current user: public




Query: 2i4a_A mol:protein length:107 thioredoxin, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst SEHTLAVSDSSFDQDVLKASGLVLVDFWAEWCGPCKMIGPALGEIGKEFAGKVTVAKVNIDDNPETPNAYQVRSIPTLMLVRDGKVIDKKVGALPKSQLKAWVESAQLast
1 -81.3003dyr_A mol:protein length:111 Thioredoxin-1  ali model follow..  56  2SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGTPTLLLFKNGEVAATKVGALSKGQLKEFLDANL 108
2 -81.3002i4a_A mol:protein length:107 thioredoxin  ali model  100  1SEHTLAVSDSSFDQDVLKASGLVLVDFWAEWCGPCKMIGPALGEIGKEFAGKVTVAKVNIDDNPETPNAYQVRSIPTLMLVRDGKVIDKKVGALPKSQLKAWVESAQ 107
3 -81.1002eir_A mol:protein length:108 Thioredoxin 1  ali model follow..  57  1SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKCFLDCNL 107
4 -81.1001txx_A mol:protein length:108 PROTEIN (THIOREDOXIN)  ali model follow..  55  1SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCVWCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL 107
5 -81.1001zcp_A mol:protein length:108 Thioredoxin 1  ali model follow..  54  1SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCACAKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL 107
6 -81.0001keb_A mol:protein length:108 Thioredoxin 1  ali model follow..  55  1SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKLIASILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL 107
7 -81.0001srx_A mol:protein length:108 THIOREDOXIN  ali model follow..  55  1SDKIIHLTDDSFDTDLVKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYIERGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL 107
8 -81.0004hu7_A mol:protein length:108 Thioredoxin-1  ali model follow..  54  1SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGACKMIAAILDEIADEYQGKLTVAKLNIDQNAGTAAKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL 107
9 -79.4002yn1_A mol:protein length:106 LGPCA THIOREDOXIN  ali model follow..  61  2..SIIHVTDDSFDQDVLKADKPVLVDFWAEWCGPCKMIAPILDEIAEEYEGKLKVAKVNIDENPETAAKYGIRGIPTLMLFKNGEVAATKVGALSKSQLKEFLDANL 106
10 -78.8001t00_A mol:protein length:112 Thioredoxin  ali model follow..  45  4AGTLKHVTDDSFEQDVLKNDKPVLVDFWAAWCGPCRQIAPSLEAIAAEYGDKIEIVKLNIDENPGTAAKYGVMSIPTLNVYQGGEVAKTIVGAKPKAAIVRDLEDFI 110
11 -78.7001thx_A mol:protein length:115 THIOREDOXIN  ali model follow..  33  6SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHL 112
12 -78.4002yj7_A mol:protein length:106 LPBCA THIOREDOXIN  ali model follow..  51  2..SVIEVTDENFEQEVLKSDKPVLVDFWAPWCGPCRMIAPIIEELAKEYEGKVKVVKVNVDENPNTAAQYGIRSIPTLLLFKNGQVVDRLVGAQPKEALKERIDKHL 106
13 -78.2001dby_A mol:protein length:107 CHLOROPLAST THIOREDOXIN M CH2  ali model follow..  41  2..EAGAVNDDTFKNVVLESSVPVLVDFWAPWCGPCRIIAPVVDEIAGEYKDKLKCVKLNTDESPNVASEYGIRSIPTIMVFKGGKKCETIIGAVPKATIVQTVEKYL 106
14 -78.1002o8v_B mol:protein length:128 Thioredoxin 1  ali model follow..  56  15SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPAKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL 121
15 -78.1004ba7_A mol:protein length:106 LBCA THIOREDOXIN  ali model follow..  50  2..SVIEINDENFEEEVLKSDKPVLVDFWAPWCGPCRMIAPIIEELAEEYEGKVKFAKVNVDENPETAAKYGIMSIPTLLLFKNGEVVDKLVGARPKEALKERIEKHL 106
16 -77.9002puk_C mol:protein length:106 Thioredoxin M-type, chloroplast (TRX-M)  ali model follow..  40  1..EVQDVNDSSWKEFVLESEVPVMVDFWAPWCGPSKLIAPVIDELAKEYSGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAVPKSTLTDSIEKYL 105
17 -77.2004pob_A mol:protein length:117 Thioredoxin  ali model follow..  46  5DHATVTVTDDSFQEDVVSSNKPVLVDFWATWCGPCKMVAPVLEEIAKDHGEALTIAKLDVDANPETARAFQVTSIPTLILFQNGEATKRIVGAKSKSALLRELDGVV 111
18 -76.8003vfi_A mol:protein length:104 thioredoxin  ali model follow..  26  1...LRSLSDSDFQLEVRQHPDPIIIMFTGSWCQPCKKMKPTFEEMASQMEGDIRFAYMDAEDAEKTMAELNIRTLPSLALFVDGMIREVFSGTMNKSDLRYWINNNI 104
19 -76.6003ziv_A mol:protein length:106 AECA THIOREDOXIN  ali model follow..  46  2..SVIEINDENFDEVIKKSDKVVVVDFWAEWCGPCRMIAPIIEELAEEYAGKVVFGKVNVDENPEIAAKYGIMSIPTLLFFKNGKVVDQLVGARPKEALKERIKKYL 106
20 -76.6002ynx_A mol:protein length:106 LACA THIOREDOXIN  ali model follow..  46  2..SVVQLNDENFDEVIKKNNKVVVVDFWAEWCGPCRMIAPIIEELAKEYAGKVVFGKLNVDENPEIAAKYGIMSIPTLLFFKNGKVVDQLVGAMPKEALKERIKKYL 106
21 -76.6004wxt_A mol:protein length:125 Thioredoxin  ali model follow..  50  11..ATIEVSDASFSTDVLASNKPVLVDFWATWCGPCKMVAPVLEEIASERGDHLTVAKLDVDANPETAQNFQVVSIPTLILFKDGQPVKRIVGAKGKAALLRELSDAV 115
22 -76.5004knd_A mol:protein length:112 Thioredoxin  ali model follow..  43  6SNDVVVLQDSTFEQEVLKSDTPVLVDFWAVWCGPCKAIAPVVDDLAARYKGKLKVAKMDVDQHQGVPQQYGIRSIPTLLVFKGGRVVDTVIGA-DKTRLEDSVKKAI 111
23 -76.4002i1u_A mol:protein length:121 Thioredoxin  ali model follow..  48  11KSATIKVTDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERATDLTVAKLDVDTNPETARNFQVVSIPTLILFKDGQPVKRIVGAKGKAALLRELSDVV 117
24 -75.2003dxb_A mol:protein length:222 thioredoxin N-terminally fused to Puf60(UHM)  ali model follow..  57  5SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL 111
25 -75.0003hz4_A mol:protein length:140 Thioredoxin  ali model follow..  27  5GSSIIEFEDMTWSQQVEDSKKPVVVMFYSPACPYCKAMEPYFEEYAKEYGSSAVFGRINIATNPWTAEKYGVQGTPTFKFFCHGRPVWEQVGQIYPSILKNAVRDML 111
26 -74.8002cvk_A mol:protein length:110 Thioredoxin  ali model follow..  48  2.AKPIEVTDQNFD-ETLGQHPLVLVDFWAEWCAPCRMIAPILEEIAKEYEGKLLVAKLDVDENPKTAMRYRVMSIPTVILFKDGQPVEVLVGAQPKRNYQAKIEKHL 106
27 -74.5001nw2_A mol:protein length:105 THIOREDOXIN  ali model follow..  43  1..ATMTLTDANFQ-QAIQGDKPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGEPVKQLIGYQPKEQLEAQLADVL 104
28 -74.4003tco_A mol:protein length:109 Thioredoxin (TrxA-1)  ali model follow..  33  3EDVTLVLTEENFD-EVIRNNKLVLVDCWAEWCAPCHLYEPIYKKVAEKYKGKAVFGRLNVDENQKIADKYSVLNIPTTLIFVNGQLVDSLVGAVDEDTLESTVNKYL 108
29 -74.4001nsw_A mol:protein length:105 THIOREDOXIN  ali model follow..  44  1..ATMTLTDANFQ-QAIQGDGPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGRPVKQLIGYQPKEQLEAQLADVL 104
30 -74.2001oaz_A mol:protein length:123 THIOREDOXIN 1  ali model follow..  57  2SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL 122
31 -73.1002o7k_A mol:protein length:107 Thioredoxin  ali model follow..  43  5..AIVKVTDADFDSKVESG--VQLVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL 107
32 -73.1002o89_A mol:protein length:107 Thioredoxin  ali model follow..  41  5..AIVKVTDADFDSKVESG--VQLVDFWATWCGTSKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL 107
33 -72.7003gnj_A mol:protein length:111 Thioredoxin domain protein  ali model follow..  15  5..SLEKLDTNTFEQLIYDEGKACLVMFSRKNCHVCQKVTPVLEELRLNYEESFGFYYVDVEEEKTLFQRFSLKGVPQILYFKDGEYKGKMAGDVEDDEVEQMIADVL 109
34 -72.7004xhm_A mol:protein length:137 Thioredoxin (Trx-3)  ali model follow..  47  32LDSPVKLNSSNFD-ETLKNNENVVVDFWAEWCHPCKMIAPVIEELAKEYAGKVVFGKLNTDENPTIAARYGISAIPTLIFFKKGKPVDQLVGAMPKSELKRWVQRNL 137
35 -72.5002voc_A mol:protein length:112 THIOREDOXIN  ali model follow..  41  2..AIVKATDQSFSAET--SEGVVLADFWAPWCGPSKMIAPVLEELDQEMGDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKDGEVVETSVGFKPKEALQELVNKHL 104
36 -70.6002mcs_A mol:protein length:128 Thioredoxin  ali model follow..  32  14GSMIEQIGDSEFDNKVTSDNILILVDFWAPWCGPCRSLEPQLEKLAQQYTENVKIYKINIEDNQDVATQYGVSAIPTILMFKNGKKLSQVIGADISKIISEINNN.. 120
37 -69.2001uvz_A mol:protein length:119 THIOREDOXIN  ali model follow..  37  5GSTTFNIQDPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLI 112
38 -67.8004o32_A mol:protein length:138 Thioredoxin  ali model follow..  20  31..PRLQQNGSNIINGVNMKNTVIVLYFFAKWCQACTMQSTEMDKLQKYYGKRIYLLKVDLDKNESLARKFSVKSLPTIILLKNKTMLARKDHFVSSNDLIALIKKHL 135
39 -67.6003hhv_A mol:protein length:110 Thioredoxin (TrxA-2)  ali model follow..  28  5KEPVKHLNSKNFD-EFITKNKIVVVDFWAEWCAPCLILAPVIEELANDY-PQVAFGKLNTEESQDIAMRYGIMSLPTIMFFKNGELVDQILGAVPREEIEVRLKSLL 109
40 -67.5002e0q_A mol:protein length:104 thioredoxin  ali model follow..  31  1...VIHLDSKNFD-SFLASHEIAVVDFWAEWCAPCLILAPIIEELAEDY-PQVGFGKLNSDENPDIAARYGVMSLPTVIFFKDGEPVDEIIGAVPREEIEIRIKNLL 102
41 -64.2002l5l_A mol:protein length:136 Thioredoxin  ali model follow..  29  8NGKVIHLTKAEFLAKVYEGDKPAIVDFYADWCGPCKMVAPILDELAKEYDGQIVIYKVDTEKEQELAGAFGIRSIPSILFIPMEGKPEMAQGAMPKASFKKAIDEFL 125
42 -64.1003aps_A mol:protein length:122 DnaJ homolog subfamily C member 10  ali model follow..  21  2PQASIDLTPQTFNEKVLQGKTHWVVDFYAPWCGPCQNFAPEFELLARMIKGKVRAGKVDCQAYPQTCQKAGIKAYPSVKLYQYERAKKSQINSRDAKTIAALIYGKL 112
43 -63.7003hxs_A mol:protein length:141 Thioredoxin  ali model follow..  36  21QSGTIHLTRAEFLKKIYLGDKPAIVDFYADWCGPCKMVAPILEELSKEYAGKIYIYKVNVDKEPELARDFGIQSIPTIWFVPMKGEPQVNMGALSKEQLKGYIDKVL 138
44 -63.5001m7t_A mol:protein length:107 Chimera of Human and E. coli thioredoxin  ali model follow..  37  2...VKQIESKTAFQEALDADKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVI-FLEVDVDDAQDVAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL 106
45 -62.1003emx_A mol:protein length:135 Thioredoxin  ali model follow..  20  15DGRLIYITPEEFRQLL---QGDAILAVYSKTCPHCHRDWPQLIQASKEVDVPIVIGERELSAARLEMNKAGVEGTPTLVFYKEGRIVDKLVGATPWSLKVEKAREIY 125
46 -62.1002j23_A mol:protein length:121 THIOREDOXIN  ali model follow..  34  8RGSVQVISSYDQFKQVTGGDKVVVIDFWATWCGPCKMIGPVFEKISDTPAGKVGFYKVDVDEQSQIAQEVGIRAMPTFVFFKNGQKIDTVVGADPS-KLQAAITQHS 114
47 -60.2002yoi_A mol:protein length:106 LECA THIOREDOXIN  ali model follow..  37  6......TNKEEFEAILSEADKLVVVDFFATWCGPCKMIAPFFEELSEEYPDKVVFIKVDVDEVPDVAAKYGITSMPTFKFFKNGKKVDELVGA-NQEKLKQMILKH. 104
48 -57.8002lrc_A mol:protein length:114 Probable thioredoxin  ali model follow..  25  2..KTRYSAEAPARDELDRLAGPTLVEFGTDWCGHCQAAQPLLAEVFSDYPE-VGHLKVEDGPGRRLGRSFQVKLWPTFVFLRDGREVARVVRPGSASVLEEAFESLV 105
49 -57.7002l6c_A mol:protein length:110 Thioredoxin  ali model follow..  22  2.SAIRDITTEAGM-AHFEGLSDAIVFFHKNLCPHCKNMEKVLDKFGARA-PQVAISSVDSEARPELMKELGFERVPTLVFIRDGKVAKVFSGIMNPRELQALYAS.. 103
50 -57.2002dj0_A mol:protein length:137 Thioredoxin-related transmembrane protein 2  ali model follow..  20  6SGYIKYFNDKTIDEELERDRVTWIVEFFANWSNDCQSFAPIYADLSLKYNTGLNFGKVDVGRYTDVSTRYKVKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSE. 119
51 -57.0001v98_A mol:protein length:140 thioredoxin  ali model follow..  39  34..WVVEADEKGFAQEVAGAP-LTLVDFFAPWCGPCRLVSPILEELARDHAGRLKVVKVNVDEHPGLAARYGVRSVPTLVLFRRGAPVATWVGASPRRVLEERLRPYL 137
52 -56.8002l57_A mol:protein length:126 Uncharacterized protein  ali model follow..  17  2..SLEGIKQINFQSEEAKEGIPTIIMFKTDTCPYCVEMQKELSYVSKEREGKFNIYYARLEENIDLAYKYDANIVPTTVFLKEGNKFYVHQGLMRKNNIETILNSLG 116
53 -56.3004kca_A mol:protein length:692 Endo-1,5-alpha-L-arabinanase  ali model follow..  57  2SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL 108
54 -55.9002f51_A mol:protein length:118 thioredoxin  ali model follow..  35  8....FNGTHEALLNRIKEAPGLVLVDFFATWCGPCQRLGQILPSIAEAN-KDVTFIKVDVDKNGNAADAYGVSSIPALFFVKKEGNEIKTLDQFDVSRIKADIEKF. 111
55 -54.4004ruv_A mol:protein length:114 Thioredoxin  ali model follow..  20  1.GSMQSIKSNESFKSVINSDTPVIVKFEAGWCPDCRAMDLWIDPIVEQY-NDYQWYTVNRDELEDVVVENEVMGIPSLLVFKNGDKIAHLHSANAKSQVESFLAETF 107
56 -53.1003qdn_A mol:protein length:287 Putative thioredoxin protein  ali model follow..  22  6VQNIVNINESNLQQTLEQSTTPVLFYFWSERSQHCLQLTPVLESLAAQYHGQFILAKLDCDAEQMIAAQFGLRAIPTVYLFQNGQPVDGFQGPQPEEAIRALLDKVL 113
57 -52.8003qou_A mol:protein length:287 protein ybbN  ali model follow..  23  6VENIVNINESNLQQVLEQSTTPVLFYFWSERSQHCLQLTPILESLAAQYNGQFILAKLDCDAEQMIAAQFGLRAIPTVYLFQNGQPVDGFQGPQPEEAIRALLDKVL 113
58 -51.8003p2a_A mol:protein length:148 Putative thioredoxin-like protein  ali model follow..  36  37DGEVINATAETLDK-LLQDDLPMVIDFWAPWCGPCRSFAPIFAETAAERAGKVRFVKVNTEAEPALSTRFRIRSIPTIMLYRNGKMIDMLNGAVPKAPFDNWLDEQL 142
59 -51.0002ppt_A mol:protein length:155 thioredoxin-2  ali model follow..  29  53........DPAILARAERDDLPLLVDFWAPWCGPCRQMAPQFQAAAATLAGQVRLAKIDTQAHPAVAGRHRIQGIPAFILFHKGRELARAAGARPASELVGFVRGKL 151
60 -48.6002fa4_A mol:protein length:111 Thioredoxin II  ali model follow..  32  8.......SASEYDSALASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQYS-DAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGA-NPAAIKQAIASNV 105
61 -48.6003f3q_A mol:protein length:109 Thioredoxin-1  ali model follow..  29  2...VTQFKTASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYP-QADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGA-NPAAIKQAIAAN. 102
62 -48.1001qgv_A mol:protein length:142 SPLICEOSOMAL PROTEIN U5-15KD  ali model follow..  19  9......HNGWQVDQAILSEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDK. 109
63 -47.9001xbs_A mol:protein length:149 Dim1-like protein  ali model follow..  13  9......TSKKEVDQAIKTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTK. 109
64 -47.4002ypm_A mol:protein length:106 LAFCA THIOREDOXIN  ali model follow..  34  7.......NKDEFESILSEADKLVVVDFTATWCGPCKMIAPKFEELSEEYPDNVVFLKVDVDEVEDVAAEYGISAMPTFQFFKNGKKVDELTGA-NQEKLKAMIKKH. 104
65 -47.2004cw9_A mol:protein length:109 THIOREDOXIN  ali model follow..  32  3...VLHINALDQLTALLSTEKVIVIDFFATWCGPSRSISPYFEELAGQYN-NIKFVKVDVDQAEEICVNYKVRSMPTFVLVKDGIEQKRFSGA-DRNALKQMVETA. 103
66 -47.1001r26_A mol:protein length:125 Thioredoxin  ali model follow..  29  14..SVVDVYSVEQFRNIMSEDILTVAWFTAVWCGPCKTIERPMEKIAYEFP-TVKFAKVDADNNSEIVSKCRVLQLPTFIIARSGKMLGHVIGA-NPGMLRQKLRDII 116
67 -47.0002av4_A mol:protein length:160 Thioredoxin-like protein 4A (DIM1)  ali model follow..  15  22.......SGWAVDQAIVNEERLVCIRFGHDYDPDCMKMDELLYKVADDIKNFCVIYLVDITEVPDFNTMYELYDPVSVMFFYRNKHMMIDLGTGNNNKINWPMNNK. 121
68 -46.8004dss_B mol:protein length:112 Thioredoxin-2  ali model follow..  31  9.......SASEYDSALASGDKLVVVDFFATWCGPSKMIAPMIEKFAEQYS-DAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGA-NPAAIKQAIASNV 106
69 -46.3003jcm_L mol:protein length:143 Spliceosomal protein DIB1  ali model follow..  17  11.......TGWHVDQAIVTEKRLVVIRFGRKNDRQCMIMDELLSSIAERVRNFAVIYLCDIDEVSDFDEMYELTDPMTVMFFYHNKHMMCDFGTGNNNKLNFIVDDK. 110
70 -46.0004euy_A mol:protein length:105 Uncharacterized protein  ali model follow..  18  2...MNTFKTIEELATYIEEQQLVLLFIKTENCGVCDVMLRKVNYVLENY-NYVEKIEILLQDMQEIAGRYAVFTGPTVLLFYNGKEILRESRFISLENLERTIQLFE 104
71 -46.0001syr_A mol:protein length:112 thioredoxin  ali model follow..  33  2.AMVKIVTSQAEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECSKTYT-KMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGA-NDSALKQLIEKY. 104
72 -46.0004j56_E mol:protein length:114 Thioredoxin  ali model follow..  32  3SGSVKIVTSQAEFDSIISQNELVIVDFFAEWCGPSKRIAPFYEECSKTYT-KMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGA-NDSALKQLIEKY. 106
73 -45.9002mmn_A mol:protein length:104 Thioredoxin  ali model follow..  34  1..SVKIVTSQSEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECSKTYT-KMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGA-NDSALKQLIEKY. 102
74 -45.7002oe0_A mol:protein length:114 Thioredoxin-3  ali model follow..  27  7..SITKLTNLTEFRNLIKQNDKLVIDFYATWCGPCKMMQPHLTKLIQAYP-DVRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGA-NPTALEKGIKD.. 107
75 -45.0001xwa_A mol:protein length:111 thioredoxin  ali model follow..  34  12.......DKADLDGQLTKAGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGA-NAKRLEDVIKANI 111

FFAS is supported by the NIH grant R01-GM087218-01
8 2 8 1 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.