current user: public




Query: 2i4a_A mol:protein length:107 thioredoxin, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst SEHTLAVSDSSFDQDVLKASGLVLVDFWAEWCGPCKMIGPALGEIGKEFAGKVTVAKVNIDDNPETPNAYQVRSIPTLMLVRDGKVIDKKVGALPKSQLKAWVESAQLast
1 -79.6002i4a_A mol:protein length:107 thioredoxin  ali model  100  1SEHTLAVSDSSFDQDVLKASGLVLVDFWAEWCGPCKMIGPALGEIGKEFAGKVTVAKVNIDDNPETPNAYQVRSIPTLMLVRDGKVIDKKVGALPKSQLKAWVESAQ 107
2 -78.4003dyr_A mol:protein length:111 Thioredoxin-1  ali model follow..  56  2SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGTPTLLLFKNGEVAATKVGALSKGQLKEFLDAN. 107
3 -78.3001keb_A mol:protein length:108 Thioredoxin 1  ali model follow..  55  1SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKLIASILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDAN. 106
4 -78.3002eir_A mol:protein length:108 Thioredoxin 1  ali model follow..  57  1SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKCFLDCN. 106
5 -78.2001zcp_A mol:protein length:108 Thioredoxin 1  ali model follow..  54  1SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCACAKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDAN. 106
6 -78.2001srx_A mol:protein length:108 THIOREDOXIN  ali model follow..  55  1SDKIIHLTDDSFDTDLVKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYIERGIPTLLLFKNGEVAATKVGALSKGQLKEFLDAN. 106
7 -78.2001txx_A mol:protein length:108 PROTEIN (THIOREDOXIN)  ali model follow..  55  1SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCVWCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDAN. 106
8 -78.1001t00_A mol:protein length:112 Thioredoxin  ali model follow..  46  4AGTLKHVTDDSFEQDVLKNDKPVLVDFWAAWCGPCRQIAPSLEAIAAEYGDKIEIVKLNIDENPGTAAKYGVMSIPTLNVYQGGEVAKTIVGAKPKAAIVRDLEDF. 109
9 -77.7001thx_A mol:protein length:115 THIOREDOXIN  ali model follow..  33  6SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTH. 111
10 -76.6002puk_C mol:protein length:106 Thioredoxin M-type, chloroplast (TRX-M)  ali model follow..  41  1..EVQDVNDSSWKEFVLESEVPVMVDFWAPWCGPSKLIAPVIDELAKEYSGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAVPKSTLTDSIEKY. 104
11 -76.5001dby_A mol:protein length:107 CHLOROPLAST THIOREDOXIN M CH2  ali model follow..  42  2..EAGAVNDDTFKNVVLESSVPVLVDFWAPWCGPCRIIAPVVDEIAGEYKDKLKCVKLNTDESPNVASEYGIRSIPTIMVFKGGKKCETIIGAVPKATIVQTVEKY. 105
12 -76.0002o8v_B mol:protein length:128 Thioredoxin 1  ali model follow..  56  15SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPAKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDAN. 120
13 -76.0002i1u_A mol:protein length:121 Thioredoxin  ali model follow..  49  11KSATIKVTDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERATDLTVAKLDVDTNPETARNFQVVSIPTLILFKDGQPVKRIVGAKGKAALLRELSDV. 116
14 -74.9003VFI Entity 1(prereleased)  ali follow..  27  1...LRSLSDSDFQLEVRQHPDPIIIMFTGSWCQPCKKMKPTFEEMASQMEGDIRFAYMDAEDAEKTMAELNIRTLPSLALFVDGMIREVFSGTMNKSDLRYWINNN. 103
15 -73.8002cvk_A mol:protein length:110 Thioredoxin  ali model follow..  49  2.AKPIEVTDQNFD-ETLGQHPLVLVDFWAEWCAPCRMIAPILEEIAKEYEGKLLVAKLDVDENPKTAMRYRVMSIPTVILFKDGQPVEVLVGAQPKRNYQAKIEKH. 105
16 -73.5003tco_A mol:protein length:109 Thioredoxin (TrxA-1)  ali model follow..  33  3EDVTLVLTEENFD-EVIRNNKLVLVDCWAEWCAPCHLYEPIYKKVAEKYKGKAVFGRLNVDENQKIADKYSVLNIPTTLIFVNGQLVDSLVGAVDEDTLESTVNKY. 107
17 -73.5001oaz_A mol:protein length:123 THIOREDOXIN 1  ali model follow..  57  2SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDAN. 121
18 -73.0001nw2_A mol:protein length:105 THIOREDOXIN  ali model follow..  44  2...TMTLTDANFQ-QAIQGDKPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGEPVKQLIGYQPKEQLEAQLADV. 103
19 -73.0001nsw_A mol:protein length:105 THIOREDOXIN  ali model follow..  45  2...TMTLTDANFQ-QAIQGDGPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGRPVKQLIGYQPKEQLEAQLADV. 103
20 -72.6003hz4_A mol:protein length:140 Thioredoxin  ali model follow..  27  5GSSIIEFEDMTWSQQVEDSKKPVVVMFYSPACPYCKAMEPYFEEYAKEYGSSAVFGRINIATNPWTAEKYGVQGTPTFKFFCHGRPVWEQVGQIYPSILKNAVRDM. 110
21 -72.3002o7k_A mol:protein length:107 Thioredoxin  ali model follow..  44  5..AIVKVTDADFDSKVESG--VQLVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH. 106
22 -72.3002o89_A mol:protein length:107 Thioredoxin  ali model follow..  42  5..AIVKVTDADFDSKVESG--VQLVDFWATWCGTSKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKH. 106
23 -72.1003gnj_A mol:protein length:111 Thioredoxin domain protein  ali model follow..  15  5..SLEKLDTNTFEQLIYDEGKACLVMFSRKNCHVCQKVTPVLEELRLNYEESFGFYYVDVEEEKTLFQRFSLKGVPQILYFKDGEYKGKMAGDVEDDEVEQMIADV. 108
24 -71.9002voc_A mol:protein length:112 THIOREDOXIN  ali model follow..  42  2..AIVKATDQSFSAET--SEGVVLADFWAPWCGPSKMIAPVLEELDQEMGDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKDGEVVETSVGFKPKEALQELVNKH. 103
25 -71.8001uvz_A mol:protein length:119 THIOREDOXIN  ali model follow..  36  6STTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKL. 111
26 -70.3002l5l_A mol:protein length:136 Thioredoxin  ali model follow..  28  21..AKVYNFEKNPEEWKYEGDKPAIVDFYADWCGPCKMVAPILDELAKEYDGQIVIYKVDTEKEQELAGAFGIRSIPSILFIPMEGKPEMAQGAMPKASFKKAIDEF. 124
27 -70.1003ul3_B mol:protein length:128 Thioredoxin  ali model follow..  20  23KVPRLQQNGSNIINGVNMKNTVIVLYFFAKWCQACTMQSTEMDKLQKYYGKRIYLLKVDLDKNESLARKFSVKSLPTIILLKNKTMLARKDHFVSSNDLIALIKKH. 128
28 -69.1003hxs_A mol:protein length:141 Thioredoxin  ali model follow..  36  21QSGTIHLTRAEFLKKIALGDKPAIVDFYADWCGPCKMVAPILEELSKEYAGKIYIYKVNVDKEPELARDFGIQSIPTIWFVPMKGEPQVNMGALSKEQLKGYIDKV. 137
29 -68.3002e0q_A mol:protein length:104 thioredoxin  ali model follow..  31  1...VIHLDSKNFD-SFLASHEIAVVDFWAEWCAPCLILAPIIEELAEDY-PQVGFGKLNSDENPDIAARYGVMSLPTVIFFKDGEPVDEIIGAVPREEIEIRIKNL. 101
30 -68.0003hhv_A mol:protein length:110 Thioredoxin (TrxA-2)  ali model follow..  28  5KEPVKHLNSKNFD-EFITKNKIVVVDFWAEWCAPCLILAPVIEELANDY-PQVAFGKLNTEESQDIAMRYGIMSLPTIMFFKNGELVDQILGAVPREEIEVRLKSL. 108
31 -67.9003emx_A mol:protein length:135 Thioredoxin  ali model follow..  20  15DGRLIYITPEEFRQLL---QGDAILAVYSKTCPHCHRDWPQLIQASKEVDVPIVIGERELSAARLEMNKAGVEGTPTLVFYKEGRIVDKLVGATPWSLKVEKAREI. 124
32 -64.1002j23_A mol:protein length:121 THIOREDOXIN  ali model follow..  34  8RGSVQVISSYDQFKQVTGGDKVVVIDFWATWCGPCKMIGPVFEKISDTPAGKVGFYKVDVDEQSQIAQEVGIRAMPTFVFFKNGQKIDTVVGADPS-KLQAAITQH. 113
33 -63.9001m7t_A mol:protein length:107 Chimera of Human and E. coli thioredoxin  ali model follow..  38  1..MVKQIESKTAFQEALDADKLVVVDFSATWCGPCKMIKPFFHSLSEKYSN-VIFLEVDVDDAQDVAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDAN. 105
34 -63.5003p2a_A mol:protein length:148 Putative thioredoxin-like protein  ali model follow..  37  37DGEVINATAETLD-KLLQDDLPMVIDFWAPWCGPCRSFAPIFAETAAERAGKVRFVKVNTEAEPALSTRFRIRSIPTIMLYRNGKMIDMLNGAVPKAPFDNWLDEQ. 141
35 -62.6002ppt_A mol:protein length:155 thioredoxin-2  ali model follow..  28  46.TGKVAGIDPAILARAERDDLPLLVDFWAPWCGPCRQMAPQFQAAAATLAGQVRLAKIDTQAHPAVAGRHRIQGIPAFILFHKGRELARAAGARPASELVGFVRGK. 150
36 -62.6001v98_A mol:protein length:140 thioredoxin  ali model follow..  39  33.PWVVEADEKGFAQEVAGAP-LTLVDFFAPWCGPCRLVSPILEELARDHAGRLKVVKVNVDEHPGLAARYGVRSVPTLVLFRRGAPVATWVGASPRRVLEERLRPY. 136
37 -62.5001xwa_A mol:protein length:111 thioredoxin  ali model follow..  34  11......KDKADLDGQLTKSGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAK-RLEDVIKAN. 110
38 -62.5003aps_A mol:protein length:122 DnaJ homolog subfamily C member 10  ali model follow..  21  2PQASIDLTPQTFNEKVLQGKTHWVVDFYAPWCGPCQNFAPEFELLARMIKGKVRAGKVDCQAYPQTCQKAGIKAYPSVKLYQYERAKKSIWEEQINSRDAKTIAA.. 106
39 -62.4001ep7_A mol:protein length:112 THIOREDOXIN CH1, H-TYPE  ali model follow..  33  2GSVIVIDSKAAWDAQLAKEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKVDVDAVAAVAEAAGITAMPTFHVYKDGVKADDLVGA-SQDKLKALVAKH. 109
40 -61.9002dj0_A mol:protein length:137 Thioredoxin-related transmembrane protein 2  ali model follow..  20  6SGYIKYFNDKTIDEELERDRVTWIVEFFANWSNDCQSFAPIYADLSLKYNTGLNFGKVDVGRYTDVSTRYKVKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEE 120
41 -61.7002l6c_A mol:protein length:110 Thioredoxin  ali model follow..  22  2.SAIRDITTEAGMAHF-EGLSDAIVFFHKNLCPHCKNMEKVLDKFGARA-PQVAISSVDSEARPELMKELGFERVPTLVFIRDGKVAKVFSGIMNPRELQALYAS.. 103
42 -61.2002oe0_A mol:protein length:114 Thioredoxin-3  ali model follow..  28  7..SITKLTNLTEFRNLIKQNDKLVIDFYATWCGPCKMMQPHLTKLIQAY-PDVRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPT-ALEKGIKD.. 107
43 -60.4003dxb_A mol:protein length:222 thioredoxin N-terminally fused to Puf60(UHM)  ali model follow..  57  5SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDAN. 110
44 -59.7003f3q_A mol:protein length:109 Thioredoxin-1  ali model follow..  30  1..MVTQFKTASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYP-QADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPA-AIKQAIAAN. 102
45 -59.6002fa4_A mol:protein length:111 Thioredoxin II  ali model follow..  33  4...TQLKSASEYDSALASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQY-SDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPA-AIKQAIASN. 104
46 -59.6001syr_A mol:protein length:112 thioredoxin  ali model follow..  33  2.AMVKIVTSQAEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECSKTY-TKMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGA-NDSALKQLIEKY. 104
47 -58.8001r26_A mol:protein length:125 Thioredoxin  ali model follow..  30  14..SVVDVYSVEQFRNIMSEDILTVAWFTAVWCGPCKTIERPMEKIAYEFP-TVKFAKVDADNNSEIVSKCRVLQLPTFIIARSGKMLGHVIGANPG-MLRQKLRDI. 115
48 -58.7001x5d_A mol:protein length:133 Protein disulfide-isomerase A6  ali model follow..  28  6SGDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDL. 115
49 -58.4002vim_A mol:protein length:104 THIOREDOXIN  ali model follow..  31  2...RVLATAADLEKLINENGRLIVVDFFAQWCGPCRNIAPKVEALAKEI-PEVEFAKVDVDQNEEAAAKYSVTAMPTFVFIKDGKEVDRFSGA-NETKLRETITRHK 104
50 -58.3002l57_A mol:protein length:126 Uncharacterized protein  ali model follow..  16  7KQINFQSINVVENLEEAKEGIPTIIMFKTDTCPYCVEMQKELSYVSKEREGKFNIYYARLEKNIDLAYKYDANIVPTTVFLKEGNKFYVHQGLMRKNNIETILNS.. 114
51 -58.1002f51_A mol:protein length:118 thioredoxin  ali model follow..  34  7...HFNGTHEALLNRIKEAPGLVLVDFFATWCGPCQRLGQILPSIAEAN-KDVTFIKVDVDKNGNAADAYGVSSIPALFFVKKEGNEIKTLDQFDVSRIKADIEKFK 112
52 -58.0001faa_A mol:protein length:124 THIOREDOXIN F  ali model follow..  23  17VGKVTEVNKDTFWPIVKAADKPVVLDMFTQWCGPCKAMAPKYEKLAEEYLD-VIFLKLDCNENKTLAKELGIRVVPTFKILKENSVVGEVTGAKYD-KLLEAIQAAR 123
53 -57.8003d6i_A mol:protein length:112 Monothiol glutaredoxin-3  ali model follow..  18  4..EINDQEQFTYLTTTAAGDKLIVLYFHTSWAEPCKALKQVFEAISNEPSSNVSFLSIDADENSEISELFEISAVPYFIIIHKGTILKELSGADPK-EYVSLLEDC. 107
54 -57.7001x5c_A mol:protein length:121 Protein disulfide-isomerase  ali model follow..  22  6SGPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVINGERTLDGFKKFLESG. 113
55 -56.6002dml_A mol:protein length:130 Protein disulfide-isomerase A6  ali model follow..  26  16SDDVIELTPSNFNREVIQSDGLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVNADKHQSLGGQYGVQGFPTIKIFGANKKPEDYQGGRTGEAIVDAALSA. 122
56 -56.4003qdn_A mol:protein length:287 Putative thioredoxin protein  ali model follow..  22  6VQNIVNINESNLQQTLEQSTTPVLFYFWSERSQHCLQLTPVLESLAAQYHGQFILAKLDCDAEQMIAAQFGLRAIPTVYLFQNGQPVDGFQGPQPEEAIRALLDKV. 112
57 -56.4002xbi_A mol:protein length:108 THIOREDOXIN  ali model follow..  27  4SKLIELKQDGDLESLLEQHNKLVVVDFFATWCGPCKTIAPLFKELSEKY--DAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIA-KVEDMIKKF. 107
58 -56.3002dj3_A mol:protein length:133 Protein disulfide-isomerase A4  ali model follow..  28  6SGPVKVVVGKTFDAIVMDPKKDVLIEFYAPWCGHCKQLEPIYTSLGKKYKGQLVIAKMDATANDITNDQYKVEGFPTIYFAPSGDKIKFEGGNRDLEHLSKFIDEH. 116
59 -56.2002xbq_A mol:protein length:117 THIOREDOXIN  ali model follow..  28  13SELIELKQDGDLESLLEQHNKLVVVDFFATWCGPCKTIAPLFKELSEKY--DAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIA-KVEDMIKKF. 116
60 -56.0003qou_A mol:protein length:287 protein ybbN  ali model follow..  23  6VENIVNINESNLQQVLEQSTTPVLFYFWSERSQHCLQLTPILESLAAQYNGQFILAKLDCDAEQMIAAQFGLRAIPTVYLFQNGQPVDGFQGPQPEEAIRALLDKV. 112
61 -55.6003ZZX Entity 1(prereleased)  ali follow..  32  7.......DQEDFTKQLNEANKLVVIDFYATWCGPCKMIAPKLEELSQSM-SDVVFLKVDVDECEDIAQDNQIACMPTFLFMKNGQKLDSLSGA-NYDKLLELVEKNK 105
62 -55.2001ti3_A mol:protein length:113 thioredoxin H  ali model follow..  36  8ACHTVDTWKEHFE-KGKGSQKLIVVDFTASWCPPCKMIAPIFAELAKKF-PNVTFLKVDVDELKAVAEEWNVEAMPTFIFLKDGKLVDKTVGA-DKDGLPTLVAKH. 110
63 -54.4002av4_A mol:protein length:160 Thioredoxin-like protein 4A (DIM1)  ali model follow..  16  22.......SGWAVDQAIVNEERLVCIRFGHDYDPDCMKMDELLYKVADDIKNFCVIYLVDITEVPDFNTMYELYDPVSVMFFYRNKHMMIDLGTGNNNKINWPMNNKQ 122
64 -54.4001qgv_A mol:protein length:142 SPLICEOSOMAL PROTEIN U5-15KD  ali model follow..  19  9......HNGWQVDQAILEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQ 110
65 -54.3002diz_A mol:protein length:117 Thioredoxin domain-containing protein 5  ali model follow..  32  6SGTVLALTENNFDDTI--AEGITFIKFYAPWCGHCKTLAPTWEELSKKELAGVKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSLHRFVLSQ. 112
66 -54.0003Q6O Entity 1(prereleased)  ali follow..  19  11SDPLTLLQADTVRGAVLGSRSAWAVEFFASWCGHCIAFAPTWXGGSYLAREKGVAVRRVLNTEANVVRKFGVTDFPSCLLFRNGSVSRVPVLMESRSFYTAYLQRL. 125
67 -53.1002vm1_A mol:protein length:118 THIOREDOXIN H ISOFORM 1.  ali model follow..  29  6GAVIACHTKQEFDTHMANTGKLVIIDFTASWCGPCRVIAPVFAEYAKKFPG-AIFLKVDVDELKDVAEAYNVEAMPTFLFIKDGEKVDSVVGGRKD-DIHTKIVAL. 112
68 -52.7001gh2_A mol:protein length:107 THIOREDOXIN-LIKE PROTEIN  ali model follow..  25  8.......SDPDFQPELSGASRLAVVKFTMRGCGPCLRIAPAFSSMSNKYP-QAVFLEVDVHQCQGTAATNNISATPTFQFFRNKVRIDQYQGA-DAVGLEEKIKQH. 105
69 -52.6003kd0_A mol:protein length:105 Thioredoxin  ali model follow..  31  7.......SKTAFQEALDAADKLVVVDFSATWCGPSKMIKPFFHSLSEKY-SNVIFLEVDVDDSQDVASESEVKSMPTFQFFKKGQKVGEFSGA-NKEKLEATINEL. 104
70 -52.6001aiu_A mol:protein length:105 THIOREDOXIN  ali model follow..  30  7.......SKTAFQEALDAADKLVVVDFSATWCGPCKMIKPFFHSLSEKY-SNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGA-NKEKLEATINEL. 104
71 -52.4002diy_A mol:protein length:130 Thioredoxin-like protein 2  ali model follow..  27  18AAVEEVGSAGQFEELLLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELP-QVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAP-ELTKKVQRH. 122
72 -52.4003e3e_A mol:protein length:105 Thioredoxin  ali model follow..  30  7.......SKTAFQEALDAADKLVVVDFSATWCGPSKMIKPFFHSLSEKY-SNVIFLEVDVDDCQDVASECEVKRMPTFQFFKKGQKVGEFSGA-NKEKLEATINEL. 104
73 -52.2001erv_A mol:protein length:105 THIOREDOXIN  ali model follow..  32  7.......SKTAFQEALDAADKLVVVDFSATWCGPCKMIKPFFHSLSEKY-SNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGA-NKEKLEATINEL. 104
74 -52.2001xbs_A mol:protein length:149 Dim1-like protein  ali model follow..  12  9......TSKKEVDQAIKSTEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQ 110
75 -52.2001cqg_A mol:protein length:105 THIOREDOXIN  ali model follow..  30  7.......SKTAFQEALDAADKLVVVDFSATWCGPAKMIKPFFHSLSEKY-SNVIFLEVDVDDAQDVASEAEVKATPTFQFFKKGQKVGEFSGA-NKEKLEATINEL. 104

FFAS is supported by the NIH grant R01-GM087218-01
5 7 2 2 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Li Z, Li W, Godzik A. FFAS03: a server for profile--profile sequence alignments. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W284-8.