current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

2iyqA
Query: 2iyq_A mol:protein length:184 SHIKIMATE KINASE, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst MAPKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPSPSEAATLELast
1 -82.9002iyq_A mol:protein length:184 SHIKIMATE KINASE  ali model  100  1MAPKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPSPSEAATLE 178
2 -75.6001kag_A mol:protein length:173 Shikimate kinase I  ali model follow..  36  4.KRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRTGADVGWVFDLEGEEGFRDREEKVINELTEKQGIVLATGGGSVKSRETRNRLSAGVVVYLETTIEKQLARTQRDKKRPLLHVETPREVLEALANERNPLYEEIADVTIRTDDQSAKVVANQIIHMLESN......... 173
3 -74.7003trf_A mol:protein length:185 Shikimate kinase  ali model follow..  33  5.LTNIYLIGLMGAGKTSVGSQLAKLTKRILYDSDKEIEKRTGADIAWIFEMEGEAGFRRREREMIEALCKLDNIILATGGGVVLDEKNRQQISEGVVIYLTASIDTQLKRIGGEMRRPLFIKNNSKEKLQQLNEIRKPLYQAMADLVYPTDDLNPRQLATQILVDIKQTYSDLEN... 181
4 -70.8001e6c_A mol:protein length:173 SHIKIMATE KINASE  ali model follow..  33  1MTEPIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHTSGMTVADVVAAEGWPGFRRRESEALQAVAT-PNRVVATGGGMVLLEQNRQFMRAGTVVYLFAPAEELALRLQASHQRPTLTGRPIAEEMEAVLREREALYQDVAHYVVDATQ-PPAAIVCELMQTMRL.......... 170
5 -70.8001shk_A mol:protein length:173 SHIKIMATE KINASE  ali model follow..  34  1MTEPIFMVGARGCGKTTVGRELARALGYEFVDTDIFMQHTSGMTVADVVAAEGWPGFRRRESEALQAVAT-PNRVVATGGGMVLLEQNRQFMRAGTVVYLFAPAEELALRLQASHQRPTLTGRPIAEEMEAVLREREALYQDVAHYVVDATQ-PPAAIVCELMQTMRLPAA....... 173
6 -68.9002pt5_A mol:protein length:168 Shikimate kinase  ali model follow..  29  2...RIYLIGFMCSGKSTVGSLLSRSLNIPFYDVDEEVQKREGLSIPQIFEKKGEAYFRKLEFEVLKDLSEKENVVISTGGGLGANEEALNFMKSGTTVFIDIPFEVFLERCKDSKERPLLK--RPLDEIKNLFEERRKIYSK-ADIKVKGE-KPPEEVVKEILLSLEGNA........ 165
7 -67.7001via_A mol:protein length:175 shikimate kinase  ali model follow..  26  3LAKNIVFIGFMGSGKSTLARALAKDLDLVFLDSDFLIEQKFNQKVSEIFEQKRENFFREQEQKMADFFSSCEKACIATGGGFV---NVSNLEKAGFCIYLKADFEYLKKRLDKDEKRPLFYDEI---KAKKLYNERLSKYEQKANFILNIENKNIDELLSEIKKVIKE.......... 166
8 -67.5003vaa_A mol:protein length:199 Shikimate kinase  ali model follow..  26  18AMVRIFLTGYMGAGKTTLGKAFARKLNVPFIDLDWYIEERFHKTVGELFTERGEAGFRELERNMLHEVAEFENVVISTGGGAPCFYDNMEFMNRGKTVFLNVHPDVLFRRLRIAKQRPILQGKEDDEFIIQALEKRAPFYTQ-AQYIFNADELEDRWQIESSVQRLQE.......... 189
9 -63.3003n2e_A mol:protein length:168 Shikimate kinase  ali model follow..  29  2..QHLVLIGFMGSGKSSLAQELGLALKLEVLDTDMIISERVGLSVREIFEELGEDNFRMFEKNLIDELKTKTPHVISTGGGIVMHENLKGL---GTTFYLKMDFETLIKRLNQKEKRPLLN---NLTQAKELFEKRQALYEKNASFIIDARG-GLNNSLKQVLQFIALQ......... 164
10 -63.3001zuh_A mol:protein length:168 Shikimate kinase  ali model follow..  30  2..QHLVLIGFMGSGKSSLAQELGLALKLEVLDTDMIISERVGLSVREIFEELGEDNFRMFEKNLIDELKTKTPHVISTGGGIVMHENLKGL---GTTFYLKMDFETLIKRLNEREKRPLLN---NLTQAKELFEKRQALYEKNASFIIDARG-GLNNSLKQVLQFI............ 161
11 -59.3003nwj_A mol:protein length:250 AtSK2  ali model follow..  29  48.GRSMYLVGMMGSGKTTVGKIMARSLGYTFFDCDTLIEQAKGTSVAEIFEHFGESVFREKETEALKKLSLMHQVVVSTGGGAVIRPINWKYMHKGISIWLDVPLEALAHRIAGTGSRPLLHDDESGNRLSTIWDARGEAYTK-ASARVSLENITLKLGYRSVSDLTPA.......... 224
12 -56.6003t61_A mol:protein length:202 Gluconokinase  ali model follow..  17  17FPGSIVVMGVSGSGKSSVGEAIAEACGYPFIEGDALHPPENIRKMSEGIPLTDDDRWPWLAAIGERLASREPVVVSCSALKRSYRDKLRESAPGLAFVFLHGSESVLAERMHHRTGHFM-----PSSLLQTQLETLEDPRGEVRTVAVDVA-QPLAEIVREALAGLARLAENLYFQSW 189
13 -37.5001y63_A mol:protein length:184 Lmaj004144AAA protein  ali model follow..  14  10.GINILITGTPGTGKTSMAEMIAAELGFQHLEVGKLVKENHFYT-----EYDTELDTHIIEEKDEDRLLDFMEPIMVSRGNHVVDYHSSELFPEHMVVVLHTSTEVLFERLTKRQYSEAKRAENMEEIQCICEEEARDAYE--DDIVLVRENDTLEQMAATVEEIRERVEVLKVERG. 183
14 -28.4002vli_A mol:protein length:183 ANTIBIOTIC RESISTANCE PROTEIN  ali model follow..  11  3MRSPIIWIGPFGVGKTHTAHTLHERLPGSFVEPEEMGQALRKLTPGFSGDPQEHPMWIPLMLDALQYASREAAGPLIVPVSISDTARHRRLMSG-HHFTLIAPLNVVLERLRRDGQPQ--------VNVGTVEDRLNELRGEQFQTHIDTAGLGTQQVAEQIAAQVGLTLAPPPQGA. 180
15 -28.0001ki9_A mol:protein length:192 adenylate kinase  ali model follow..  12  2KNKLVVVTGVPGVGGTTITQKAMEKLSEEGINYKMV---NFGTVMFEVAQEENQKRIQKLAGRKIAEMVKESPVVVDTGYLPGLPVWVLNELNPDIIIVVETSGDEILIRRLNDETRN--RDLETTAGIEEHQIMNRAAAMTYGVKIIQNKNNLLDYAVEELISVLR........... 192
16 -27.4003iij_A mol:protein length:180 Coilin-interacting nuclear ATPase protein  ali model follow..  15  11.LPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYD--EYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHI-----VFVLRTDTNVLYERLTRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKEELENNVDQILKWIEQWIKDHNS... 180
17 -26.5002axp_A mol:protein length:173 hypothetical protein BSU20280  ali model follow..  13  2..TLIILEGPDCCFKSTVAAKLSKELKYPIIKGSSF-NEKLFEHFNKLADEDNVIIDRFVYSNLVYAKKFKDYSILT---ERQLRFIEDKIKAKAKVVYLHADPSVIKKRLRVRGDEYI-----EGKDIDSILELYREVMSNAG-YSWDTGQWSSDEIAKDIIFLVELE......... 167
18 -24.1001grq_A mol:protein length:178 CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE  ali model follow..  16  1MTTRMIILGGSSAGKSGIVRCLQSVLPEPWFGVDSLIEKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDERWRSFVGDLDVVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHE---------GVEYDVEVDTTHKESIECAWAIAAHV............ 176
19 -23.8001zp6_A mol:protein length:191 hypothetical protein Atu3015  ali model follow..  20  12....LLLSGHPGSGKSTIAEALANLPGVPHFHSDDLWGYIKHGRIDPWLPQSHQQNRMIMQIDVAGRYAKEGYFVILDG---VVRPDWLPAFTALAYIVLRTTAAEAIERCLDRGGDSLSD-----PLVVADLHSQFADLGAFEHHVLPVSGKDTDQALQSAINALQSGRFRIDASLE 185
20 -23.5001nks_A mol:protein length:194 ADENYLATE KINASE  ali model follow..  12  2..KIGIVTGIPGVGKSTVLAKVKEILDNQGINNKII---NYGDFMLATALKLGKLQIDAAKGIAEEARAGGEGYLFIDTHAVIRTPSG-TEINPSVIFLLEADPKIILSRQKRDTTRNRNDYSDESVILETINFARYAALAGSTVKVIVNVEGDPSIAANEIIRSMK........... 194
21 -23.4002bdt_A mol:protein length:189 BH3686  ali model follow..  17  1MKKLYIITGPAGVGKSTTCKRLAAQLDNSYIEGDIINHMVVGGYRPPWESDELLALTWKNITDLTVNFLLAQNDVVLDY---IAFPDEAEALAQTVFIILWTNREELLRRDA-LRKKDEQMGERCLELVEEFESKGID-----ERYFYNTSHLQPTNLNDIVKNLKTNPR........ 172
22 -23.0002rhm_A mol:protein length:193 Putative kinase  ali model follow..  16  8....IIVTGHPATGKTTLSQALATGLRLPLLSKDAFKEV-----MFDGLGWSDREWSRRVGATAIMMLYHTAATILQSGQSLIMEDLDTERMQN-IQIRCVASGDVLVERILSRIAQGCDDRSPADLELVRSRGDIPPLPLGGPLLTVDTTF-PEQIDMNAIVQWVRQHLQSGTA... 191
23 -22.5001knq_A mol:protein length:175 Gluconate kinase  ali model follow..  14  11....YVLMGVSGSGKSAVASEVAHQLHAAFLDGDFLHPRRNIEKMASLNDDDRKPWLQALNDAAFAMQRTNKVSLIVC---SALKKHYRDLLREGSFIYLKGDFDVIESRLKARKGH-------KTQMLVTQFETLQEPGADETDVLVVDIDQPLEGVVASTIEVIKKGK........ 175
24 -22.1003h86_B mol:protein length:192 Adenylate kinase  ali model follow..  13  2KNKVVVVTGVPGVGGTTVTQKAMDILSEEGLNYKMV---NFGSAMFDVANEEGQKRIQKMAGRKIAEMAKESPVAVDTGYLPGLPAWVLTELNPDIVIVVETDGDEILMRRLSDESR---RDLETTASIEEHQFMNRAAAMSYGVKIVKNKNGLVDNAVEELMSVLR........... 192
25 -21.2001kht_A mol:protein length:192 adenylate kinase  ali model follow..  11  2KNKVVVVTGVPGVGSTTSSQLAMDNLRKEGVNYKMV---SFGSVMFEVAKEENQKRIQKMAGRKIAEMAKESPVAVPKGYLPGLPSWVLNELNPDLIIVVETTGDEILMRRMSDETR---RDLDTASTIEQHQFMNRCAAMSYGVKIVQNRNGLLDQAVEELTNVLR........... 192
26 -18.8003hdt_A mol:protein length:223 putative kinase  ali model follow..  12  12NKNLIITIE-YGSGGRIVGKKLAEELGIHFYDDDILKLASEKSAVGEQFFRLADEKAGNFQSEVMRELAESEPCIF-VGRAAGYVLDQDEDIERLIRIFVYTDKVKKVQRVMEVDC---IDEERAKRRIKKIEKERKEYYKYFTDLPINTTKLTLEETAELIKAYIRLK......... 219
27 -16.9003fdi_A mol:protein length:201 uncharacterized protein  ali model follow..  4MKQIIIAIG-FGSGGHLVAKKLAEHYNIPLYSKELLDEVAKDGRYSKEVLERFDEAIRQFNFIRKKANEEKESFVIVGRCAEEILSDNPNMIS----AFILGDKDTKTKRVMEREG---VDEKTALNMMKKMDKMRKVYHNFYCDICIKIGKVDVDTATDMIIKYIDSR......... 199
28 -15.2001ltq_A mol:protein length:301 POLYNUCLEOTIDE KINASE  ali model follow..  14  1MKKIILTIGCPGSGKSTWAREFIAKPGFYNINRDDYRQSIMAHEERD--EYKYTKKKEGIVTGMQFDTAKSILYGGDSVKGVIISDTNLNPERRLEHKVFDVPWTELVKRNSKRGTKAV-----PIDVLRSMYKS........................................... 142
29 -14.4002grj_A mol:protein length:192 Dephospho-CoA kinase  ali model follow..  10  9....IGVTGKIGTGKSTVCEILKNKYGAHVVNVDRIGHEVLEEVKEKLVELFGGSVLEDVNRKKLAGIVFESRENLKKLELLVMKKRVQEIINKTSGLIVIEAALLKRMGLDQLCDHVITVVASRETILKRNREADRRLKFQPQGIVVANNS-TLEDLEKKVEEVMKL.......... 180
30 -14.3001uky_A mol:protein length:203 URIDYLATE KINASE  ali model follow..  13  17...VIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYCIKEGQIVPQEITLALLRNAISDNVKANKHKDGFPRKMDQAISFERKFILFFDCPEDIMLERLGKTSGRSDDNIESIKKRFNTFKETSMPVFETKSKVVRVRCDRSVEDVYKDVQDAIRDS......... 202
31 -14.3003akc_A mol:protein length:208 Cytidylate kinase  ali model follow..  17  1MRGIVTIDGPSASGKSSVARRVAAALGVPYLSSGLLYRAAAFLALRAGVDPGDEARLPGVRAWVNRRLKEVPPPFVAEGGTAVFPEAAHK-------FYLTASPEVRAWRRARERPQAYEEVLRDLLRRDERDKAQSAPAPDA--LVLDTGGMTLDEVVAWVLAHIRR.......... 208
32 -14.2001tev_A mol:protein length:196 UMP-CMP kinase  ali model follow..  11  5...VVFVLGGPGAGKGTQCARIVEKYGYTHLSAGELLRDERKNPDSQYYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQADVSFVLFFDCNNEICIERCGKSSGRSDDNRESLEKRIQTYLQSTKPIYEEMGKVKKIDASKSVDEVFDEVVQIFDKE......... 195
33 -14.1003lw7_A mol:protein length:179 Adenylate kinase related protein (AdkA-like)  ali model follow..  12  4....ILITGMPGSGKSEFAKLLKE-RGAKVIVMSDVVRKRYSIE-KRLREIYGDGVVARLCVEELGTSNHDLVVFDGVRSLAEVEEFKRLLGDSVYIVAVHSPPKIRYKRMERLRSDDSKEISELIRRDREELKLGIGEVIAMADYIITNDS-NYEEFKRRCEEVTDR.......... 176
34 -13.9002h92_A mol:protein length:219 Cytidylate kinase  ali model follow..  20  5...NIALDGPAAAGKSTIAKRVASELSMIYVDTGAMYRALTYKYLKLNKTEDFAKLVDQTTLDLVRSFAVKKQKELAAEKGIVMDGRDIGTVDADLKVYMIASVEERAER-GIESNFEDLKRDIEARDQYDMNREISPLRKADDAVTLDTTGKSIEEVTDEILAMVSQIK........ 219
35 -13.7004E22 Entity 1(prereleased)  ali follow..  18  30....ITVDGPSGAGKGTLCKALAESLNWRLLDSGAIYRVLALAALHHQVDISTEEALVPLAAHLVREALLRRQRAFREAPGLIADGRDMGTIDAPVKIFLDASSQERAHR-GFNVNFERLLAEIQERDNRDRNRSVAPLVPAADALVLDSTSMSIEQVIEQALAYAQRILALPLK... 251
36 -13.7001g3u_A mol:protein length:214 THYMIDYLATE KINASE  ali model follow..  20  3....IAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAALFALD-----RAGAVHTIQGLCRGYDVVIL---AARLHENAAGKPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAWLVVGADVDPGRLAATLAPPDVP.......... 213
37 -13.6003r20_A mol:protein length:233 Cytidylate kinase  ali model follow..  22  12....VAVDGPAGTGKSSVSRGLARALGARYLDTGAMADLTDPAAIEKAAADAGEDVSSEIRGDAVTGLVDIQRKLATEGGRVVVEGRDIGTVDADVKIFLTASAEERARR-GLPDDYATVLADVQRRDHLDSTRPVSPLRAADDALVVDTSDMDQAQVIAHLLDLVTAQAGARR.... 233
38 -13.6003r8c_A mol:protein length:228 Cytidylate kinase  ali model follow..  24  7....VAVDGPSGTGKSSVAKELARQLGASYLDTGAMVDLTDPAAIAAATDQAGEDVSVPIRGNEVTGAVSAVSAVPAVRERLVRQQRELAESSGAVVIYLTASAQARAQR-GGDDEYEKVLADVQRRDHLDSTRAVSPLRPAEDALEVDTSDMTQEQVVAHLLDLVRTR......... 223
39 -13.5001qf9_A mol:protein length:194 PROTEIN (URIDYLMONOPHOSPHATE/CYTIDYLMONOPHOSP  ali model follow..  15  8...VVFVLGGPGSGKGTQCANIVRDFGWVHLSAGDLLRQEQGEMIATMIK-NGEIVPSIVTVKLLKNAIDANQGKNFLVDGFPRNEENNNSWEEKFVLFFDCPEEVMTQRLGESSGRSDDNIESIKKRFNTFNVQTKLVYNKFDKVKIIPANRDVNEVYNDVENLFKS.......... 191
40 -13.5002a2z_A mol:protein length:248 Deoxycytidine kinase  ali model follow..  10  27....ISIEGNIAAGKSTFVNILKQLCEDWEVVPEPV-NVQSTNVLQMMYEKPERWSFNGKLKDAEKPVLFFERSVYS------MNNQFGQSLELDGIIYLQATPETCLHRIYLRGRN---EQGIPLEYLEKLHYKHESWLLHRVPILTLDVNEDFKDKYESLVEKVKE.......... 243
41 -13.5003UMF Entity 1(prereleased)  ali follow..  13  25...VIFVLGGPGSGKGTQCEKLVQKFHFNHLSSGDLLRAEVGKELKAMMER--LEVVLALLKEAMIKLVDKNCHFLIDGYPRELDQGEKEVCPCLCVINFDVSEEVMRKRLAETSNRVDDNEETIVKRFRTFNELTKPVYKQQNKVITIDASGTVDAIFDKVNHELQK.......... 207
42 -13.4001ot3_A mol:protein length:250 Deoxyribonucleoside Kinase  ali model follow..  11  23....VLIEGNIGSGKTTYLNHFEKYKNDICLEPVEKWRNVNGVNLLELMYKDPKTMLQSHTAPTNKKLKIMERSIFS--RNGSLEQGMYNTLEEDLIIYLRTSPEVAYERIRQRARS---ESCVPLKYLQELHELHEDWLIHQADLNLENIGTEYQRSESSIFDAISSNQQPSPV... 238
43 -13.3002bwj_A mol:protein length:199 ADENYLATE KINASE 5  ali model follow..  18  14...IIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELSKLIRDIME-RGDLVPSGIVLELLKEAMVASL---GDTRGFLIDGYPREVKQGQLVICMDCSADTMTNRLSRSSLPVDDTTKTIAKRLEAYYRASIPVYETKTQLHKINAEGTPEDVFLQLCTAIDS.......... 196
44 -13.3002ocp_A mol:protein length:241 Deoxyguanosine kinase  ali model follow..  11  2.PRRLSIEGNIAVGKSTFVKLLTKTYPIQAAGNQKACTAQSLGNLLDMMYREPASRLKVQLEPFPEKLLQARKPVQIFERSVYLLWEFASRITLHGFIYLQASPQVCLKRLYQRARE---EKGIELAYLEQLHGQHEAWLIHKTTLDVNDDFSEEVTKQEDLMREVNT.......... 236
45 -13.3001q3t_A mol:protein length:236 Cytidylate kinase  ali model follow..  21  12...QIAIDGPASSGKSTVAKIIAKDFGFTYLDTGAMYRAATYMALKNQLGVEEVEALLALLDQHVREKLVSLQQEIAQQGGIVMDGRDIGTVQAELKIFLVASVDERAER-GIETDLETLKKEIAARDYKDSHRETSPLKQAEDAVYLDTTGLNIQEVVEKIKAEAEKR......... 229
46 -13.3001cke_A mol:protein length:227 PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)  ali model follow..  18  4IAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHHVDVASEDALVPLASHLVREALLRRQRAFRELPGLIADGRDMGTVDAPVKIFLDASSEERAHR-GFSVNFERLLAEIKERDDRDRNRAVAPLVPAADALVLDSTTLSIEQVIEKALQYARQK......... 223
47 -13.2002jas_A mol:protein length:206 DEOXYGUANOSINE KINASE  ali model follow..  15  4....IAIFGTVGAGKSTISAEISKKLGYEIFKMQIYMLTARSKQLKQAKNLENIIFDRTLLEDPIFMKVNYDLNNVDQTDYNTYIDFYNNVVLEDIVIYLRVSTKTAISRIKRGRSEELLIGEEYWETLNKNYEEFYKQNVYDFPFFVVDAELDVKTQIELIMNKLNS.......... 201
48 -13.1003a4l_A mol:protein length:260 L-seryl-tRNA(Sec) kinase  ali model follow..  16  7....IILTGLPGVGKSTFSKNLAKILSKNNIDV-IVLGSDLIRESFPVWKEKYEEFIKKSTYRLIDSALKNYWVIVD---DTNYYNSMRRDLIN-AIIYLKASLDVLIRRNIERGEK-------PNEVIKKMYEKFDE-WDEPFLIIDTTKDIDFNEIAKKLIEKSKEIPKFYVLEEN 183
49 -13.1003qeo_A mol:protein length:279 Deoxycytidine kinase  ali model follow..  12  37....ISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVMEQKNGGNVLQMMYEKPESMIRAQLASLNGKLKDAEKPVLFFERSVYMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRN---EQGIPLEYLEKLHYKHESWLLHRVPILTLDVNEDFKDKYESLVEKVKE.......... 268
50 -13.1002qrn_A mol:protein length:280 Deoxycytidine kinase  ali model follow..  11  38....ISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVMSQKNGGNVLQMMYEKPESRIRAQLASLNGKLKDAEKPVLFFERSVYMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRN---EQGIPLEYLEKLHYKHESWLLHRVPILTLDVNEDFKDKYESLVEKVKE.......... 269
51 -13.0003adb_A mol:protein length:259 L-seryl-tRNA(Sec) kinase  ali model follow..  14  8....IILTGLPGVGKSTFSKNLAKILSKNNIDV-IVLGSDLIRESFPVWKEKYEEFIKKSTYRLIDSALKNYWVIVDD-----LINIAKKYNKNYAIIYLKASLDVLIRRNIERGEK-------PNEVIKKMYEKFDE-WDEPFLIIDTTKDIDFNEIAKKLIEKSKEIPKFYVLEEN 184
52 -13.0002no0_A mol:protein length:280 Deoxycytidine kinase  ali model follow..  11  38....ISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVMSQKNGGNVLQMMYEKPESRIRAQLASLNGKLKDAEKPVLFFERSVYMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRN---EQGIPLEYLEKLHYKHESWLLHRVPILTLDVNEDFKDKYESLVEKVKE.......... 269
53 -13.0001z83_A mol:protein length:196 Adenylate kinase 1  ali model follow..  17  11...IIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVGKKLSEIME-KGQLVPLETVLDMLRDAMVAKV---NTSKGFLIDGYPREVQQGTLLLYVDAGPETMTQRLGETSGRVDDNEETIKKRLETYYKATEPVYEKRGIVRKVNAEGSVDSVFSQVCTHLDA.......... 193
54 -12.8001rz3_A mol:protein length:201 hypothetical protein RBSTP0775  ali model follow..  18  25....LGIDGLSRSGKTTLANQLSQTLRVCVFHMDDHIVERAKRYHTGNEEWFEYYYVEWLTHQLFRQLKASHQLMIMIEGVFLQRKEWRPFFD--FVVYLDCPREIRFARENDQVKQNIQKFINRYWKAEDYYLETEE--IKRADVVFDMTS.......................... 201
55 -12.8002ar7_A mol:protein length:246 Adenylate kinase 4  ali model follow..  18  23...RAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKDLVISLNIPFETLKDRLSRRTGEPLVQQEDDAARLRQYKDVAKPVLYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEA 238
56 -12.7003adk_A mol:protein length:195 ADENYLATE KINASE  ali model follow..  17  11...IIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVGKMLSEIME-KGQLVPLETVLDMLRDAMVAKV---DTSKGFLIDGYPREVKQGTLLLYVDAGPETMTKRLGETSGRVDDNEETIKKRLETYYKATEPVYEKRGIVRKVNAEGSVDDVFSQVCTHLDT.......... 193
57 -12.6001zd8_A mol:protein length:227 GTP:AMP phosphotransferase mitochondrial  ali model follow..  18  9...RAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEKAFIDQGKLIPDDVMTRLALHELKNQYSWLLDG--LPQAEALDRAYQIDTVINLNVPFEVIKQRLTARTGEPLIQREDDIKRLKAYEDQTKPVYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKAS 224
58 -12.6002ak3_A mol:protein length:226 ADENYLATE KINASE ISOENZYME-3  ali model follow..  20  8...RAAIMGAPGSGKGTVSSRITKHFELKHLSSGDLLRDNMLRGTEKTFIDQGKLIPDDVMTRLVLHELKNQYNWLLDG--LPQAEALDRAYQIDTVINLNVPFEVIKQRLTARTGEPLVQREDDVKRLKAYEAQTEPVYYRKKGVLETFSGTETNKIWPHVYAFLQTKLPQRSQETS 223
59 -12.5003a8t_A mol:protein length:339 Adenylate isopentenyltransferase  ali model follow..  16  34.EKLLVLMGATGTGKSRLSIDLAAHFPLEVINSDK-MQVYKGLDITTNKISVPDADFRSLAGKAVSEITGRRKLPVLVGGSNSFSVVSSELRYDCCFLWVDVSVKVLTDYLAKRVDDMLELG---------MFDELAEFYSP.................................... 207
60 -12.4001zak_A mol:protein length:222 ADENYLATE KINASE  ali model follow..  17  7...KVMISGAPASGKGTQCELIKTKYQLAHISAGDLLRAEIAAGSEKEFMEKGQLVPDEIVVNMVKERLRQPD---AQENGWLLDGYPRSYIRPDTFILLDVPDELLVERVVGRRLDPLTQRFDDTE---EKVKLRLETYYQNIESLLSQGDATVDAVFAKIDELLGSILEKKNEMVS 220
61 -12.4002qg6_A mol:protein length:199 Nicotinamide riboside kinase 1  ali model follow..  13  1MKTFIIISGVTNSGKTTLAKNLQKHLNCSVISQDDFFKPESEIETDK----NGFLQYDVLEASAISCWMESARHILIIEGFLLFNYKPLDTIWN-RSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEVYEDLIQELAKQKCLQVTA.. 199
62 -12.3003hp1_A mol:protein length:280 Deoxycytidine kinase  ali model follow..  11  38....ISIEGNIAAGKSTFVNILKQLCEDWEVVPEPV-QKNGGNVLQMMYEKPERWSFNGKLKDAEKPVLFFERSVYS----DWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRN---EQGIPLEYLEKLHYKHESWLLHRVPILTLDVNEDFKDKYESLVEKVKE.......... 269
63 -12.3002rgx_A mol:protein length:206 Adenylate kinase  ali model follow..  20  2...ILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPKEYMERGELVPDDLIIALIEEVFPKHGNVIFDGAEALDEMLEKKGLKVDHVLLFEVPDEVVIERLSGRRGVKVIQREDDKKRLEVYREQTAPLYKKKGILRIIDASKPVEEVYRQVLEVIGD.......... 204
64 -12.3003SR0 Entity 1(prereleased)  ali follow..  20  2...ILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTPKEYMERGELVPDDLIIALIEEVFPKHGNVIFDGAEALDEMLEKKGLKVDHVLLFEVPDEVVIERLSGRRGVKVIQREDDKKRLEVYREQTAPLYKKKGILRIIDASKPVEEVYRQVLEVIGD.......... 204
65 -12.2001uf9_A mol:protein length:203 TT1252 protein  ali model follow..  20  11....IGITGNIGSGKSTVAALLRS-WGYPVLDLDALAARARENKEEELKRLFPEAVV-RLDRRALARLVFSDPERLKA--EAVVHPEVRRLLMEHGTLLVAAPLEERVRRV---MARSGLSREEVLARERAQMPEEEKR--KRATWVLENTGEDLERALKAVLAELTGGATEGRG... 203
66 -12.2003ndp_A mol:protein length:231 Adenylate kinase isoenzyme 4  ali model follow..  18  7...RAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKDLVISLNIPFETLKDRLSRRTGEPLVQQEDDAARPRQYKDVAKPVLYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEA 222
67 -12.1003c8u_A mol:protein length:208 Fructokinase  ali model follow..  19  25....VALSGAPGSGKSTLSNPLAAALSAEVVPMDGFHLDNRLLEPRGLLPRKGAPETFDFEGRLCHALKHQERVAIIEGNYLLFDAPGWRDLTADVSIRLEVPMADLEARL----QRWLDHGLNHDAAVARAQGNDLANARAIADLTWPQ............................ 207
68 -12.1002p0e_A mol:protein length:207 Nicotinamide riboside kinase 1  ali model follow..  14  11RGSKTFIIGISGSGKTTLAKNLQKHLNCSVISQDDFFKPESEIETDK----NGFLQYDVLEALNMEKMMSEEIPILIIEGFLLFNYKPLDTIWN-RSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTSEEDLFLQVYEDLIQ.......... 199
69 -12.1001n3b_A mol:protein length:216 Dephospho-CoA kinase  ali model follow..  18  1MRYIVALTGGIGSGKSTVANAFAD-LGINVIDADRQVVEPGAPALHAIADHFGANMIAAIQQETQHQIQQATSPYVLWVVPLLVENSLYKKANR--VLVVDVSPETQLKRT---MQRDDVTREHVEQILAAQATREARL--AVADDVIDNNG-APDAIASDVARLHAH.......... 192
70 -12.0003cm0_A mol:protein length:186 Adenylate kinase  ali model follow..  21  3VGQAVIFLGPPGAGKGTQASRLAQELGFKKLSTGDILRDHVGERVRPIMER-GDLVPDDLILELIREELAERVIFDGFPRTLAQAEALDRLLSELGVVLVEVPEEELVRRILRRAERSDDNEETVRRRLEVYREKTEPLYEARGVLKRVDGLGTPDEVYARIRAAL............ 184
71 -12.0001vhl_A mol:protein length:218 Dephospho-CoA kinase  ali model follow..  15  3LRYIVALTGGIGSGKSTVANAFAD-LGINVIDADI---------IARQVVEPGAPALHAIADHFGANMIAADGTL-ALRERIFANPEEKNWLNALLHPLIQQETQHQIQQATSP---PLLVENSLYKKANRVLVVDVSPETQLKRT-MQRDDVTREHVEQILAAQATREARLAVAD.. 172
72 -12.0002pey_A mol:protein length:179 Bifunctional 3`-phosphoadenosine 5`-phosphosu  ali model follow..  19  8....VWLTGLSGAGKTTVSMALEEYLPCYTLDGDN-IRQGLNKNLGFSPEDREENVRRIAE---VAKLFADAGLVCITS-----RNNARQIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKA-RAGEIKGFTGIDSEYEKEAPELVLKTDSCDVNDCVQQVVELLQERD........ 177
73 -12.0002ze5_A mol:protein length:253 Isopentenyl transferase  ali model follow..  15  4....HLIYGPTCSGKTDMAIQIAQETGWPVVALDRQIATGSGRPLESLTEGILDAESAHRRLIFEVDWRKSEEGLILEGG---------------SISLLNCMAKSPFWRSGFQWHVKRLRLGDSDAFLTRAKQRVAEMFAI.................................... 145
74 -12.0002cdn_A mol:protein length:201 ADENYLATE KINASE  ali model follow..  16  16...RVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKKRYLDAGD-----VPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKAVLEFRVSEEVLLERLKG-RGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVDAGTMDEVFARALRALGK.......... 195
75 -12.0002yvu_A mol:protein length:186 Probable adenylyl-sulfate kinase  ali model follow..  20  16....VWLTGLPGSGKTTIATRLADLLRVEVLDGDW-ARTTVSEGAGFTREERLRHLKRIAW---IARLLARNGVIVICS-----RNMVRRIVEEEGIPFLEIYVKASLEEVIRRDPKGLYKKA-LKGELENFTGITDP-YEENPQLVLDTESNTIEHNVSYLYSLVKAV......... 184

FFAS is supported by the NIH grant R01-GM087218-01
6 0 2 4 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.