current user: public




Query: 2j89_A mol:protein length:261 METHIONINE SULFOXIDE REDUCTASE A, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst MLQTLSTHLSSTSTSTTTPLLLLSKPFLSPSAKSQLSHSKPFNFPRTLKPISYYKPPMANILSKLGFGTRSPDPSTMDPTIPQGPDDDLPAPGQQFAQFGAGCFWGVELAFQRVPGVTKTEVGYTQGLLHNPTYEDVCTGTTNHNEVVRVQYDPKECSFDTLIDVLWARHDPTTLNRQGNDVGTQYRSGIYYYTPEQEKAAKESLERQQKLLNRKIVTEILPAKKFYRAEEYHQQYLAKGGRFGFMQSAEKGCNDPIRCYGLast
1 -134.0002j89_A mol:protein length:261 METHIONINE SULFOXIDE REDUCTASE A  ali model  100  1MLQTLSTHLSSTSTSTTTPLLLLSKPFLSPSAKSQLSHSKPFNFPRTLKPISYYKPPMANILSKLGFGTRSPDPSTMDPTIPQGPDDDLPAPGQQFAQFGAGCFWGVELAFQRVPGVTKTEVGYTQGLLHNPTYEDVCTGTTNHNEVVRVQYDPKECSFDTLIDVLWARHDPTTLNRQGNDVGTQYRSGIYYYTPEQEKAAKESLERQQKLLNRKIVTEILPAKKFYRAEEYHQQYLAKGGRFGFMQSAEKGCNDPIRCYG 261
2 -102.0001fva_A mol:protein length:217 PEPTIDE METHIONINE SULFOXIDE REDUCTASE  ali model follow..  39  12......................................................SAAKIVSPQEALPGRKEPLVVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWTLKGVYSTQVGFAGGYTPNPTYKEVCSGKTGHAEVVRVVFQPEHISFEELLKVFWENHDPTQGMRQGNDHGSQYRSAIYPTSAEHVGAALKSKEDYQKVLSELITTDIREGQTFYYAEDYHQQYLSKDPD-GYCGLGGTGVSCPL.... 217
3 -101.0002l90_A mol:protein length:212 Peptide methionine sulfoxide reductase  ali model follow..  41  3......................................................SASKVISAEEALPGRTEPIPVTAKHHVSGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGHTRNPTYKEVCSEKTGHAEVVRVVYRPEHISFEELLKVFWENHDPTQGMRQGNDFGTQYRSAVYPTSAVQMEAALRSKEEYQKVLSKPITTDIREGQVFYYAEDYHQQYLSKNPD-GYCGLGGTGVSCP..... 207
4 -99.5002gt3_A mol:protein length:212 Methionine Sulfoxide Reductase A  ali model follow..  42  1..................................................MSLFDKKHLVSPADALPGRNTPMPVATLHAVNGHSMT-NVPDGMEIAIFAMGCFWGVERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWENHDPAQGMRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAADDRHITTEIANATPFYYAEDDHQQYLHKNPY-GYCGIGGIGVCLP..... 209
5 -93.7003bqe_A mol:protein length:194 Peptide methionine sulfoxide reductase msrA/m  ali model follow..  40  2............................................................................................NTRTIYLAGGCFWGLEAYFQRIDGVVDAVSGYANGNTKNPSYEDVSYRHTGHAETVKVTYDADKLSLDDILQYFFRVVDPTSLNKQGNDTGTQYRSGVYYTDPAEKAVIAAALKREQQKYQLPLVVENEPLKNFYDAEEYHQDYLIKNPN-GYCHIDIRKADEPLPG.. 167
6 -91.4003pim_A mol:protein length:187 Peptide methionine sulfoxide reductase  ali model follow..  34  3.............................................................................HGSSLISKTIKYDPAKDKLITLACGCFWGTEHMYRKYDRIVDCKVGYANGEESKKSYKRVCGGDTDFAEVLQVSYNPKVITLRELTDFFFRIHDPTTSNSQGPDKGTQYRSGLFAHSDADLKELAKIKEEWQPKWGNKIATVIEPIKNFYDAEEYHQLYLDKNPQGYAC............... 179
7 -91.0001nwa_A mol:protein length:203 Peptide methionine sulfoxide reductase msrA  ali model follow..  34  2................................................................................GSSGHIEGRHMTSNQKAILAGGCFWGLQDLIRNQPGVVSTRVGYSGGNIPNATYRNHG----THAEAVEIIFDPTVTDYRTLLEFFFQIHDPTTKDRQGNDRGTSYRSAIFYFDEQQKRIALDTIADVEASWPGKVVTEVSPAGDFWEAEPEHQDYLQRYPNGYTCHFVRPGWRLPRRTA. 179
8 -89.9003pin_B mol:protein length:183 Peptide methionine sulfoxide reductase  ali model follow..  34  1...............................................................................SSLISKTIKYDPAKDKLITLASGSFWGTEHMYRKYDRIVDSKVGYANGEESKKSYKRVSGGDTDFAEVLQVSYNPKVITLRELTDFFFRIHDPTTSNSQGPDKGTQYRSGLFAHSDADLKELAKIKEEWQPKWGNKIATVIEPIKNFYDAEEYHQLYLDKNPQGYAC............... 175
9 -74.4003e0m_A mol:protein length:313 Peptide methionine sulfoxide reductase msrA/m  ali model follow..  37  1............................................................................................HMAEIYLAGGCFWGLEEYFSRISGVLETSVGYANGQVETTNYQLLKE--TDHAETVQVIYDEKEVSLREILLYYFRVIDPLSINQQGNDRGRQYRTGIYYQDEADLPAIYTVVQEQERMLGRKIAVEVEQLRHYILAEDYHQDYLRKNPS-GYCHI............. 153
10 -21.9002kv1_A mol:protein length:124 Methionine-R-sulfoxide reductase B1  ali model follow..  20.VYVCAKCSYELFSSHSKYAHSSPWPAFTETIHPDSVTKCKNRPEALKVSCGKCGNGLGHEFLNDGPKRGQSRFCIFSSSLKFVPKGKEAAASQ....................................................................................................................................................................... 114
11 -21.6003mao_A mol:protein length:105 Methionine-R-sulfoxide reductase B1  ali model follow..  13.VYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPNRSEALKVSCGKCGNGLGHEFLNDGPKPGQSRFSIFSSSLKFVPKGKETSA......................................................................................................................................................................... 105
12 -21.4003cez_A mol:protein length:164 Methionine-R-sulfoxide reductase  ali model follow..  67.IYHCVVCGTALFESGAKYHSGCGWPSYFKPIDGEVIMDYTHGMTRVEVRCNQCGAHLGHVFEDGPRDKTGLRYCINSAALNFEAKPE............................................................................................................................................................................. 156
13 -20.0001l1d_A mol:protein length:152 peptide methionine sulfoxide reductase  ali model follow..  49.IYVDVVSGEPLFSSADKYDSGCGWPSFTRPIDAKSVDDFSFNMRRTEVRSRAADSHLGHVFPDGPRDKGGLRYCINGASLKFIPLEQMDAAGY....................................................................................................................................................................... 144
14 -19.9002k8d_A mol:protein length:151 Peptide methionine sulfoxide reductase msrB  ali model follow..  61.IYRCICCGTDLFDSETKFDSGTGWPSFYDVVSEHNREDRSLGMVRCEVLCARCDAHLGHVFDDG-PRPTGKRYCMNSAALKFIPRDQ............................................................................................................................................................................. 149
15 -19.7003hcg_A mol:protein length:146 Peptide methionine sulfoxide reductase msrA/m  ali model follow..  43.IYVDVVSGEPLFSSADKYDSGCGWPSFTRPIDAKSVDDFSYNMRRTEVRSHAADSHLGHVFPDGPRDKGGLRYCINGASLKFIPLEQMDAAGY....................................................................................................................................................................... 138
16 -19.6003hch_A mol:protein length:146 Peptide methionine sulfoxide reductase msrA/m  ali model follow..  43.IYVDVVSGEPLFSSADKYDSGSGWPSFTRPIDAKSVDDFSYNMRRTEVRSHAADSHLGHVFPDGPRDKGGLRYSINGASLKFIPLEQMDAAGY....................................................................................................................................................................... 138
17 -19.5003hci_A mol:protein length:154 Peptide methionine sulfoxide reductase  ali model follow..  50.VYTCRLCGLPLFRSNAKFDSGTGWPSFFAPYDPAHIRDTSYGMVRTEIVCARCDSHLGHVFPDG-PPPTGERHSLNSVSLAFTEDGQPLPNPLQRAG................................................................................................................................................................... 148
18 -19.5002kzn_A mol:protein length:151 Peptide methionine sulfoxide reductase msrB  ali model follow..  11  41.LYVDIVSGKPLFTSKDKFDSQCGWPSFTKPIEEEVEEKLDHGMIRTEVRSRTADSHLGHVFND-GPGPNGLRYCINSAALRFVPKHKLKEEGY....................................................................................................................................................................... 134
19 -19.5003hcj_A mol:protein length:154 Peptide methionine sulfoxide reductase  ali model follow..  50.VYTCRLCGLPLFRSNAKFDSGTGWPSFFAPYDPAHIRDTSYGMIRTEIVCARCDSHLGHVFPDG-PPPTGERHCLNSVSLAFTEDGQPLPNPLQRAG................................................................................................................................................................... 148
20 -18.7002l1u_A mol:protein length:143 Methionine-R-sulfoxide reductase B2, mitochon  ali model follow..  10  37.MYHCVCCDSPLFSSEKKYCSGTGWPSFSEAYGSKGRLDTSLGCPRMEVVCKQCEAHLGHVFPDG-PKPTGQRFCINSVALKFKPSKPAAA.......................................................................................................................................................................... 135
21 -9.5402ofg_X mol:protein length:111 Zinc-transporting ATPase  ali model follow..  19  20....................................................................................................TSCKLKIEGSLERLKGVAEASVTVA-------------------TGRLTVTYDPKQVSEITIQERI-------------AALGYTLAEPKSSVTLNGHKHPHSHREEGHSHSHGAGEFNL......................................... 107

FFAS is supported by the NIH grant R01-GM087218-01
5 7 0 8 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Grynberg M, Jaroszewski L, Godzik A. Domain analysis of the tubulin cofactor system: a model for tubulin folding and dimerization. BMC Bioinformatics. 2003 Oct 10;4(1):46.