGAVVNRDVGYGEFF........................................................................... 399
62 -11.6001ssq_A mol:protein length:267 Serine acetyltransferase  ali model follow..  21  140.............................................................................................IHPAAKIGHGIMFDHATGIV-----------VGETSVIENDVSILQGVTLGGHPKVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVPEYATAAGVPARIVS.................................................................. 241
63 -11.6001s80_A mol:protein length:278 Serine acetyltransferase  ali model follow..  21  142.............................................................................................IHPAAKIGHGIMFDHATGIV-----------VGETSVIENDVSILQGVTLGGHPKVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVPEYATAAGVPARIVS.................................................................. 243
64 -11.5004n69_A mol:protein length:286 Serine Acetyltransferase Apoenzyme  ali model follow..  27  155.............................................................................................IHPAARIGKGILFDHATGVV-----------VGETAVIGNNVSILHHVTLGGHPKIGDGVLIGAGATILGNIKIGEGAKVGAGSVVLIDVPPRTTAVGNPARLVG.................................................................. 256
65 -11.5003gvd_A mol:protein length:276 Serine acetyltransferase  ali model follow..  24  147.............................................................................................IHPAATIGCGIMLDHATGIV-----------IGETAVVENDVSILQSVTLGGHPKIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQSVPAHTTAAGVPARIVG.................................................................. 248
66 -11.4004h7o_A mol:protein length:281 Serine acetyltransferase  ali model follow..  23  144.............................................................................................IHPAARIGRGIMLDHATGIV-----------IGETAVVEDDVSILQDVTLGGHPKIREGVMIGAGAKILGNIEVGEGAKIGSGSVVLQAVPPHTTVAGVPARIVG.................................................................. 245
67 -11.4004hzd_A mol:protein length:282 CysE, serine acetyltransferase  ali model follow..  18  154.............................................................................................IHPAARLGSGLFLDHATGLV-----------VGETAVVEDNVSILHGVTLGGHPKIRQGVLIGAGAKILGNIQVGQCSKIAAGSVVLKSVPHNVTVAGVPARIIG.................................................................. 255
68 -11.3001t3d_A mol:protein length:289 Serine acetyltransferase  ali model follow..  23  154.............................................................................................IHPAAKIGRGIMLDHATGIV-----------VGETAVIENDVSILQSVTLGGHPKIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQPVPPHTTAAGVPARIVG.................................................................. 255
69 -11.3003mc4_A mol:protein length:287 WW/Rsp5/WWP domain:Bacterial transferase hexa  ali model follow..  18  161.............................................................................................IHPAARLGSGLFLDHATGLV-----------VGETAVVEDNVSILHGVTLGGHPKIRQGVLIGAGAKILGNIQVGQCSKIAAGSVVLKSVPHNVTVAGVPARIIG.................................................................. 262
70 -10.5002f9c_A mol:protein length:334 Hypothetical protein YDCK  ali model follow..  13  61..IYDENAMAFAGTEITGNARITQPCTLYNNVRIGDNVWIDRSSSVREECAIYGDARVLNQSEILAIQGLTHEHAQILQIYDRATVNHSRIVHQVQLYGNAEVFDFALIEGDKDNNVWICDCAKVYGHARVIAGTEEDAIPTLRYSSQVAEHALIEGNCVLKHHVLVGGHAEVRGGPILLDD.................................................................................. 267
71 -9.6503f1x_A mol:protein length:310 Serine acetyltransferase  ali model follow..  24  180..............FITEMAHSETGIDIHPGAQIGHHFTIDHGT-----VVIGATSIIGNNVKLYQGVTLGAKSFPLDNNGNPIK--------------------------------------GIPRHPILEDDVIVYSNATILGRVTIGKGATVGGNIWVTENVPAGSRIVQRKNKDELE................................................................................... 304
72 -9.4403p47_A mol:protein length:315 Serine acetyltransferase  ali model follow..  20  155..............EMMESVHSYTSIDIHPGASIKGHFFIDHGV-----VVIGETAIIGEWCRIYQSVTLGA----MHFQEEGGVIKRG-----------------------------------TKRHPTVGDYVTIGTGAKVLGNIIVGSHVRIGANCWIDRDVDSNQTVYISEHPTHFVK.................................................................................. 279
73 -9.1905b04_I mol:protein length:678 Probable translation initiation factor eIF-2B  ali model follow..  12  304....QTFSYQRHQIYKEEDVVLARSCIIKARTLIGAYTKVGDASVV-ANTIIGRNCTIGSNCSI-------------------DSAFLWEDVVIGDNCRIGK--------AILANSVKIGNNCSIEDGAIVAAGVVIGDNTIIEKNKRL................................................................................................................... 420
74 -9.1803c8v_A mol:protein length:496 Putative acetyltransferase  ali model follow..  14  258.........VFASGHMASGAGSASGASVSGYAVIKGDTVIGENVLVSQRAYLDNAW-------------------------------MGKGSNAQENCYIINSRLERNCV---------TAHGGKIINAHLGDMIFTGFNSFLQGPLKIGDGCVVMPHTIIEEPLEIPAGHLVWGYIRNKADLAAHSISFEEFAKVDGVTMGRMTFRGKGGPFLDSFKRIKRILSENGAFFDGSEGTGHAQKGKNFTFNIIQPYQDGDPRGM.. 478

FFAS is supported by the NIH grant R01-GM087218-01
8 2 7 9 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Godzik A. Fragnostic: walking through protein structure space. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W249-51.