current user: public




2hr2A
Query: 2hr2_A mol:protein length:159 Hypothetical protein, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
# Score Template Links and tools%idFirst GMKPLKEVVGAYLALSDAQRQLVAGEYDEAAANCRRAMEISHTMPPEEAFDHAGFDAFCHAGLAEALAGLRSFDEALHSADKALHYFNRRGELNQDEGKLWISAVYSRALALDGLGRGAEAMPEFKKVVEMIEERKGETPGKERMMEVAIDRIAQLGASLast
1 -77.9002hr2_A mol:protein length:159 Hypothetical protein  ali model  100  1GMKPLKEVVGAYLALSDAQRQLVAGEYDEAAANCRRAMEISHTMPPEEAFDHAGFDAFCHAGLAEALAGLRSFDEALHSADKALHYFNRRGELNQDEGKLWISAVYSRALALDGLGRGAEAMPEFKKVVEMIEERKGETPGKERMMEVAIDRIAQLGAS 159
2 -50.3002lni_A mol:protein length:133 Stress-induced-phosphoprotein 1  ali model follow..  18  2GSHMNPDLALMVKN--KGNECFQKGDYPQAMKHYTEAIKRNPK------------DAKLYSNRAACYTKLLEFQLALKDCEECIQLEPT-----------FIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYN........ 127
3 -49.5003kd7_A mol:protein length:125 CTPR390  ali model follow..  19  2AMDPG-NSAEAWKNL--GNAYYKQGDYQKAIEYYQKALELDPN------------NASAWYNLGNAYYKQGDYQKAIEYYQKALELDPNNAK-----------AWYRRGNAYYKQGDYQKAIEDYQKALELDPNNAKAKQNLGNAKQKQG......... 125
4 -49.4002vyi_A mol:protein length:131 SGTA PROTEIN  ali model follow..  16  4GSEEDSAEAERLKT--EGNEQMKVENFEAAVHFYGKAIELNPA------------NAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPA-----------YSKAYGRMGLALSSLNKHVEAVAYYKKALELDPDNETYKSNLKIAELKLREA....... 130
5 -49.1002wqh_A mol:protein length:125 CTPR3Y3  ali model follow..  23  2AMDP-GNSAEAWYNL--GNAYYKQGDYDEAIEYYQKALELYPN------------NAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAE-----------AWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAKQNLGNAKQKQG......... 125
6 -49.1001na0_A mol:protein length:125 designed protein CTPR3  ali model follow..  23  2AMDPG-NSAEAWYNL--GNAYYKQGDYDEAIEYYQKALELDPN------------NAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAE-----------AWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAKQNLGNAKQKQG......... 125
7 -48.3002fo7_A mol:protein length:136 SYNTHETIC CONSENSUS TPR PROTEIN  ali model follow..  23  1........AEAWYNL--GNAYYKQGDYDEAIEYYQKALELDPR------------SAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAE-----------AWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEY. 125
8 -45.8003asg_A mol:protein length:186 MamA  ali model follow..  14  1.MGNDDIRQVYYRDK--GISHAKAGRYSQAVMLLEQVYDADAFDVDERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFN-----------VRFRLGVALKNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPH. 166
9 -45.7002q7f_A mol:protein length:243 YrrB protein  ali model follow..  16  5SSGLVPRGSHMASMTGGQQRGSEFGDYEKAAEAFTKAIEENKEDAIDKALELDSSAATAYYGAGNVYVVKEMYKEAKDMFEKALRAGMENGD-----------LFYMLGTVLVKLEQPKLALPYLQRAVELNENDTEARFQFGMCLANEGMLDEALSQ. 175
10 -45.7003fwv_A mol:protein length:128 Hsc70/Hsp90-organizing protein  ali model follow..  11  3.........QALKEKELGNDAYKKKDFDTALKHYDKAKELDPT------------NMTYIVNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRMI----AYAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPKVLKKCQQAEKILKEQ........ 128
11 -45.6001elr_A mol:protein length:131 TPR2A-DOMAIN OF HOP  ali model follow..  10  3.........QALKEKELGNDAYKKKDFDTALKHYDKAKELDPT------------NMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQ----IAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRDVLKKCQQAEKILKEQER........ 130
12 -45.6003as8_A mol:protein length:186 Magnetosome protein MamA  ali model follow..  15  1.MGNDDIRQVYYRDK--GISHAKAGRYSEAVVMLEQVYDADAFDVEERSIADAPDNIKVATVLGLTYVQVQKYDLAVPLLVKVAEANPVNFN-----------VRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAYSYEQMGSHEEALPH. 166
13 -45.4003sz7_A mol:protein length:164 Hsc70 cochaperone (SGT)  ali model follow..  14  4SMAPTPE---SDKLKSEGNAAMARKEYSKAIDLYTQALSIAPA------------NPIYLSNRAAAYSASGQHEKAAEDAELATVVDPK-----------YSKAWSRLGLARFDMADYKGAKEAYEKGIEAEGNGGSDAMKRGLETRKIEEANRGAEPP 138
14 -45.3003asd_A mol:protein length:200 MamA  ali model follow..  15  1.MGNDDIRQVYYEDK--GISHAKAGRYSQAVMLLEQVYDADAFDVDERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFN-----------VRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPH. 166
15 -44.9002pl2_A mol:protein length:217 Hypothetical conserved protein TTC0263  ali model follow..  17  31ALKENPQDPEALYWL--ARTQLKLGLVNPALENGKTLVARTPRYLGKDAERVNPRYAPLHLQRGLVYALLGERDKAEASLKQALALEDT------------PEIRSALAELYLSMGRLDEALAQYAKALEQAPKDLDLRVRYASALLLKGKAEEAARA. 207
16 -44.1003upv_A mol:protein length:126 Heat shock protein STI1  ali model follow..  18  3.........KAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPE------------DARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN-----------FVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQLYYKASQQRF... 126
17 -43.3002vgy_A mol:protein length:148 CHAPERONE SYCD  ali model follow..  18  13LNEISSDTLEQLYSL--AFNQYQSGKYEDAHKVFQALCVLDHY------------DSRFFLGLGACRQAMGQYDLAIHSYEEGAVMDIKEPR-----------FPFHAAECLLQKGELAEAESGLFLAQELKPEFKELSTRVSSMLEAIKLKKEMKH.. 147
18 -43.1002vgx_A mol:protein length:148 CHAPERONE SYCD  ali model follow..  18  13LNEISSDTLEQLYSL--AFNQYQSGKYEDAHKVFQALCVLDHY------------DSRFFLGLGACRQAMGQYDLAIHSYSYGAVMDIKEPR-----------FPFHAAECLLQKGELAEAESGLFLAQELKPEFKELSTRVSSMLEAIKLKKEMKH.. 147
19 -43.0003urz_A mol:protein length:208 Uncharacterized protein  ali model follow..  12  2......QSVDEMLQK--VSAAIEAGQNGQAVSYFRQTIALNIDRTEMNVDKNSEISSKLATELALAYKKNRNYDKAYLFYKELLQKAPNNVD-----------CLEACAEMQVCRGQEKDALRMYEKILQLEADNLAANIFLGNYYYLTAEQEKK.... 141
20 -42.8003uq3_A mol:protein length:258 Heat shock protein STI1  ali model follow..  12  64AVEQGREMRADYKVISKS--FARIGNAYHKLGDLKKTIEYYQKSLTEAEAYVNPEKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDAR-----------GYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALET. 229
21 -42.5003q47_B mol:protein length:137 STIP1 homology and U box-containing protein 1  ali model follow..  15  1..GPHMKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPL------------VAVYYTNRALCYLKMQQPEQALADCRRALELDGQ-----------SVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIE 134
22 -42.3001hxi_A mol:protein length:121 PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5  ali model follow..  9EANNPYMYHENPMEE--GLSMLKLANLAEAALAFEAVCQKEPE------------REEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIA-----------VHAALAVSHTNEHNANAALASLRAWLLSQPQYEQ...................... 120
23 -42.2003r9a_B mol:protein length:328 Peroxisomal targeting signal 1 receptor  ali model follow..  17  167AVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPN------------DYLLWNKLGATLANGNQSEEAVAAYRRALELQPG-----------YIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGELRLALSMLGQSDAYGAA. 312
24 -42.2002xcb_A mol:protein length:142 REGULATORY PROTEIN PCRH  ali model follow..  18  10LRGLSEDTLEQLYAL--GFNQYQAGKWDDAQKIFQALCMLDHY------------DARYFLGLGACRQSLGLYEQALQSYSYGALMDINEPR-----------FPFHAAECHLQLGDLDGAESGFYSARALQPAHEALAARAGAMLEAVTARKDR.... 142
25 -41.9002kck_A mol:protein length:112 TPR repeat  ali model follow..  14  1...MVDQNPEEYYLE--GVLQYDAGNYTESIDLFEKAIQLDPE------------ESKYWLMKGKALYNLERYEEAVDCYNYVINVIEDEYN---------KDVWAAKADALRYIEGKEVEAEIAEARAKLE........................... 106
26 -41.8001a17_A mol:protein length:166 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model follow..  17  5..PADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPS------------NAIYYGNRSLAYLRTECYGYALGDATRAIELDKK-----------YIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQKAFE.... 134
27 -41.8003cvq_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  12  81ARALDPADIAVHAAL--AVSHTNEHNANAALASLRAWLLSQPQYEQHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQ-----------LWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQ. 262
28 -41.7003cv0_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  12  81ARMLDPKDIAVHAAL--AVSHTNEHNANAALASLRAWLLSQPQYEQHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQ-----------LWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQ. 262
29 -41.1003fp2_A mol:protein length:537 TPR repeat-containing protein YHR117W  ali model follow..  14  302AVDLNPEYPPTYYHR--GQMYFILQDYKNAKEDFQKAQSLNPENVYNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIE.. 483
30 -41.1001xnf_A mol:protein length:275 Lipoprotein nlpI  ali model follow..  12  69ALAIRPDMPEVFNYL--GIYLTQAGNFDAAYEAFDSVLELDPTY------------NYAHLNRGIALYYGGRDKLAQDDLLAFYQDDPNDPFRS-SLAEHLSETNFYLGKYYLSLGDLDSATALFKLAVANNVHNFVEHRYALLELSLLGQDQDDLAE. 271
31 -40.9002bug_A mol:protein length:140 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model follow..  18  7..PADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPS------------NAIYYGNRSLAYLRTECYGYALNDATRAIELDKK-----------YIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQ........ 132
32 -40.8001elw_A mol:protein length:118 TPR1-DOMAIN OF HOP  ali model follow..  16  1.......MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPH------------NHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPD-----------WGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEAR........... 118
33 -40.8001wm5_A mol:protein length:208 Neutrophil cytosol factor 2  ali model follow..  3MGSMSLVEAISLWN--EGVLAADKKDWKGALDAFSAVQDPHSRI--TRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILGLACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKA................ 167
34 -40.7001w3b_A mol:protein length:388 UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUC  ali model follow..  15  59AIKQNPLLAEAYSNL--GNVYKERGQLQEAIEHYRHALRLKPDFIDVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPN-----------FAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAA. 225
35 -40.4001fch_A mol:protein length:368 PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR  ali model follow..  17  207AVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPN------------DYLLWNKLGATLANGNQSEEAVAAYRRALELQPG-----------YIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGELRLALSMLGQSDAYGAA. 352
36 -40.4003hym_B mol:protein length:330 Cell division cycle protein 16 homolog  ali model follow..  14  185ALSIAPEDPFVMHEV--GVVAFQNGEWKTAEKWFLDALEKIKAIGNEVT---VDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQN-----------ASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIG. 326
37 -40.2002dba_A mol:protein length:148 Smooth muscle cell associated protein-1, isof  ali model follow..  20  20..PATPGASSVEQLRKEGNELFKCGDYGGALAAYTQALGLDAT---------PQDQAVLHRNRAACHLKLEDYDKAETEASKAIEKDGG-----------DVKALYRRSQALEKLGRLDQAVLDLQRCVSLEPKNKVFQEALRNISGPSS......... 147
38 -40.0001hh8_A mol:protein length:213 NEUTROPHIL CYTOSOL FACTOR 2  ali model follow..  10  25ALAVQDPHSRICFNI--GCMYTILKNMTEAEKAFTRSINRDKHL------------AVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILGLACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKA................ 162
39 -39.9002vq2_A mol:protein length:225 PUTATIVE FIMBRIAL BIOGENESIS AND TWITCHING MO  ali model follow..  15  2..EKANQVSNIKTQL--AMEYMRGQDYRQATASIEDALKSDPK------------NELAWLVRAEIYQYLKVNDKAQESFRQALSIKPDSAEINNNYGWFLYIANLNKGICSAKQGQFGLAEAYLKRSLAAQPQFPPAFKELARTKMLAGQLGDADYY. 169
40 -39.8003k9i_A mol:protein length:117 BH0479 protein  ali model follow..  17  2......................VLGLEAQAVPYYEKAIASGLQ---------GKDLAECYLGLGSTFRTLGEYRKAEAVLANGVKQFPNHQA-----------LRVFYAMVLYNLGRYEQGVELLLKIIAETSDDETIQSYKQAILFYADKLDETWKA. 117
41 -39.7004abn_A mol:protein length:474 TETRATRICOPEPTIDE REPEAT PROTEIN 5  ali model follow..  13  123AVKLEPELVEAWNQL--GEVYWKKGDVTSAHTCFSGALTHCKNKVSKLAVQMDVLDGRSWYILGNAYQNPKISQQALSAYAQAEKVDRKASS---------PDLHLNRATLHKYEESYGEALEGFSQAAALDPAWPEPQQREQQLLEFLSRLTSLLES. 308
42 -39.6002l6j_A mol:protein length:111 TPR repeat-containing protein associated with  ali model follow..  13  1.......MSQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQ------------NPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTA-----------EHVAIRSK-LQYRLELAQGAVGSVQIPVVEVDELPEGYDR.................. 110
43 -39.5003u4t_A mol:protein length:272 TPR repeat-containing protein  ali model follow..  12  100AVDRDTTRLDMYGQI--GSYFYNKGNFPLAIQYMEKQIRPTTT------------DPKVFYELGQAYYYNKEYVKADSSFVKVLELKPNIYPGGAKYKDELIEANEYIAYYYTINRDKVKADAAWKNILALDPTNKKAIDGLKMKLE............ 266
44 -39.5002xpi_A mol:protein length:597 ANAPHASE-PROMOTING COMPLEX SUBUNIT CUT9  ali model follow..  10  399SSTMDPQFGPAWIGF--AHSFAIEGEHDQAISAYTTAARLFQGTHLQSSYALFQYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKP----WAATWANLGHAYRKLKMYDAAIDALNQGLLLSTNDANVHTAIALVYLHKKIPGLAIT.. 571
45 -39.2002kat_A mol:protein length:115 uncharacterized protein  ali model follow..  14  1..........................MQAITERLEAMLAQGTD------------NMLLRFTLGKTYAEHEQFDAALPHLRAALDFDPT-----------YSVAWKWLGKTLQGQGDRAGARQAWESGLAAAQSRQQVVKELQVFLRRLAREDAL.... 108
46 -38.7002ho1_A mol:protein length:252 Type 4 fimbrial biogenesis protein PilF  ali model follow..  17  23TDKGRDEARDAYIQL--GLGYLQRGNTEQAKVPLRKALEIDPS------------SADAHAALAVVFQTEMEPKLADEEYRKALASDSRNARVLNNYGGFLSRVFENLGLVSLQMKKPAQAKEYFEKSLRLNRNQPSVALEMADLLYKEREYVPARQ.. 190
47 -38.6003rkv_A mol:protein length:162 putative peptidylprolyl isomerase  ali model follow..  11  1SNAEDDKLKSVEALRQKGNELFVQKDYKEAIDAYRDALTRREKPGEPEWVELDRKNIPLYANMSQCYLNIGDLHEAEETSSEVLKREETN-----------EKALFRRAKARIAAWKLDEAEEDLKLLLRNHPAAASVVAREMKIVTERRAEKKADSRV 154
48 -38.2001zu2_A mol:protein length:158 Mitochondrial import receptor subunit TOM20-3  ali model follow..  10  2..........PLGSMDTETEFDRILLFEQIRQDAENTYKSNPL------------DADNLTRWGGVLLELSQIQEAITKFEEALLIDPKKDE-----------AVWCIGNAYTSFAFFDLATQFFQQAVDEQPDNTHYLKSLEMTAKAPQLHAEAYKQG 148
49 -37.9002fi7_A mol:protein length:265 type 4 fimbrial biogenesis protein PilF  ali model follow..  14  70ALEIDPSSADAHAAL--AVVFQTEMEPKLADEEYRKALASDSR------------NARVLNNYGGFLYEQKRYEEAYQRLLEASQ-----DTLYPER----SRVFENLGLVSLQMKKPAQAKEYFEKSLRLNRNQPSVALEMADLLYKEREYVPARQ.. 203
50 -37.8002gw1_A mol:protein length:514 Mitochondrial precursor proteins import recep  ali model follow..  17  296ALKLDSNNSSVYYHR--GQMNFILQNYDQAGKDFDKAKELDPENIFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELENKLDGIYVGIAPLVGKA--TLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIT.. 470
51 -37.7003ks2_A mol:protein length:151 Chaperone protein ipgC  ali model follow..  13  24INAIPDDMMDDIYSY--AYDFYNKGRIEEAEVFFRFLCIYDFY------------NVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYT-----------PVFHTGQCQLRLKAPLKAKECFELVIQHSND-EKLKIKAQSYLDAIQDIKE..... 151
52 -37.5002c2l_A mol:protein length:281 CARBOXY TERMINUS OF HSP70-INTERACTING PROTEIN  ali model follow..  15  2........PSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPL------------VAVYYTNRALCYLKMQQPEQALADCRRALELDGQ-----------SVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIE 129
53 -37.2002fbn_A mol:protein length:198 70 kDa peptidylprolyl isomerase, putative  ali model follow..  13  23.YTDEEKVQSAFDIKEEGNEFFKKNEINEAIVKYKEALDFFIHTDQILLDKKKNIEISCNLNLATCYNKNKDYPKAIDHASKVLKIDKNN-----------VKALYKLGVANMYFGFLEEAKENLYKAASLNPNNLDIRNSYELCVNKLKEARKKDKLT 173
54 -37.1001na3_A mol:protein length:91 designed protein CTPR2  ali model follow..  22  6.....................................................GNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAE-----------AWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAKQNLGNAKQKQG......... 91
55 -36.7003gyz_A mol:protein length:151 Chaperone protein ipgC  ali model follow..  14  28INAIPDDMMDDIYSY--AYDFYNKGRIEEAEVFFRFLCIYDFY------------NVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYT-----------PVFHTGQCQLRLKAPLKAKECFELVIQHSNDEKLKIKAQSYL.............. 147
56 -35.9003ieg_A mol:protein length:359 DnaJ homolog subfamily C member 3  ali model follow..  180ASKLKSDNTEAFYKI--STLYYQLGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIRDGRYTDATSKYESVMKTEPSVAEYT-------VRSKERICHCFSKDEKPVEAIRICSEVLQMEPDNVNALKDRAEAYLIEEMYDEAIQD. 328
57 -35.7003ro3_A mol:protein length:164 G-protein-signaling modulator 2  ali model follow..  12  5....RAAQGRAFGNL--GNTHYLLGNFRDAVIAHEQRLLIAKEFGDKAA------ERIAYSNLGNAYIFLGEFETASEYYKKTLLLARQLKD-----RAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIRIGEGRACWSLGNAYTALGNHDQAMH.. 150
58 -35.1002e2e_A mol:protein length:177 Formate-dependent nitrite reductase complex n  ali model follow..  18  36KIRANPQNSEQWALL--GEYYLWQNDYSNSLLAYRQALQLRGE------------NAELYAALATVLYYQASTAQTRAMIDKALALDSNEIT-----------ALMLLASDAFMQANYAQAIELWQKVMDLNSPRINRTQLVESINMAKLLQRRS.... 168
59 -34.3003ma5_A mol:protein length:100 Tetratricopeptide repeat domain protein  ali model follow..  14  3....................................................DPEDPFTRYALAQEHLKHDNASRALALFEELVETDPD-----------YVGTYYHLGKLYERLDRTDDAIDTYAQGIEVAREEGTQKDELQDAKLKAEGLE...... 94
60 -34.2002kc7_A mol:protein length:99 bfr218_protein  ali model follow..  14  2..........................................................DQLKTIKELINQGDIENALQALEEFLQTEPVG----------KDEAYYLMGNAYRKLGDWQKALNNYQSAIELNPDSPALQARKM-VMDILNFYNKDM... 88
61 -34.1001p5q_A mol:protein length:336 FK506-binding protein 4  ali model follow..  16  131EMNSEEKLEQSTIVKERGTVYFKEGKYKQALLQYKKIVSWESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNN-----------EKGLSRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKL 281
62 -33.9002y4t_A mol:protein length:450 DNAJ HOMOLOG SUBFAMILY C MEMBER 3  ali model follow..  14  12LYFQSMADVEKH--LELGKKLLAAGQLADALSQFHAAVDGDPDNYITKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSENEEKEAQSQL-MQRLRSQALNAFGSGDYTAAIAFLDKILEVCVWDAELRELRAECFIKEGEPRKAISD. 193
63 -33.7003gw4_A mol:protein length:203 Uncharacterized protein  ali model follow..  11  18LLAHPATASGARFML--GYVYAFMDRFDEARASFQALQQQAQKSGDHTA------EHRALHQVGMVERMAGNWDAARRCFLEERELLASL----PEDPLAASANAYEVATVALHFGDLAGARQEYEKSLVYAQQADDAFRGLGDLAQQEKNLLEAQQ.. 168
64 -33.5002avp_A mol:protein length:70 synthetic consensus TPR protein  ali model follow..  27  1......................................................GSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAE-----------AWYNLGNAYYKQGDYDEAIEYYQKALELDPRS........................ 70
65 -33.5002v5f_A mol:protein length:104 PROLYL 4-HYDROXYLASE SUBUNIT ALPHA-1  ali model follow..  13  4.......................................................TAEDCFELGKVAYTEADYYHTELWMEQALRQLDEGEISTIDK----VSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEYIMAKEKDVNKSA 103
66 -33.2001tjc_A mol:protein length:108 Prolyl 4-hydroxylase alpha-1 subunit  ali model follow..  13  4.......................................................TAEDSFELGKVAYTEADYYHTELWMEQALRQLDEGEISTIDK----VSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEYIMAKEKDVNKS. 102
67 -32.6003ffl_A mol:protein length:167 Anaphase-promoting complex subunit 7  ali model follow..  11  7GLVPRGSHMNVIDHVRD---MAAAGLHSNVRLLSSLLLTLSNN---NPELFSPPQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALSKTSKVRPST-IEVKYKLAECYTVLKQDKDAIAILDGIPSRQRT......................... 148
68 -30.9003v6t_A mol:protein length:499 dHax3  ali model follow..  58PLNLTPEQVVAIASHDGG--KQALETVQRLLPVLCQAHGLTPQQVVAQAHGLTPEQVVAIASHDGGKQALETVQALLPVLCQAHGLTPEQ-----------VVAIASNGGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNGGGKQALETVQRLLPV. 224
69 -30.2003ly7_A mol:protein length:372 Transcriptional activator cadC  ali model follow..  180LQKILPHRGALLTNFYQAHDYLDDKSLNRASELLGEIVQSSPEFTNIVTLPELNNLSIIYQIKAVSALVKGKTDESYQAINTGIDLEMSWL------------NYVLLGKVYEMKGMNREAADAYLTAFNLRPGANTLYWIENGIQTSVPYVVPYLDKF 362
70 -30.0002if4_A mol:protein length:338 ATFKBP42  ali model follow..  16  169DMTVEERIGAADRRKMDGNSLFKEEKLEEAMQQYEMAIAYMFQLYGKYQDMALAVKNPCHLNIAACLIKLKRYDEAIGHCNIVLTEEEKN-----------PKALFRRGKAKAELGQMDSARDDFRKAQKYAPDDKAIRRELRALAEQEKALYQKQKEM 321
71 -29.9001nzn_A mol:protein length:126 Fission protein Fis1p  ali model follow..  6...............AVLNELVSVEDLLKFEKKFQSEKAAGSV------------SKSTQFEYAWCLVYNDDIRKGIVLLEELLPK---------GSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKK........ 123
72 -29.9003ulq_A mol:protein length:383 Response regulator aspartate phosphatase F  ali model follow..  13  97....LTGLLEYYFNFFRGMYELDQREYLSAIKFFKKAESKLIFVKDRI------EKAEFFFKMSESYYYMKQTYFSMDYARQAYEIYKEHEAYNIRL----LQCHSLFATNFLDLKQYEDAISHFQKAYSMAEAEKQTLYNIGLCKNSQSQYEDAIP.. 245
73 -29.8003ro2_A mol:protein length:338 G-protein-signaling modulator 2  ali model follow..  11  1....GSASCLELALE--GERLCKSGDCRAGVSFFEAAVQVGTE---------LKTLSAIYSQLGNAYFYLHDYAKALEYHHHDLTLARTIGD-----QLGEAKASGNLGNTLKVLGNFDEAIVCCQRHLDIKVGEARALYNLGNVYHAKGKSFGCPG.. 144
74 -29.6003v6p_A mol:protein length:442 dHax3  ali model follow..  17PLNLTPEQVVAIASHDGGKQ--ALETVQRLLPVLCQAHGLTPQQVVAQAHGLTPEQVVAIASHDGGKQALETVQALLPVLCQAHGLTPEQ-----------VVAIASNGGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNGGGKQALETVQRLLPV. 183
75 -28.8001iyg_A mol:protein length:133 Hypothetical protein (2010003O14)  ali model follow..  12.................LNELVSVEDLKNFERKFQSEQAAGSV------------SKSTQFEYAWCLVYNEDIRRGIVLLEELLPKGSKEEQ---------RDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKK........ 127

FFAS is supported by the NIH grant R01-GM087218-01
6 1 1 7 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Schwarzenbacher R, Godzik A, Jaroszewski L. The JCSG MR pipeline: optimized alignments, multiple models and parallel searches. Acta Crystallogr D Biol Crystallogr. 2008 Jan;64(Pt 1):133-40. Epub 2007 Dec 5.