current user: public




Query: 2i99_A mol:protein length:312 Mu-crystallin homolog, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310
# Score Template Links and tools%idFirst SRVPAFLSAAEVEEHLRSSSLLIPPLETALANFSSGPEGGVMQPVRTVVPVTKHRGYLGVMPAYSAAEDALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAKRTAAVSAIATKFLKPPSSEVLCILGAGVQAYSHYEIFTEQFSFKEVRIWNRTKENAEKFADTVQGEVRVCSSVQEAVAGADVIITVTLATEPILFGEWVKPGAHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVKPAHCEKTTVFKSLGMAVEDTVAAKLIYDSWSSGLast
1 -122.0002i99_A mol:protein length:312 Mu-crystallin homolog  ali model  100  1SRVPAFLSAAEVEEHLRSSSLLIPPLETALANFSSGPEGGVMQPVRTVVPVTKHRGYLGVMPAYSAAEDALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAKRTAAVSAIATKFLKPPSSEVLCILGAGVQAYSHYEIFTEQFSFKEVRIWNRTKENAEKFADTVQGEVRVCSSVQEAVAGADVIITVTLATEPILFGEWVKPGAHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVKPAHCEKTTVFKSLGMAVEDTVAAKLIYDSWSSG 312
2 -117.0004bv8_A mol:protein length:335 THIOMORPHOLINE-CARBOXYLATE DEHYDROGENASE  ali model follow..  88  18KRAPAFLSAEEVQDHLRSSSLLIPPLEAALANFSKGPDGGVMQPVRTVVPVAKHRGFLGVMPAYSAAEDALTTKLVTFYEGHS-NTAVPSHQASVLLFDPSNGSLLAVMDGNVITAKRTAAVSAIATKLLKPPGSDVLCILGAGVQAYSHYEIFTEQFSFKEVRMWNRTRENAEKFASTVQGDVRVCSSVQEAVTGADVIITVTMATEPILFGEWVKPGAHINAVGASRPDWRELDDELMRQAVLYVDSREAALKESGDVLLSGADIFAELGEVISGAKPAHCEKTTVFKSLGMAVEDLVAAKLVYDSWSSG 328
3 -92.1001vll_A mol:protein length:334 alanine dehydrogenase  ali model follow..  30  9...TLILTQEEVESLISM-DEAMNAVEEAFRLYA---LGKAQMPPKVYLEFE--KGDLRAMPAHLMG--YAGLKWVNSHPGNP-DKGLPTVMALMILNSPETGFPLAVMDATYTTSLRTGAAGGIAAKYLARKNSSVFGFIGCGTQAYFQLEALRRVFDIGEVKAYDVREKAAKKFVSYCDRGISASVQPAEEASRCDVLVTTTPSRKPVVKAEWVEEGTHINAIGADGPGKQELDVEILKKAKIVVDDLEQA-KHGGEIVIGVEDVHATIGEVIAGLKDGREEEITIFDSTGLAIQDVAVAKVVYENALS. 316
4 -90.1001u7h_A mol:protein length:350 ornithine cyclodeaminase  ali model follow..  22  1..MTYFIDVPTMSDLVHDVAPFIGELAAALRDDF---KRWQAFDKSARVASHSEVGVIELMPVADK--SRYAFKYVNGHPANT-ARNLHTVMAFGVLADVDSGYPVLLSELTIATALRTAATSLMAAQALARPNARKMALIGNGAQSEFQALAFHKHLGIEEIVAYDTDPLATAKLIANLGLTIRRASSVAEAVKGVDIITTVTADKATIITPDMLEPGMHLNAVGGDCPGKTELHADVLRNARVFVEYEPQTRIEGEIQQLPADFPVVDLWRVLRGETEGRQSQVTVFDSVGFALEDYTVLRYVLQQAEK. 313
5 -89.0003hdj_A mol:protein length:313 Probable ornithine cyclodeaminase  ali model follow..  26  1SNAMLHIDDAMIEDAVTP-QAAQEVLHAAFLDFG---RGSAAMQRRVRTEAG--GVKLSTLGAVIPGQGVAGAKVYTTIKGQ--------FQFVILLFSAADGRPLATCDAGTLTRKRTAACTVLAAGALARPRSSVLGLFGAGTQGAEHAAQLSARFALEAILVHDPYASPLERIGRRCGVPARM-AAPADIAAQADIVVTATRSTTPLFAGQALRAGAFVGAIGSSLPHTRELDDEALRRARVVVEWREQTLSEAGDLVLAADAKVVELADVLAGRAAARDEDIVIYKSVGVGLEDVALAGYAYRRLAAQ 307
6 -81.1004m54_A mol:protein length:339 Putative ornithine cyclodeaminase  ali model follow..  23  9....LYLNRSDIEQAGGNSQVYVDALTEALTAHA---HNDFVQPLKPYLRQDPENGHIIAMPSHIGGEAISGIKWIGSKHDNPSKRNMERASGVIILNDPETNYPIAVMEASLISSMRTAAVSVIAAKHLAKKGFKDLTIIGCGLIGDKQLQSMLEQFDIERVFVYDQFSEACARFVDRWEINFIATENAKEAVSNGEVVITCTVTDQPYIEYDWLQKGAFISNISI-----MDVHKEVFIKAKVVVDDWSQCNREKKTIKFSKEALHAELGQLVTGDIPGRDDEIILLNPMGMAIEDISSAYFIYQQAQQ. 329
7 -20.4003oj0_A mol:protein length:144 Glutamyl-tRNA reductase  ali model follow..  17  1..................................................................................................................SNAGKVSIPSIVYDIVRKNGGNKILLVGNGMLASEIAPYFSY-----KVTVAGRNIDHVRAFAEKYEYEYVLINDIDSLIKNNDVIITATSSKTPIVEERSLMPGKLFIDLGN-----PNIERGNNV---ITLDEIYEISKK........................................................ 133
8 -12.6001gpj_A mol:protein length:404 GLUTAMYL-TRNA REDUCTASE  ali model follow..  17  151......................................................................................................................GSAAVELAERELGSLHDKTVLVVGAGEMGKTVAKSLVD-RGVRAVLVANRTYERAVELARDLGGEAVRFDELVDHLARSDVVVSATAAPHPVIHVDDVREALRILIIDIANP--RDVEEGVENIEDVEVRTID------------------DLRVIARENLERRRKEIPKVEKL.................... 310
9 -11.2004d3s_A mol:protein length:293 IMINE REDUCTASE  ali model follow..  18  4..................................................................................................................................TKAKKSPVTLIGLGPMGQAMAGALLEA---YELTVWNRTKAKAEALAER----AAVADSPAEALRAGGPVLLSLTEHAVMYRESDLKGRTILNLGSDTPAASRAAAAWAEGHGARYVT---------GGVMSPAPGISSSVFSFYSGDRAAFEENKALLEVLTATDEDPGLAQVY....... 173
10 -11.0003ic5_A mol:protein length:118 putative saccharopine dehydrogenase  ali model follow..  15  1..................................................................................................................................SNAMRWNICVVGAGKIGQMIAALLKTSSNY-SVTVADHDLAALAVLVATKQVDAKDEAGLAKALGGFDAVISAAPFFTPIIAKAAKAAGAHYFDLTEDVAATNAV............................................................................. 109
11 -10.9003c1a_A mol:protein length:315 Putative oxidoreductase  ali model follow..  11  6..................................................................................................................................ANNSPVRLALIGAGRWGKNYIRTIAGLPGAALVRLASSNPDNLALVPPGCVIESDWRSVVSAPEVEAVIIATPPATHAEITL-AAIASGKAVKPLTLDLAEAEAVAAAAKATGVMVWVEHTQLFNPA---WEALKADLTSIGPILGNHGPYRPGGVPMLWD--WGAHDVSMVLDLMGR.... 186
12 -10.7004n7r_A mol:protein length:472 Glutamyl-tRNA reductase 1, chloroplastic  ali model follow..  20  179..................................................................................................................TNIASGAVSSSAAVELALMVSARMCVIGAGKMGKLVIKHLMA-KGCTKVVVVNRSEERVSAIREEMPGIYRPLDEMLACASEADVVFTSTASETPLFLKEHVENGGLRHFVDISVP--RNVGSCVGEVETARVYNVD------------------DLKEVVAANKEDRMRKAMEAQTI.................... 354
13 -10.6003l6d_A mol:protein length:306 Putative oxidoreductase  ali model follow..  15  5..................................................................................................................................DESFEFDVSVIGLGAMGTIMAQVLLKQ---KRVAIWNRSPGKAAALVAA----AHLCESVKAALSASPATIFVLLDNHATHEARALAHRTIVDYTTNAQDEGLALQGLVNQAGGHYVK---------GMIVAYPRNVHRESHSIHTGDREAFEQHRALLEGLA................... 161
14 -10.5004oqz_A mol:protein length:289 Putative oxidoreductase YfjR  ali model follow..  13  2......................................................................................................................................SQSVTVIGLGPMGQAMAAAYLDR---YEVTLWNRTASRADALVAR----AKLAATPEQALSANELVILSLIDYDAMYGEEAVAGRVLVNLSSDTPEKARAAARRVAELGGTHLT---------GGVLSPPPGISPDMSTFYSGPRAAYDQHRAALEVITAALMYQLNMVVFWPAMLS. 182
15 -10.4003zgy_A mol:protein length:309 R-IMINE REDUCTASE  ali model follow..  18  1....................................................................................................................MPDNPSTKGRMMRNQQAEHTPVTVIGLGLMGQALAGAFLGA---HPTTVWNRTAAKAEPLVAR----AKSAGSVAEAVAASPLVVVCVSDYDAVLDGTALQGRTLVNLTSGTSAQARERAAWADGRGADYLD---------GAILAGPAAITADAVVLLSGPRSAFDPHASALGGLGAGTADHGLASL........ 185
16 -10.3004d3d_A mol:protein length:310 IMINE REDUCTASE  ali model follow..  16  4.....................................................................................................................NSQNEKNGSETTNAVGNRKSVTVIGLGPMGQAMADVFLEY---YSVTVWNRTSSKADQLVAK----AIRVSTVNEALAANELVILSLTDYNVMYSSENLFGKVLVNLSSDTPEKARKAAKWLEDRGARHIT---------GGVQVPPSGIKSESYTYYSGDRVVFEAHRETLEVLTSSDEDPGLAMLY....... 186
17 -9.9404oqy_A mol:protein length:290 (S)-imine reductase  ali model follow..  16  2.....................................................................................................................................SKQSVTVIGLGPMGQAMVNTFLDN---HEVTVWNRTASKAEALVAR----AVLAPTVEDALSANELIVLSLTDYDAVYATGSLSGKVIANLSSDTPDKAREAAKWAAKHGAKHLT---------GGVQVPPPLIKPESSTYYSGPKDVFDAHEDTLKVLTAAMYYQAQMTIFWTTMLS. 182
18 -9.8904iq0_A mol:protein length:328 Oxidoreductase, Gfo/Idh/MocA family  ali model follow..  14  7.........................................................................................................................................LGVIGTGAISHHFIEAAHTSGEYQLVAIYSRKLETAATFASRYQNIQLFDQLEVFFKSSFDLVYIASPNSLHFAQAK-LSAGKHVKPAVSQPQEWFDLIQTAEKNNCFIFEAARNYHEKAFTTILADKQVYAKYSSKMPDLLAGQTPNVFSDRFAGGALMDLGI........... 183
19 -9.7401wxd_A mol:protein length:263 shikimate 5-dehydrogenase  ali model follow..  21  61.......................................................................................LPLKEAALAHLDWVSPEAQRIQVEGRLFGFNTDAPGFLEAKAGGIPLKGPALVLGAGGAGRAVAFALREA----EVWVWNRTPQRALALAEEFGLRAVPL----EKAREARLLVNATR-------------------VGLEDPSASPLPAELFPEEGAAVD................................................................ 204
20 -9.6104xij_A mol:protein length:275 Shikimate 5-dehydrogenase  ali model follow..  14  68.......................................................................................MPGKFAALEFADQRTDRAQLVGSANTLVRMPTGGWRADNTDVDGGTAGDSALVIGSGGTAPAAVVALAEL-GVQRITIVARDEGKASRLVDQGGWCDIGGAALADAVASADAAVSTIPADAAAVYADALARVPRVLDA-IYDPWPTPLAQAVEAAGGEAINGLQMLLNQA....................................................... 247
21 -9.5103don_A mol:protein length:277 Shikimate dehydrogenase  ali model follow..  13  45.......................................................................IKKIISEKSIDGFNVTIPHKERIIPYLDDINEQAKSVVKDGKWIGYNTDGIGYVNGQIYEGIEDAYILILGAGGASKGIANELYK-IVRPTLTVANRTMSRFNNWSLNIN--KINLSHAESHLDEFDIIINTTP-------------------AGMNGNTDSVISLNRLASHTLVSD................................................................ 208
22 -9.4902axq_A mol:protein length:467 Saccharopine dehydrogenase  ali model follow..  18  2...........................................................................................................................GSSGHIEGRHMGKNVLLLGSGFVAQPVIDTLAANDDI-NVTVACRTLANAQALAKPISLDVTDDSALDKVLADNDVVISLIPYTHPNVVKSAIRTKTDVVTSSYISPALRELEPEIVKAGITVMNEI-----DPGIDHLYAVKTIDEVHR--------AGGKLKSFLS-GLPAPEDSDNPLGYK..... 181
23 -9.4802yjz_A mol:protein length:201 METALLOREDUCTASE STEAP4  ali model follow..  13  1....................................................................................................................MEKTCADEFPLTVDSSEKQGVVCIFGTGDFGKSLGLKMLQC---YSVVFGSRNPQVSSLLPRGAE-----VLCYSEAASRSDVIVLAVHELADSLKGRVLIDVSNNQKMNQYPESNAEYLAQLVPGAHVV-----KAFNTISAWALQSGTLDASRQVFVCGNDSKAKDRVMIARTLGLTPLDQ............. 180
24 -9.3104p4g_A mol:protein length:277 Shikimate 5-dehydrogenase AroE (5-dehydroshik  ali model follow..  12  66.......................................................................................MPGKFAALRFADERTARADLVRTPHGWRADNTDIDGVAGA---LGAAAGHALVLGSGGTAPAAVVGLAEL-GVTDITVVARNSDKAARLVDATRFCAFDSGGLADAVAAAEVLVSTIPAEVAAGYAGTLAAIPVLLDA-IYDPWPTPLAAAVGSAGGRVISGLQMLLHQA....................................................... 244
25 -9.1901lc0_A mol:protein length:294 Biliverdin Reductase A  ali model follow..  11  1................................................................................................................................MITNSGKFGVVVVGVGRAGSVRLRDLKDPRSAAFLNLIGFVSRRELGSLDEV-----RQISLEDALREIDVAYICSESSS--YIRQFLQAGKHVYPMTLSFAAAQELWELAAQKGRVLHEE............................................................... 122
26 -9.0901npy_A mol:protein length:271 Hypothetical shikimate 5-dehydrogenase-like p  ali model follow..  13  45............................................................IEHAIKGVRALGIRGCAV--------SMPFKETCMPFLDEIHPSAQAI-DNGFLRAYNTDYIAIVLIEKYHLNKNAKVIVHGSGGMAKAVVAAFKN-SGFEKLKIYARNVKTGQYLAALYGYA----YINSLENQQADILVNVTS----------------IGMKGGKEEMDLAFPKAFIDNASVAFD................................................................ 211
27 -9.0704fsh_A mol:protein length:271 Shikimate dehydrogenase  ali model follow..  17  60.................................................................................SGANVTLPFKERAFQVCDKIKGIALECLENDELVGYNTDALGFYLS--LKHQNYQNALILGSGGSAKALACGLKKQ---LKVSVLNRSPRGLDFFQR-----LGCDCFMEPPKSAFDLIINATSA-----------------SLNNELPLNKEVLKGYFKEAKLAYDLA--------------------YGFLTPFLALAKELKIPFQDGKDMLIYQASLSFEKFSASQIP 251
28 -9.0101gcu_A mol:protein length:295 BILIVERDIN REDUCTASE A  ali model follow..  12  11.........................................................................................................................................VVVVGVGRAGSVRLRDLKDPRSAAFLNLIGFVSRRELGSLDEVR-----QISLEDALREIDVAYICSESSS--YIRQFLQAGKHVYPMTLSFAAAQELWELAAQKGRVLHEEH.............................................................. 124

FFAS is supported by the NIH grant R01-GM087218-01
8 5 6 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.