current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

2i99A
Query: 2i99_A mol:protein length:312 Mu-crystallin homolog, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310
# Score Template Links and tools%idFirst SRVPAFLSAAEVEEHLRSSSLLIPPLETALANFSSGPEGGVMQPVRTVVPVTKHRGYLGVMPAYSAAEDALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAKRTAAVSAIATKFLKPPSSEVLCILGAGVQAYSHYEIFTEQFSFKEVRIWNRTKENAEKFADTVQGEVRVCSSVQEAVAGADVIITVTLATEPILFGEWVKPGAHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVKPAHCEKTTVFKSLGMAVEDTVAAKLIYDSWSSGLast
1 -102.0002i99_A mol:protein length:312 Mu-crystallin homolog  ali model  100  1SRVPAFLSAAEVEEHLRSSSLLIPPLETALANFSSGPEGGVMQPVRTVVPVTKHRGYLGVMPAYSAAEDALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAKRTAAVSAIATKFLKPPSSEVLCILGAGVQAYSHYEIFTEQFSFKEVRIWNRTKENAEKFADTVQGEVRVCSSVQEAVAGADVIITVTLATEPILFGEWVKPGAHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVKPAHCEKTTVFKSLGMAVEDTVAAKLIYDSWSSG 312
2 -80.5001vll_A mol:protein length:334 alanine dehydrogenase  ali model follow..  30  8..ETLILTQEEVESLI-SMDEAMNAVEEAFRLYA---LGKAQMPPKVYLEFE--KGDLRAMPAHLMG--YAGLKWVNSHPGNP-DKGLPTVMALMILNSPETGFPLAVMDATYTTSLRTGAAGGIAAKYLARKNSSVFGFIGCGTQAYFQLEALRRVFDIGEVKAYDVREKAAKKFVSYCEDRISASVQPAEEASRCDVLVTTTPSRKPVVKAEWVEEGTHINAIGADGPGKQELDVEILKKAKIVVDDLEQAKHGGEKGVIGVEDVHATIGEVIAGLKDGRDEEITIFDSTGLAIQDVAVAKVVYENALS. 316
3 -79.6001u7h_A mol:protein length:350 ornithine cyclodeaminase  ali model follow..  22  1..MTYFIDVPTMSDLVPFIGELAAALRDDFKRWQAF-------DKSARVASHSEVGVIELMPVADKS--RYAFKYVNGHPANTAR-NLHTVMAFGVLADVDSGYPVLLSELTIATALRTAATSLMAAQALARPNARKMALIGNGAQSEFQALAFHKHLGIEEIVAYDTDPLATAKLIANLGLTIRRASSVAEAVKGVDIITTVTAAYATIITPDMLEPGMHLNAVGGDCPGKTELHADVLRNARVFVEYEPQTRIEGEIQQLPADFPVVDLWRVLRGETEGRDSQVTVFDSVGFALEDYTVLRYVLQQAEK. 313
4 -77.6003hdj_A mol:protein length:313 Probable ornithine cyclodeaminase  ali model follow..  25  1SNAMLHIDDAMIEDAV-TPQAAQEVLHAAFLDFG---RGSAAMQRRVRTEAG--GVKLSTLGAVIPGQGVAGAKVYTTIKGQ--------FQFVILLFSAADGRPLATCDAGTLTRKRTAACTVLAAGALARPRSSVLGLFGAGTQGAEHAAQLSARFALEAILVHDPYAS--PEILERIGRRCARMAAPADIAAQADIVVTATRSTTPLFAGQALRAGAFVGAIGSSLPHTRELDDEALRRAAVVVEWREQTLSEAGDLVLA-DAKVVELADVLAGRAAARDEDIVIYKSVGVGLEDVALAGYAYRRLAA. 306
5 -23.9003oj0_A mol:protein length:144 Glutamyl-tRNA reductase  ali model follow..  17  1..................................................................................................................SNAGKVSIPSIVYDIVRKNGGNKILLVGNGMLASEIAPYFSY----YKVTVAGRNIDHVRAFAEKYEYEYVLINDIDSLIKNNDVIITATSSKTPIVEERSLMPGKLFIDLGN-----PNIERGNNV---ITLDEIYEISKK........................................................ 133
6 -12.1003ic5_A mol:protein length:118 putative saccharopine dehydrogenase  ali model follow..  14  1..................................................................................................................................SNAMRWNICVVGAGKIGQMIAALLKTSSNY-SVTVADHDLAALAVLNRMKQVDAKDEAGLAKALGGFDAVISAAPFLTPIIAKAAKAAGAHYFDLTEDVAATNAV............................................................................. 109
7 -11.7001gpj_A mol:protein length:404 GLUTAMYL-TRNA REDUCTASE  ali model follow..  18  141..................................................................................................................TRISEGAVSILAERELGSLHDKTVLVVGAGEMGKTVAKSLVD-RGVRAVLVANRTYERAVELARDLGGEAVRFDELVDHLARSDVVVSATAAPHPVIHVDDVREALRILIIDIANP--RDVEEGVENIEDVEVRTIDDLRVIARENLERRRKEIPKVEKLIEEE.................................. 314
8 -11.5003c1a_A mol:protein length:315 Putative oxidoreductase  ali model follow..  10  1.............................................................................................................................GMSIPANNSPVRLALIGAGRWGKNYIRTIAGLPGAALVRLASSNPDNLALVPPGCV----IESDWRSVVSAPEVVIIATPPATHAITLAAIASGKAVLVEKPLTLDLAEAEAVAAAAKATGVMVWVEHTQLFNPAWEALKADLTSIGPILAVRSEAGNHGPYRPGGVPWGAHDVSMVLDLMGR.... 186
9 -10.9003bio_A mol:protein length:304 Oxidoreductase, Gfo/Idh/MocA family  ali model follow..  15  1..............................................................................................................................SNAMTDDKKIRAAIVGYGNIGRYALQALREAPDFEIAGIVRRNPAEVPFELQPFR-----VVSDIEQLESVDVALVCSPSREVETALEILKKGICTADSFDIHDGILALRRSLGDAAG.................................................................... 114
10 -10.8002vns_A mol:protein length:215 METALLOREDUCTASE STEAP3  ali model follow..  11  1...........................................................................................................MPEEMDKPLISLHLVDSDSSLAKVPDEAPKVGILGSGDFARSLATRLVGS---FKVVVGSRNPKRTARLFP----SAAQVTFQEEAVSSPEVIFVAVFREH-CSLSDQLAGKILVDVSNPTEQEHLQHRESNAEYLASLFPTCTKAFNVISAWTLQAGPRDGNRQVPICGDQPEAKRAVSMALAMGFMPVDM............. 192
11 -10.8003mz0_A mol:protein length:344 Inositol 2-dehydrogenase/D-chiro-inositol 3-d  ali model follow..  18  5.........................................................................................................................................IGVIGTGAIGKEHINRITNKLSAEIVAVTDVNQEAAQKVVEQYQLNATVYPNDDSLLADENVVTSWGPAHESSVLKA-IKAQKYVFCLATTAEGCMRIVEEEIKVGKRLVQVGFMRRYDSGYVQLKEALDNHVIGEPLMIHCAHRNPTVGDNYTTDMAVVDTLVHEIDVLHWLVN 186
12 -10.4003ec7_A mol:protein length:357 Putative Dehydrogenase  ali model follow..  13  2.......................................................................................................................GSSSSGRENLYFQGMTLKAGIVGIGMIGSDHLRRLANTVSVEVVAVCDIVAGRAQAALDKYAIEAKDYNDYHDLINDKDVITASNEAHADVAVAA-LNANKYVFCLAVTAADCQRVIEAEQKNGKRMVQIGFMRRYDKGYVQLKNIIDSGEIGQPLMVHGRHYNASTVPEYKTPQAIYETLIHEIDVMHWLLN 201
13 -10.3003uuw_A mol:protein length:308 Putative oxidoreductase with NAD(P)-binding R  ali model follow..  10  8........................................................................................................................................KMGMIGLGSIAQAYLPILTKSERFEFVGAFTPNKVKREKICSDYR--IMPFDSIESLAKKCDCIFLHSSTETHYIIKILLNLGVHVYVDKPLASTVSQGEELIELSTKKNLNLMVGFNRRFCPMYKEIKNNATEIVSINICKHGLNSLRNV---RFDSTLIDDYI........... 169
14 -10.3002axq_A mol:protein length:467 Saccharopine dehydrogenase  ali model follow..  18  2...........................................................................................................................GSSGHIEGRHMGKNVLLLGSGFVAQPVIDTLAANDDI-NVTVACRTLANAQALAKPSGSKAISLDALDKVLADNDVVISLIPYTHPNVVKSAIRTKTDVVTSSYISPALRELEPEI------------------------------------------VKAGITVMNEIGLGIDHLYAVKTIDE..... 150
15 -10.2003abi_A mol:protein length:365 Putative uncharacterized protein PH1688  ali model follow..  18  2..............................................................................................................................NHKVIEGRHMKVLILGAGNIGRAIAWDLKD-----DVYIGDVNNENLEKVKEFATVDASNFDKLVEVMKEFELVIGALPGGFKSIKA--IKSKVDMVDVSFMPENPLELRDEAEKAQVTIV................................................................. 123
16 -10.1001dap_A mol:protein length:320 DIAMINOPIMELIC ACID DEHYDROGENASE  ali model follow..  16  5........................................................................................................................................RVAIVGYGNLGRSVEKLIAKQPDMDLVGIFSRRATLDTKT------PVFDVADVDKHADDVDVLFLCMGSATDIEQAPKFAQFACTVDTYDNHRDIPRHRQVMNEAAT.................................................................... 107
17 -10.1003l6d_A mol:protein length:306 Putative oxidoreductase  ali model follow..  15  5..................................................................................................................................DESFEFDVSVIGLGAMGTIMAQVLLKQ----RVAIWNRSPGKAAALVAA----AHLCESVKAALSASPATIFVLLDNHATHE----MPGVARALAHRTIVDYTTNAQDEGLALQGLVNQAGGHYVKGMIVAYPRNVGHRESHSIHTGDREAFEQHRALLEGLA................... 161
18 -10.1002p2s_A mol:protein length:336 Putative oxidoreductase  ali model follow..  7.........................................................................................................................................FAAIGLAHNHIYDMCQQLIDAGAELAGVFESDSDNRAKFTSLFPS-VPFAASAEQLITDASIACAVIPCDRAELALRTLDAGKDFFTPLTTLEQLDAVQRRVAETGRKFAVYFNERINVDSALFAGELVQRGEIGRVIQTMGVGPHRE----RQYGGILCDIGIHQIEQFLYFTG 193
19 -9.9302ho3_A mol:protein length:325 Oxidoreductase, Gfo/Idh/MocA family  ali model follow..  13  3........................................................................................................................................KLGVIGTGAISHHFIEAAHTSGEYQLVAIYSRKLETAATFASRYQNIQLFDQLEVFFKSSFDLVYIASPNSLHFQAKAALSAGKHVILEKPAVSQPQEWFDQTAEKNNCFIFEAARNYHEKAFTTIKNFLADKQVLGAMPDLLAGQTPNVFSDRFAGGALMDLGIYPLYAAVRLFG 191
20 -9.9102hk9_A mol:protein length:275 Shikimate dehydrogenase  ali model follow..  20  67.......................................................................................VPFKEEIIPLLDYVEDTAKEIFENGKAYGYNTDWIGFLKSSLIPEVKEKSILVLGAGGASRAVIYALVKE---AKVFLWNRTKEKAIKLAQKFP--LEVVNSPEEVIDKVQVIVNTTS-------------------VGLKDEDPEIFNYDLIKKDHVVVDIIYKETKLLKKAKEKGAKLLDGLPMLL..................................... 240
21 -9.8203u3x_A mol:protein length:361 Oxidoreductase  ali model follow..  12..............................................................................................................................LYFQSMMDELRFAAVGLNHNHIYGQVNCLLRAGARLAGFHEKDDALAAEFSAVYAD-ARRIATAEEILEDENIVSAAVSSERAELAIRAMQHGKDVLVGMTSFDQLAKLRRVQAETGRIFSILYSEHFESPATVKAGELVAAGAIGEVVH-RRETRPDWFFRRADYGGILTDIASHQCEQFLFFTG 210
22 -9.7602ixa_A mol:protein length:444 ALPHA-N-ACETYLGALACTOSAMINIDASE  ali model follow..  2..............................................................................................................GALIPSSTLFNIFDFNPKKV------RIAFIAVGLRGQTHVENMARRDDVEIVAFADPDPYMVGRAQEILKKNGNGNDDYKNMLKNIDAVFVSSPWEHHEHGVAAMKAGKIVGMEVSGAITLEECWDKVSEQTGVPLMALENVCYRRDVMAILNMVRKGMFGELVHGT.................................. 176
23 -9.7101tlt_A mol:protein length:319 PUTATIVE OXIDOREDUCTASE (VIRULENCE FACTOR mvi  ali model follow..  12  8.........................................................................................................................................IGVVGLGGIAQAWLPVLAAASDWTLQGAWSPTRAKALPICESWR--IPYADSLSSLAASCDAVFVHSSTASHFVVSTLLNAGVHVCVDKPLAENLRDAERELAARKKLTLMVGFNRRFAPLYGELKTQLATAASLRMDKHRSNSVGPHDLYFTLLDDYLHVVDTALWLSGG.... 180
24 -9.6803ezy_A mol:protein length:344 Dehydrogenase  ali model follow..  12  5.........................................................................................................................................IGVIGLGRIGTIHAENLKMIDDAILYAISDVREDRLREMKEKLGVE-KAYKDPHELIEDPNVVCSSTNTHSELVIAC-AKAKKHVFCEKPLSLNLADVDREETKKADVILFTGFNRRFDRNFKKLKEAVENGTIGKPHVLRITSRDPALDYIRVSGGIFLDMTIHDFDMARYIMG 186
25 -9.6702glx_A mol:protein length:332 1,5-anhydro-D-fructose reductase  ali model follow..  12  1.......................................................................................................................................NRWGLIGASTIAREWVIGAIRATGGEVVSMMSTSAERGAAYATENGIG-KSVTSVEELVGDPDVVYVSTTNEL--QTLAAIRAGKHVLCEKPLAMTLEDAREVAAREAGVVLGTNHHLRNAAAHRAMRDAIAEGRIGRPIAARVFHAVYRLERPEAGGGVILDITVHDADTLRFVLN 189
26 -9.6601e5l_A mol:protein length:450 SACCHAROPINE REDUCTASE  ali model follow..  21  3......................................................................................................................................TKSVLMLGSGFVTRPTLDVLTD-----KVTVACRTLESAKKLSAGVQLDVNDDAALDAEVAKHDLVISLIPYTHATVIKSAIRQKKHVVTTSYVSPAMMELDQAA------------------------------------------KDAGITVMNEIGLGIDHLYAIKTIEE..... 140
27 -9.5603doj_A mol:protein length:310 Dehydrogenase-like protein  ali model follow..  15  2.........................................................................................................................GSSSSGLVPRGSHMMEVGFLGLGIMGKAMSMNLLKN----KVTVWNRTLSKCDELVEH----ASVCESPAEVIKKCKYTIAMLSDPCAALS-EQICEGKGYIDMSTVDAESLKINEAITGKGGRFVEGPVSGSKKPAE---------GQLIILAAGDKALFEESIPAFDVLGKRS................ 172
28 -9.5503don_A mol:protein length:277 Shikimate dehydrogenase  ali model follow..  13  61.......................................................................................IPHKERIIPYLDDINEQAKSVVKDGKWIGYNTDGIGYVNGQIYEGIEDAYILILGAGGASKGIANELYKI-VRPTLTVANRTMSRFNNWSLNIN--KINLSHAESHLDEFDIIINTTP-------------------AGMNGNTDSVISLNRLASHTLVSD................................................................ 208
29 -9.5401wxd_A mol:protein length:263 shikimate 5-dehydrogenase  ali model follow..  21  61.......................................................................................LPLKEAALAHLDWVSPEAQRIQVEGRLFGFNTDAPGFLALKAGGIPLKGPALVLGAGGAGRAVAFALREA----EVWVWNRTPQRALALAEEFGLRAVPLEK----AREARLLVNATR-------------------VGLEDPSASPLPAELFPEEGAAVD................................................................ 204
30 -9.5203euw_A mol:protein length:344 Myo-inositol dehydrogenase  ali model follow..  15  7.........................................................................................................................................IALFGAGRIGHVHAANIAANPDLELVVIADPFIEGAQRLAEANG--AEAVASPDEVFARDDIIGSPTSTHVDLITRA-VERGIPALCEKPIDLDIEMVRAEKIGDGASKVMLGFNRRFDPSFAAINARVANQEIGNLEQLVIISRDPAKDYIAGSGGIFRDMTI........... 176
31 -9.5001lc0_A mol:protein length:294 Biliverdin Reductase A  ali model follow..  10  1................................................................................................................................MITNSGKFGVVVVGVGRAGSVRLRDLKDPRSAAFLNLIGFVSRRELGSLDEV-----RQISLEDALREIDVAYICSESSS--YIRQFLQAGKHVLVEYPMTLSFAAAQEELAAQKGRVLHEEHVELLMEEFEFLRREVLGKELLKGSLRFTASPLEEERFGFPAFSGISRLTWLVSLFGELSL. 183
32 -9.5002nlo_A mol:protein length:302 Shikimate dehydrogenase  ali model follow..  14  83.......................................................................................HPYKQAVLPLLDEVSGAVNTVVATGHTTGHNTDVSGFGRGEGLPNAKLDSVVQVGAGGVGNAVAYALVTH-GVQKLQVADLDTSRAQALADVINVVGVDARGIEDVIAAADGVVNATP-------------------MGMPAHPGTAFDVSCLTKDHWVGDVVYMPIETE---------------------KAARALGCETLDGTRMAIHQAVDAFRLF...... 279
33 -9.5003pdu_A mol:protein length:287 3-hydroxyisobutyrate dehydrogenase family pro  ali model follow..  14  2.......................................................................................................................................TTYGFLGLGIMGGPMAANLVRA----DVTVWNRNPAKCAPLVAL----ARQASSPAEVCAACDITIAMLADPAAARE-EGIGGGRGYIDMSTVDDESTAIGAAVTARGGRFLEAPVSGTKKPAE---------GTLIILAAGDQSLFTDAGPAFAALGKKC................ 158
34 -9.4401nvt_A mol:protein length:287 Shikimate 5`-dehydrogenase  ali model follow..  18  72.......................................................................................IPHKIEIMKYLDEIDKDAQLIIEDGKAIGYNTDGIGARMAEEIGRVKDKNIVIYGAGGAARAVAFELAKD---NNIIIANRTVEKAEALAKEIAGEEVKFSGLDVDLDGVDIIINATPDVEPIVKAEKLREDMVVMDL-IYNPLETVLLKEAKKVNAKTINGLGMLIYQG....................................................... 260
35 -9.2702egg_A mol:protein length:297 Shikimate 5-dehydrogenase  ali model follow..  16  78.......................................................................................IPHKLAVIPFLDEVDGAVNTIINDGRLVGYNTGYVQALEEEMNITLDGKRILVIGAGGGARGIYFSLLS-TAAERIDMANRTVEKAERLVREGDSAYFSLAEAETRLAEYDIIINTTSVEVQPLSLERLRPGVIVSDI-IYNPLETKWLKEAKARGARVQNGVGMLVYQGAL..................................................... 266
36 -9.2503qsg_A mol:protein length:312 NAD-binding phosphogluconate dehydrogenase-li  ali model follow..  10  2......................................................................................................................SSGVDLGTENLYFQSNAMKLGFIGFGEAASAIASGLRQA-GAIDMAAYDAASAESWRPRAE-ELGVSCKASVAEVAGECDVIFSLVTAQAALEVAQ-LCEGALYADFTSCSPAVKRAIGDVISRHRPYAAV-AVKPHGHRVPLVVDGDGARRFQAAFTDGEVGGAALLKMCRSAVLKGLEALFLEALAAAEKMG 212
37 -9.2503e18_A mol:protein length:359 oxidoreductase  ali model follow..  13  7........................................................................................................................................QLVIVGYGGMGSYHVTLASAADNLEVHGVFDILAEKREAAAQK---GLKIYESYEAVLADEDAVLIATPNDS--LAISALEAGKHVVCEKPVTMTSEDLLADVAKRVNKHFMVHQNRRWDEDFLIIKEMFEQKTIGEMFHLESRVHGANGIMVLDWGVHLLDQLL........... 186
38 -9.2403db2_A mol:protein length:354 putative NADPH-dependent oxidoreductase  ali model follow..  15  8.........................................................................................................................................VAAIGLGRWAYVMADAYTKSEKLKLVTCYSRTEDKREKFGKRYN--CAGDATMEALLADVEMVIITVPNDK--VIEQCARSGKHIYVEKPISVSLDHAQRQVIKETGVKFLCGHSSRRLGALRKMKEMIDTKEIGEVSSIEAVFSNERGLELKAPGGPLTQLGVHQIDNLQFLLG 195
39 -9.2301npy_A mol:protein length:271 Hypothetical shikimate 5-dehydrogenase-like p  ali model follow..  14  64.......................................................................................MPFKETCMPFLDEIHPSAQAINDNGFLRAYNTDYIAIVLIEKYHLNKNAKVIVHGSGGMAKAVVAAFKNS-GFEKLKIYARNVKTGQYLAALYGYAYIN----SLENQQADILVNVTS----------------IGMKGGKEEMDLAFPKAFIDNASVAFD................................................................ 211
40 -9.1901p74_A mol:protein length:272 Shikimate 5-dehydrogenase  ali model follow..  17  62.......................................................................................SPFKERAYQLADEYSQRAKLAEACNTLKKLDDGKLYADNTDGIG--PNQHVLILGAGGATKGVLLPLLQA---QNIVLANRTFSKTKELAERFQGNIQAVSMDSIPLQTYDLVINATSA--------------------GLSGGTASVDAEILKLGSAFYDMQYAKGTDTPFIALCKSL-----------------GLTNVSDGFGMLVAQAAHSFHLW...... 253
41 -9.1801gcu_A mol:protein length:295 BILIVERDIN REDUCTASE A  ali model follow..  10  1.................................................................................................................................MDAEPKRKFVVVGVGRAGSVRLRDLKDPRSAAFLNLIGFVSRRELGSLDEV-----RQISLEDALREIDVAYICSESSS--YIRQFLQAGKHVLVEYPMTLSFAAAQEELAAQKGRVLHEEHVELLMEEFEFLRREVLGKELLKGSLRFTASPLEEERFGFPAFSGISRLTWLVSLFGELSL. 184
42 -9.1403pwz_A mol:protein length:272 Shikimate dehydrogenase 3  ali model follow..  16  63.......................................................................................APFKLRAFELADRRSERAQLAFEDGRIVAENFGLLRDIEENLGEPLRNRRVLLLGAGGAVRGALLPFLQA-GPSELVIANRDMAKALALRNELDHSRLRISRYEALGQSFDIVVNATSA--------------------SLTADLPPLPADVLGEAALAYE................................................................ 213
43 -9.1303phg_A mol:protein length:269 Shikimate dehydrogenase  ali model follow..  18  66.......................................................................................LPFKERAFQVCDKIKGIALECLENDELVGYNTDALGFYLS--LKQKNYQNALILGAGGSAKALACELKKQ----QVSVLNRSSRGLDFFQR-----LGCDCFMEPPKSAFDLIINATSA-----------------SLHNELPLNKEVLKGYFKEGKLAYD------------------AYGFLTPFL---SLAKELKTPFQDGKDMLIYQAALSFEKFSASQ.. 249
44 -9.1303pef_A mol:protein length:287 6-phosphogluconate dehydrogenase, NAD-binding  ali model follow..  15  1......................................................................................................................................SQKFGFIGLGIMGSAMAKNLVKA----SVTIWNRSPEKAEELAAL----AERAATPCEVVESCPVTFAMLADPAAAEE-EGIGEGRGYVDMSTVDPASQRIGVAVVAKGGRFLEAPVSGSKKPAE---------GTLIILAAGDRNLYDEAMPGFEKMGKKI................ 158
45 -9.1102uyy_A mol:protein length:316 N-PAC PROTEIN  ali model follow..  13  7.....................................................................................................................LGTENLYFQSMGSITPTDKKIGFLGLGLMGSGIVSNLLKM----TVTVWNRTAEKCDLFIQE----ARLGRTPAEVVSTCDITFACVSDPKAAKD-QGIRPGKCYVDMSTVDADVTELAQVIVSRGGRFLEAPVSGNQQLSN---------GMLVILAAGDRGLYEDCSSCFQAMGKTS................ 181
46 -9.0203f4l_A mol:protein length:345 Putative oxidoreductase yhhX  ali model follow..  15  4........................................................................................................................................NCAFIGFGKSTTYHLPYVLNRKDSWHVAHIFRRHAKPEEQAPIYSH-IHFTSDLDEVLNDVKLVVVCTHADSHFYAKRALEAGKNVLVEKPFTPTLAQAKEALAKSKGLTVTPYQNRRFDSCFLTAKKAIESGKLGEIVE.................................... 148

FFAS is supported by the NIH grant R01-GM087218-01
6 1 0 4 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.