current user: public




Query: 2iyq_A mol:protein length:184 SHIKIMATE KINASE, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst MAPKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPSPSEAATLELast
1 -90.9002iyq_A mol:protein length:184 SHIKIMATE KINASE  ali model  100  1MAPKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPSPSEAATLE 178
2 -80.8004y0a_A mol:protein length:179 Shikimate kinase  ali model follow..  37  7TLPNIYLVGPMGAGKTTVGRHLAELLGREFLDSDHEIERKTGATIPWIFEKEGEVGFRTRETVVLNELTSRKALVLATGGGAITQAPNREFLKRGIVVYLYTPVELQLQRTYRDKNRPLLQVENPEQKLRDLLKIRDPLYREVAHYTIETNQGAARDLAQKILQLILS.......... 175
3 -78.2003trf_A mol:protein length:185 Shikimate kinase  ali model follow..  33  4NLTNIYLIGLMGAGKTSVGSQLAKLTKRILYDSDKEIEKRTGADIAWIFEMEGEAGFRRREREMIEALCKLDNIILATGGGVVLDEKNRQQISTGVVIYLTASIDTQLKRIGQEMRRPLFIKNNSKEKLQQLNEIRKPLYQAMADLVYPTDDLNPRQLATQILVDIKQ.......... 174
4 -78.1001kag_A mol:protein length:173 Shikimate kinase I  ali model follow..  36  4.KRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRTGADVGWVFDLEGEEGFRDREEKVINELTEKQGIVLATGGGSVKSRETRNRLSRGVVVYLETTIEKQLARTQRDKKRPLLHVETPREVLEALANERNPLYEEIADVTIRTDDQSAKVVANQIIHMLESN......... 173
5 -72.3001e6c_A mol:protein length:173 SHIKIMATE KINASE  ali model follow..  33  1MTEPIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHTSGMTVADVVAAEGWPGFRRRESEALQAVATP-NRVVATGGGMVLLEQNRQFMRAGTVVYLFAPAEELALRLQASHQRPTLTGRPIAEEMEAVLREREALYQDVAHYVVDAT-QPPAAIVCELMQTMRLPAA....... 173
6 -72.2001shk_A mol:protein length:173 SHIKIMATE KINASE  ali model follow..  34  1MTEPIFMVGARGCGKTTVGRELARALGYEFVDTDIFMQHTSGMTVADVVAAEGWPGFRRRESEALQAVATP-NRVVATGGGMVLLEQNRQFMRAGTVVYLFAPAEELALRLQQAHQRPTLTGRPIAEEMEAVLREREALYQDVAHYVVDAT-QPPAAIVCELMQTMRLPAA....... 173
7 -69.4002pt5_A mol:protein length:168 Shikimate kinase  ali model follow..  29  2...RIYLIGFMCSGKSTVGSLLSRSLNIPFYDVDEEVQKREGLSIPQIFEKKGEAYFRKLEFEVLKDLSEKENVVISTGGGLGANEEALNFMKSGTTVFIDIPFEVFLERCKDSKERPLLK--RPLDEIKNLFEERRKIYSK-ADIKVKGE-KPPEEVVKEILLSLEGN......... 164
8 -67.8001via_A mol:protein length:175 shikimate kinase  ali model follow..  26  3LAKNIVFIGFMGSGKSTLARALAKDLDLVFLDSDFLIEQKFNQKVSEIFEQKRENFFREQEQKMADFFSSCEKACIATGGGFV---NVSNLEKAGFCIYLKADFEYLKKRLDKDEKRPLFYDEI---KAKKLYNERLSKYEQKANFILNIENKNIDELLSEIKKVIKEGGS....... 169
9 -66.0004loa_A mol:protein length:173 De-novo design amidase  ali model follow..  21  3LAKNIVFIGESGSGKSTLARALAKDLDLVFLDSDFLIEQKFNQKASEIWEQYGWNFALEQEQKMADFFSSCEKACIATSGSFVNVSNLEKA---GFCIYLKADFEYLKKRLDKDSKFPLFSDEI---KWKKHYNETLSKYEQKANFILNIENKNIDELLSEIKKVIKLE......... 167
10 -64.7003vaa_A mol:protein length:199 Shikimate kinase  ali model follow..  26  18AMVRIFLTGYMGAGKTTLGKAFARKLNVPFIDLDWYIEERFHKTVGELFTERGEAGFRELERNMLHEVAEFENVVISTGGGAPCFYDNMEFMRTGKTVFLNVHPDVLFRRLRIAKQRPILQGKEDMDFIIQALEKRAPFYTQ-AQYIFNADELEDRWQIESSVQRLQE.......... 189
11 -64.5001zuh_A mol:protein length:168 Shikimate kinase  ali model follow..  30  3...HLVLIGFMGSGKSSLAQELGLALKLEVLDTDMIISERVGLSVREIFEELGEDNFRMFEKNLIDELKTKTPHVISTGGGIVMHENLKGL---GTTFYLKMDFETLIKRLNQKEKRPLLN---NLTQAKELFEKRQALYEKNASFIIDARG-GLNNSLKQVLQFI............ 161
12 -64.4003n2e_A mol:protein length:168 Shikimate kinase  ali model follow..  29  3...HLVLIGFMGSGKSSLAQELGLALKLEVLDTDMIISERVGLSVREIFEELGEDNFRMFEKNLIDELKTKTPHVISTGGGIVMHENLKGL---GTTFYLKMDFETLIKRLNQKAKRPLLN---NLTQAKELFEKRQALYEKNASFIIDARG-GLNNSLKQVLQFIALQ......... 164
13 -59.4003nwj_A mol:protein length:250 AtSK2  ali model follow..  28  48.GRSMYLVGMMGSGKTTVGKIMARSLGYTFFDCDTLIEQAMGTSVAEIFEHFGESVFREKETEALKKLSLMYHVVVSTGGGAVIRPINWKYMHKGISIWLDVPLEALAHRIAATGSRPLLHDDESGDRLSTIWDARGEAYTK-ASARVSLENITLKLGYRSVSDLTPA.......... 224
14 -41.2003iij_A mol:protein length:180 Coilin-interacting nuclear ATPase protein  ali model follow..  14  12..PNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREE---QLYDGYDEEYDCPILDEDRDELDNQMREGGVIVDYHGCDFFPERWFHI-----VFVLRTDTNVLYERLETRGYNEKKLTDNQCEIFQVLYEEATASYKE--EIVHQLPSNKPEELENNVDQILK........... 169
15 -35.3004cvn_A mol:protein length:191 PUTATIVE ADENYLATE KINASE  ali model follow..  18  4MGMLIAITGTPGVGKTTIAKLLAEKLGYEYVNLRDFALE------------KGCGREVDGEVEVEIDELAYFVEKELKDRNVVLDGHLSHLMPVDLVVVLRAHPRIIGERLERGYSKEKIGENVEAELVDAILIEAIDEHE--NVIEVDTTNKTPEEIVEEIIGLIKSGVKRRVGIVD 168
16 -24.7002vli_A mol:protein length:183 ANTIBIOTIC RESISTANCE PROTEIN  ali model follow..  12  3MRSPIIWIGPFGVGKTHTAHTLHERLGSFVFEPEEMGQALRKLTPGFSGDPQEHPMWIPLMLDALQYASREAAGPLIVPVSISDTARHRRLMSG-HHFTLIAPLNVVLER--------LRRDGQPQVNVGTVEDRLNELRGEQFQTHIDTAGLGTQQVAEQIAAQVGLTLAPPPQGA. 180
17 -22.5004eun_A mol:protein length:200 thermoresistant glucokinase  ali model follow..  17  23.TRHVVVMGVSGSGKTTIAHGVADETGLEFAEADA--TMQRGIPLTD---EDRWPWLRSLAEWMDARADAGVSTIITC---SALKRTYRDVLREGDFLHLDGPAEVIKGRMSKREGHFM-----PASLLQSQLATLEALEPDESGIVLDLRQ-PPEQLIERALTWLDIAPAVAT.... 193
18 -21.9002axp_A mol:protein length:173 hypothetical protein BSU20280  ali model follow..  13  2..TLIILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGNEFNKLADEDNVIIDRFVYSNLVYAKKFKDYSILTE---RQLRFIEDKIKAKAKVVYLHADPSVIKKRLRVRGDEYI-----EGKDIDSILELYREVMSNAG-YSWDTGQWSSDEIAKDIIFLVELE......... 167
19 -21.6001knq_A mol:protein length:175 Gluconate kinase  ali model follow..  14  11....YVLMGVSGSGKSAVASEVAHQLHAAFLDGDNIEKMASGEPLND---DDRKPWLQALNDAAFAMQRTNKVSLIVC---SALKKHYRDLLREGSFIYLKGDFDVIESRLKARKGHFF-----KTQMLVTQFETLQEPGADETDVLVVDIDQPLEGVVASTIEVIKKGK........ 175
20 -21.1001zp6_A mol:protein length:191 hypothetical protein Atu3015  ali model follow..  18  12....LLLSGHPGSGKSTIAEALANLPGVPHFHSDDLWGYIKHGRID-----PWLPQSHQQNRMIMQIAADVAGRYAKEGYFVILDPAFTALARPLHYIVLRTTAAEAIERCLDRGGDSLSDPLVVADLHSQFADLGAF-----EHHVLPVSGKDTDQALQSAINALQSGRFRIDASLE 185
21 -21.0003t61_A mol:protein length:202 Gluconokinase  ali model follow..  19  18.PGSIVVMGVSGSGKSSVGEAIAEACGYPFIEGDA--KMSEGIPLTD----------RWPWLAAIGERLASREPVVVS---SALKRSYRDKLRESAFVFLHGSESVLAERMHHRTGHFM-----PSSLLQTQLETLEDPRGEVRTVAVDVAQ-PLAEIVREALAGLARLAENLYFQS. 188
22 -20.3001grq_A mol:protein length:178 CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE  ali model follow..  16  1MTTRMIILGGSSAGKSGIVRCLQSVLPEPWFGVDSLIEKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDERWRSFVGDLDVVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHE---------GVEYDVEVDTTHKESIECAWAIAAHV............ 176
23 -19.9002rhm_A mol:protein length:193 Putative kinase  ali model follow..  20  3QTPALIIVGHPATGKTTLSQALATGLRLPLLSKDAFKEV-----MFDGLGWSDREWSRRVGATAIMMLYHTAATILQSGQSLIMEDLDTERMQN-IQIRCVASGDVLVERILSQGARHPGHCDDRSPADLELVRSRPPLPLGGPLLTVDTTF-PEQIDMNAIVQWVRQHLQSGTA... 191
24 -19.5001ki9_A mol:protein length:192 adenylate kinase  ali model follow..  14  1MKNKLVVVGVPGVGGTTITQKAMEKLSEEGINYKMV---NFGTVMFEVAQEENQKRIQKLAGRKIAEMVKESPVVVPKGYLPGLPVWVLNELNPDIIIVVETSGDEILIRRLNDETR---RDLETTAGIEEHQIMNRAAAMTYGVKIIQNKNNLLDYAVEELISVLR........... 192
25 -19.1001nks_A mol:protein length:194 ADENYLATE KINASE  ali model follow..  15  4....GIVTGIPGVGKSTVLAKVKEILDNQGINNKI----NYGDFMLATALKLGKKLQIDAAKGIAEEARAGGEGYLFIDTHAVIRTPSGYLINPSVIFLLEADPKIILSRQKRDTTR-----NRNDYSDESVILETINFARYAATKVIVNVEGDPSIAANEIIRSMK........... 194
26 -18.9002bdt_A mol:protein length:189 BH3686  ali model follow..  17  1MKKLYIITGPAGVGKSTTCKRLAAQLDNSYIEGDIINHMVVGGYRPPWESDELLALTWKNITDLTVNFLLAQNDVVLDY---IAFPDEAEALAQTVFIILWTNREELLRRDA-LRKKDEQMGERCLELVEEFES-----KGIDERYFYNTSHLQPTNLNDIVKNLKTNPR........ 172
27 -18.9001kht_A mol:protein length:192 adenylate kinase  ali model follow..  13  1MKNKVVVVGVPGVGSTTSSQLAMDNLRKEGVNYKMV---SFGSVMFEVAKEENQKRIQKMAGRKIAEMAKESPVAVPKGYLPGLPSWVLNELNPDLIIVVETTGDEILMRRMSDETRV--RDLDTASTIEQHQFMNRCAAMSYGVKIVQNRNGLLDQAVEELTNVLR........... 192
28 -18.3003h86_B mol:protein length:192 Adenylate kinase  ali model follow..  13  1MKNKVVVVGVPGVGGTTVTQKAMDILNYKMVNFGSAMFDVANEE----LDPETQKRIQKMAGRKIAEMAKESPVAVPKGYLPGLPAWVLTELNPDIVIVVETDGDEILMRRLSDESR---RDLETTASIEEHQFMNRAAAMSYGVKIVKNKNGLVDNAVEELMSVLR........... 192
29 -18.0001y63_A mol:protein length:184 Lmaj004144AAA protein  ali model follow..  16  10.GINILITGTPGTGKTSMAEMIAAELGFQHLEVGKLVKEN-----HFYTEYDTELDTHIIEEKDEDRLLDFMEPIMVSRGNHVVDYHSSELFPEHMVVVLHTSTEVLFERLKRQYSEAKRAENMEAEIQCICEEEARDAYED--DIVLVRENDTLEQMAATVEEIRE........... 173
30 -15.9003hdt_A mol:protein length:223 putative kinase  ali model follow..  13  12NKNLIITIEREGSGGRIVGKKLAEELGIHFYDDDKLASEKSAVG-EQFFRLADEENLFKFQSEVMRELAESEPCIF-VGRAAGYVLDQDEDIERLIRIFVYTDKVKKVQRVMEVDC---IDEERAKRRIKKIEKERKEYYKYFTDLPINTTKLTLEETAELIKAYIRLK......... 219
31 -15.0003akc_A mol:protein length:208 Cytidylate kinase  ali model follow..  18  1MRGIVTIDGPSASGKSSVARRVAAALGVPYLSSGLLYRAAAFLALRAGVDPGDEEGLLALLEGLGVRLLAQAEGNRVLADGEDLTSFLHKEVPPPFVFYLTASPEVRAWRRARERPQAYEEVLRDLLRRDERDKAQSAPAPDA--LVLDTGGMTLDEVVAWVLAHIR........... 207
32 -14.6003a4l_A mol:protein length:260 L-seryl-tRNA(Sec) kinase  ali model follow..  17  7....IILTGLPGVGKSTFSKNLAKILSKNNIDV-IVLGSDLIRESFPVWKEKYEEFIKKSTYRLIDSALKNYWVIV---DDTNYYNSMRRDLKNYAIIYLKASLDVLIRRNIERGEK-------PNEVIKKMYEKFDE-WDEPFLIIDTTKDIDFNEIAKKLIEK............. 170
33 -14.6004e22_A mol:protein length:252 Cytidylate kinase  ali model follow..  21  26IAPVITVDGPSGAGKGTLCKALAESLNWRLLDSGAIYRVLAGEDVSNEIRTEGNTASQAAAFPRVREALLRRQRAFREAPGLIADGRDMGTIDAPVKIFLDASSQERAHRRGFNVNFERLLAEIQERDNRDRNRSVAPLVPAADALVLDSTSMSIEQVIEQALAYAQRI......... 245
34 -14.6003r20_A mol:protein length:233 Cytidylate kinase  ali model follow..  24  11...VVAVDGPAGTGKSSVSRGLARALGARYLDTDAEIGVGSDPDVDAAF-LAGEDVSSEIRGDAVTRLVDIQRKLATEGGRVVVEGRTVVLPDADVKIFLTASAEERARRNGLPDDYATVLADVQRRDHLDSTRPVSPLRAADDALVVDTSDMDQAQVIAHLLDLVTAQ......... 228
35 -14.5001cke_A mol:protein length:227 PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)  ali model follow..  19  4IAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLAGEDVSGEIRTQANAASQVAAFPRVREALLRRQRAFRELPGLIADGRDMGTVDAPVKIFLDASSEERAHRKGFSVNFERLLAEIKERDDRDRNRAVAPLVPAADALVLDSTTLSIEQVIEKALQYARQK......... 223
36 -14.3003adb_A mol:protein length:259 L-seryl-tRNA(Sec) kinase  ali model follow..  18  8....IILTGLPGVGKSTFSKNLAKILDVIVLGSDLIRESFP------VWKEKYEEFIKKSTYRLIDSALKNYWVIV---DDTNYYNSMRRDLKNYAIIYLKASLDVLIRRNIERGEK-------PNEVIKKMYEKFDE-WDEPFLIIDTTKDIDFNEIAKKLIEKS............ 172
37 -14.2001q3t_A mol:protein length:236 Cytidylate kinase  ali model follow..  24  12...QIAIDGPASSGKSTVAKIIAKDFGFTYLDTGAMYRAATGDQLVFVGDVDITHPIRENEVTEVREKLVSLQQEIAQQGGIVMDGRTVVLPQAELKIFLVASVDERAER-GIETDLETLKKEIAARDYKDSHRETSPLKQAEDAVYLDTTGLNIQEVVEKIKAEAEKR......... 229
38 -14.2002ze5_A mol:protein length:253 Isopentenyl transferase  ali model follow..  14  4....HLIYGPTCSGKTDMAIQIAQETGWPVVALDRQIATGSGRPLESLTEGILDAESAHRRLIFEVDWRKSEEGLILEGG---------------SISLLNCMAKSPFWRSGFQWHVKRLRLGDSDAFLTRAKQRRPSLLEELAELWNYPAARPILEDIDGYRCAIR........... 180
39 -14.2002h92_A mol:protein length:219 Cytidylate kinase  ali model follow..  21  5...NIALDGPAAAGKSTIAKRVASELSMIYVDTGAMYRALTYKYLKLLDNEDVTDFLRNNDVTQHVSYVASKEPVLAAEKGIVMDGRTVVLPDADLKVYMIASVEERAER-GIESNFEDLKRDIEARDQYDMNREISPLRKADDAVTLDTTGKSIEEVTDEILAMVS........... 216
40 -14.2003fdi_A mol:protein length:201 uncharacterized protein  ali model follow..  4MKQIIIAIG--GSGGHLVAKKLAEHYNIPLYSKEDEVAKDGRYS-KEVLERFDEQDIAIRQFNFIRKKANEEKVIVGRCAEEILSDNPNMI------AFILGDKDTKTKRVMEREG---VDEKTALNMMKKMDKMRKVYHNFYCDICIKIGKVDVDTATDMIIKYIDSR......... 199
41 -14.1003r8c_A mol:protein length:228 Cytidylate kinase  ali model follow..  22  6...VVAVDGPSGTGKSSVAKELARQLGASYLDTGAMYRIVTGEDVSVVSAVSAVPAVRERLVRQQRELAESSGAVVVEGGTVVLPDADVK-------IYLTASAQARAQRGGGDDEYEKVLADVQRRDHLDSTRAVSPLRPAEDALEVDTSDMTQEQVVAHLLDLVRTR......... 223
42 -13.6004xrp_A mol:protein length:312 Pnkp1  ali model follow..  20  10FPKLLILVGAPGSGKSTFARYFIRT-NWVRVNRDDFRLMQFG---DSLMSPFYEERITKMVEASVIALLKNRTNVII--DATNSSLRSLQDMVH-SFKVFDLPVEELVKR---CDKRC............................................................ 127
43 -13.6001qf9_A mol:protein length:194 PROTEIN (URIDYLMONOPHOSPHATE/CYTIDYLMONOPHOSP  ali model follow..  15  8...VVFVLGGPGSGKGTQCANIVRDFGWVHLSAGDLLEQQSGSKDGEMMIKNGEIVPSIVTVKLLKNAIDANQGKNFLVDGFPRNEENNNSWEEKFVLFFDCPEEVMTQRLGESSGRSDDNIESIKKRFNTFNVQTKLVYNKFDKVKIIPANRDVNEVYNDVENLFKS.......... 191
44 -13.3003umf_A mol:protein length:217 Adenylate kinase  ali model follow..  16  26....IFVLGGPGSGKGTQCEKLVQKFHFNHLSSGDLLEVQSGSPKGKEMMERGELVPLEVVLALLKEAMIKNCHFLIDGYPRELDQGEKEVCPCLCVINFDVSEEVMRKRLAETSNRVDDNEETIVKRFRTFNELTKPVYKQQNKVITIDASGTVDAIFDKVNHELQK.......... 207
45 -13.2001uky_A mol:protein length:203 URIDYLATE KINASE  ali model follow..  14  18....IFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYCIKEGEITLALLRNAISDNVKANKHKFLIDGFPRKMDQAERDIVESKFILFFDCPEDIMLERLGKTSGRSDDNIESIKKRFNTFKETSMPVFETKSKVVRVRCDRSVEDVYKDVQDAIRD.......... 201
46 -13.1002rgx_A mol:protein length:206 Adenylate kinase  ali model follow..  20  2...ILVFLGPPGAGKGTQAKRLAKEKGFVHISTGDILREAVQKGTAKEYMERGELVPDDLIIALIEEVFPKHGNVIFDGAEALDEMLEKKGLKVDHVLLFEVPDEVVIERLSGRRGVKVIQREDDKKRLEVYREQTAPLYKKKGILRIIDASKPVEEVYRQVLEVIG........... 203
47 -13.0005cb6_A mol:protein length:197 Probable adenylyl-sulfate kinase  ali model follow..  19  22....IWLTGLSGAGKTTITHALEKKLRLEVLDGDV-VRTNLTKGL----------GFSKEDRDTNIRRIGFVSHLLTRNGVIVLRQEVKHTIGDFLEVFVNAPLAVCEERDVKG-----LYAKARSGEIKGFTGIDDP-YEP-PDVECRTDLEELDESVGKIWQKLVDLK........ 187
48 -13.0001z83_A mol:protein length:196 Adenylate kinase 1  ali model follow..  16  11...IIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGTLLLYVDAGPETMTQRLGETSGRVDDNEETIKKRLETYYKATEPVYEKRGIVRKVNAEGSVDSVFSQVCTHLDA.......... 193
49 -12.9002bwj_A mol:protein length:199 ADENYLATE KINASE 5  ali model follow..  17  15....IFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLELASESERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGQLVICMDCSADTMTNRLSRSSLPVDDTTKTIAKRLEAYYRASIPVYETKTQLHKINAEGTPEDVFLQLCTAIDS.......... 196
50 -12.8002cdn_A mol:protein length:201 ADENYLATE KINASE  ali model follow..  16  16...RVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTK--YLDAGDLVPSDLTNELVDDRLNNPD----AANGFILDGYPRSVEQAKAVLEFRVSEEVLLERL-KGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVDAGTMDEVFARALRALGK.......... 195
51 -12.6003adk_A mol:protein length:195 ADENYLATE KINASE  ali model follow..  18  11...IIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLEVSSGSARGKMIMEKGQLVPLETVLDMLRDAMVAKKGFLIDGYPREVKQGERKIGQPTLLLYVDAGPETMTKRLGETSGRVDDNEETIKKRLETYYKATEPVYEKRGIVRKVNAEGSVDDVFSQVCTHLDT.......... 193
52 -12.6002yvu_A mol:protein length:186 Probable adenylyl-sulfate kinase  ali model follow..  22  16....VWLTGLPGSGKTTIATRLADLLRVEVLDGDW-ARTTVSEGA----------GFTREERLRHLKRIAWIARLLARNGVIVIRNMVRRIVEEEGIPFLEIYVKASLEEVIRRDPKGLYKKA-LKGELENFTGITDP-YEENPQLVLDTESNTIEHNVSYLYSLVKAV......... 184
53 -12.6002grj_A mol:protein length:192 Dephospho-CoA kinase  ali model follow..  11  9....IGVTGKIGTGKSTVCEILKNKYGAHVVNVDRIGHEVLEEVKEKLVELFGGSVLRKKLAGIVFESRENLKKLELLVHPLMKKRVQEIINKTSGLIVIEAAL----MGLDQLCDHVITVVASRETILKRNREADRRLKFQEQGIVVANNSEDLEKKVEEVMKLVWEKR........ 185
54 -12.5001tev_A mol:protein length:196 UMP-CMP kinase  ali model follow..  11  6....VFVLGGPGAGKGTQCARIVEKYGYTHLSAGELLRDERKNPDSQYYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQADVSFVLFFDCNNEICIERCGKSSGRSDDNRESLEKRIQTYLQSTKPIYEEMGKVKKIDASKSVDEVFDEVVQIFDK.......... 194
55 -12.5003cm0_A mol:protein length:186 Adenylate kinase  ali model follow..  20  3VGQAVIFLGPPGAGKGTQASRLAQELGFKKLSTGDILRDHVARGTPRPIMERGDLVPDDLILELIREELAERVIFDGFPRTLAQAEALDRLLSELGVVLVEVPEEELVRRIAELEGRSDDNEETVRRRLEVYREKTEPLYEARGVLKRVDGLGTPDEVYARIRAALGI.......... 186
56 -12.4004mde_A mol:protein length:171 Metallophosphoesterase  ali model follow..  16  12....VVLIGSSGSGKSTFAKKHFKPTEVISSNF----------------LVSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNRKPLIE-VAVVFNLPEKVCQERNKNRTDRQV------RKHTQQMKKSIKGLQRE.................................... 148
57 -12.4002ged_A mol:protein length:193 Signal recognition particle receptor beta sub  ali model follow..  10  48.QPSIIIAGPQNSGKTSLLTLLTTDSVRPTVVSQEPLSAADYDGSGTLVDFPGHVKLRYKLSDYLKTRAKFVKGLIFMVDSTVDPKKLTTTAEFLVDILSITESSCE-------NGIDILIACNKSELFTARPPSKDALESEIQKVI............................... 189
58 -12.3004gp6_A mol:protein length:171 Metallophosphoesterase  ali model follow..  18  12....VVLIGSSGSGKSTFAKKHFKPTEVISSDF----------------LVSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNRKPLIE-VAVVFNLPEKVCQERNKNRTDRQV------RKHTQQLKKSIKGLQRE.................................... 148
59 -12.2004gp7_A mol:protein length:171 Metallophosphoesterase  ali model follow..  17  12....VVLIGSSGSGKSTFAKKHFKPTEVISSDF----------------LMSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNRKPLIE-VAVVFNLPEKVCQERNKNRTDRQV------RKHTQQMKKSIKGLQRE.................................... 148
60 -12.1001nrj_B mol:protein length:218 Signal recognition particle receptor beta sub  ali model follow..  10  12.QPSIIIAGPQNSGKTSLLTLLTTDSVRPTVVSQEPLSAADYDGSGTLVDFPGHVKLRYKLSDYLKTRAKFVKGLIFMVDSTVDPKKLTTTAEFLVDILSITESSCE-------NGIDILIACNKSELFTARPPSKDALESEIQKVI............................... 153
61 -12.0002ar7_A mol:protein length:246 Adenylate kinase 4  ali model follow..  19  23...RAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTE--YIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKDLVISLNIPFETLKDRLSRRTGEPLVQQEDDAARLRQYKDVAKPVLYKSRGVLHQFSGTETNKIWPYVYTLFSNK......... 229
62 -11.9001ltq_A mol:protein length:301 POLYNUCLEOTIDE KINASE  ali model follow..  18  1MKKIILTIGCPGSGKSTWAREFIAK-GFYNINRDDYRQSIMAHEERD-YTKKKEGIVTGMQFDTAKSILYGGDSVKGV-SDTNLNPERRLAWET-EHKVFDVPWTELVKRNSKRGTKAV-----PIDVLRSMYKS........................................... 142
63 -11.9002x8a_A mol:protein length:274 NUCLEAR VALOSIN-CONTAINING PROTEIN-LIKE  ali model follow..  16  47....VLLAGPPGCGKTLLAKAVANESGLNFVKGPELLNMYVGESVRQVFQRRRSDRETGASVRVVNQLLTEMDGLEARQQVFIMAATNRP------------IIDPAILRPGRLDKTLFVGLPPPADRLAILKTTKPPLDADVNLEAIAGDLRCDCYTGADLSALVREAS........ 230
64 -11.8003c8u_A mol:protein length:208 Fructokinase  ali model follow..  23  25....VALSGAPGSGKSTLSNPLAAALSAQFHLDNRLLEPLPRKGAPETFDFEGFQRLALKHQERVIYPLFDRARDIAIAGAAEVGPECRVAIIEGNYLRLEVPMADLEARL---VQRWLDHGLNHDAAVARAQGNDLANARAIEAARLPAD........................... 202
65 -11.7003ndp_A mol:protein length:231 Adenylate kinase isoenzyme 4  ali model follow..  19  7...RAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTE--YIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKDLVISLNIPFETLKDRLSRRTGEPLVQQEDDAARPRQYKDVAKPVLYKSRGVLHQFSGTETNKIWPYVYTLFSNK......... 213
66 -11.6001rz3_A mol:protein length:201 hypothetical protein RBSTP0775  ali model follow..  17  25....LGIDGLSRSGKTTLANQLSQTLRVCVFHMDDHIVERAKRYHTGNEEWFEYYYLQETDTHSKRTVYLSDSDMIMIEGVFLQRKEWRPFF--DFVVYLDCPREIRFARENDQVKQNIQKFINRYWKAEDYLETEEP--IKRADVVFDMTS.......................... 201
67 -11.6002jas_A mol:protein length:206 DEOXYGUANOSINE KINASE  ali model follow..  15  4....IAIFGTVGAGKSTISAEISKKLGYPYFEQYYKDLKKTVFKMQIYMLTARSKQLKQALENIIFDRTLLEDPIFMK--NNVDQTDYNTYID-DIVIYLRVSTKTAISRIKK-RGRS-EELLIGEEYWETLNKNYEEFYKQFFVVDAELDVKTQIELIMNKLNSIKNP......... 205
68 -11.6001zd8_A mol:protein length:227 GTP:AMP phosphotransferase mitochondrial  ali model follow..  18  9...RAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTAKAFIDQGKLIPDDVMTRLALHELKNQYSWLLDGFPRTLPQAEARAYQIDTVINLNVPFEVIKQRLTARTGEPLIQREDDIKRLKAYEDQTKPVYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKAS 224
69 -11.5003lw7_A mol:protein length:179 Adenylate kinase related protein (AdkA-like)  ali model follow..  12  4....ILITGMPGSGKSEFAKLLKER-GAKVIVMSDVVRKRYSIE-KRLREIYGDGVVARLCVEELGTSNHDLVVFDGVRSLAEVEEFKRLLGDSVYIVAVHSPPKIRYKRMERLRSDDSKEISELIRRDREELKLGIGEVIAMADYIITNDS-NYEEFKRRCEEVTDR.......... 176
70 -11.5003a8t_A mol:protein length:339 Adenylate isopentenyltransferase  ali model follow..  16  34.EKLLVLMGATGTGKSRLSIDLAAHFPLEVINSDK-MQVYKGLDITTNKISVPDADFRSLAGKAVSEITGRRKLPVLVGGSNSFSVVSSELRYDCCFLWVDVSVKVLTDYLAKRVDDMLELG---------MFDELAEFYSP.................................... 207
71 -11.4004ntz_A mol:protein length:217 Adenylate kinase  ali model follow..  17  4GSMNLLIMGLPGAGKGTQAAKIVEQFHVAHISTGDMFRAAMANQTAKSYIDKGELVPDEVTNGIVKERLSQDD---IKETGFLLDGYPRTIEQAHAIINIEVNPDSLLERLSGRIEEDYYQREDDKRRLDVNIAQGEPIYRAKGLVHDIEGNQDINDVFSDIEKVLT........... 214
72 -11.4002ak3_A mol:protein length:226 ADENYLATE KINASE ISOENZYME-3  ali model follow..  21  8...RAAIMGAPGSGKGTVSSRITKHFELKHLSSGDLLRDNMLRGTAKTFIDQGKLIPDDVMTRLVLHELKNQYNWLLDGFPRTLPQAEARAYQIDTVINLNVPFEVIKQRLTARTGEPLVQREDDVKRLKAYEAQTEPVYYRKKGVLETFSGTETNKIWPHVYAFLQTKLPQRSQETS 223
73 -11.3002xx3_A mol:protein length:232 THYMIDYLATE KINASE  ali model follow..  14  23....IVLEGVDRAGKSTQSRKLVEALCAAGHRAELL-STEIGKLLSSYLQKKSDSANRWEQVPLIKEKLSQGVTLVVAFSGVAFTGAKENFPKPDLVLFLQLQLADAAKRGAFGHER--YENGAFQERALRCFHQ---MKDTTLNWKMVDASKSIEAVHEDIRVLSE........... 210
74 -11.3002plr_A mol:protein length:213 Probable thymidylate kinase  ali model follow..  15  7....IAFEGIDGSGKSSQATLLKDWIKRDVYLTEWNSSDWIHDIIKEAKKKD-ATDFSDRYERYILPMLKSGFIVIS--DIDWVKKLYSFAIKPDITFYIRVSPDIALERIKKSKRKDIFPGLSPEEGFLKYQGLITEVYDKLVKFIVIDGTKTPKEIQIQIRKFVG........... 206
75 -11.3002v54_A mol:protein length:204 THYMIDYLATE KINASE  ali model follow..  14  7....IVFEGLDKSGKTTQCMNIMESIPANTIKYLNFPQRSTGKMIDDYLTRKKTCANRWEFASFIQEQLEQGITLIAYAAAKGASMTESGLPKPDLVIFLESGSKEINRNVGEEIYEDVTFQQKVLQEYKKMIEEGDIHWQIISEFEEDVKKELIKNIVIEAIHTVT........... 196

FFAS is supported by the NIH grant R01-GM087218-01
8 3 0 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.