current user: public




Query: 2hr2_A mol:protein length:159 Hypothetical protein, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
# Score Template Links and tools%idFirst GMKPLKEVVGAYLALSDAQRQLVAGEYDEAAANCRRAMEISHTMPPEEAFDHAGFDAFCHAGLAEALAGLRSFDEALHSADKALHYFNRRGELNQDEGKLWISAVYSRALALDGLGRGAEAMPEFKKVVEMIEERKGETPGKERMMEVAIDRIAQLGASLast
1 -83.4002hr2_A mol:protein length:159 Hypothetical protein  ali model  100  1GMKPLKEVVGAYLALSDAQRQLVAGEYDEAAANCRRAMEISHTMPPEEAFDHAGFDAFCHAGLAEALAGLRSFDEALHSADKALHYFNRRGELNQDEGKLWISAVYSRALALDGLGRGAEAMPEFKKVVEMIEERKGETPGKERMMEVAIDRIAQLGAS 159
2 -50.8003kd7_A mol:protein length:125 CTPR390  ali model follow..  20  2AMDPG-NSAEAWK--NLGNAYYKQGDYQKAIEYYQKALELDPN------------NASAWYNLGNAYYKQGDYQKAIEYYQKAL-------ELDPNNAKAW----YRRGNAYYKQGDYQKAIEDYQKALELDPNNAKAKQNLGNAKQKQG......... 125
3 -50.7002fo7_A mol:protein length:136 SYNTHETIC CONSENSUS TPR PROTEIN  ali model follow..  23  1........AEAWYNL--GNAYYKQGDYDEAIEYYQKALELDPR------------SAEAWYNLGNAYYKQGDYDEAIEYYQKAL-------ELDPRSAEAW----YNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEY. 125
4 -50.0001na0_A mol:protein length:125 designed protein CTPR3  ali model follow..  24  2AMDPG-NSAEAWYNL--GNAYYKQGDYDEAIEYYQKALELDPN------------NAEAWYNLGNAYYKQGDYDEAIEYYQKAL-------ELDPNNAEAW----YNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAKQNLGNAKQKQG......... 125
5 -49.8002wqh_A mol:protein length:125 CTPR3Y3  ali model follow..  24  2AMDP-GNSAEAWYNL--GNAYYKQGDYDEAIEYYQKALELYPN------------NAEAWYNLGNAYYKQGDYDEAIEYYQKAL-------ELYPNNAEAW----YNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAKQNLGNAKQKQG......... 125
6 -49.3003vtx_A mol:protein length:184 MamA  ali model follow..  16  31VLKADPNNVETLLKL--GKTYMDIGLPNDAIESLKKFVVLDTTS------------AEAYYILGSANFMIDEKQAAIDALQRAI-------ALNTVYADAY----YKLGLVYDSMGEHDKAIEAYEKTISIKPGFIRAYQSIGLAYEGKGLRDEAVKY. 163
7 -48.8004xi0_A mol:protein length:202 Magnetosome protein MamA  ali model follow..  12  33WARHEKNDPEPLYQM--GIALANLGDYQRAVTVFDKVLKLRPN------------HFMASYRKGAVLLKIKQYKLALPVLEAVV-------AAAPADARAY----YLLGLAYDGDEQLEKGIEAMQKAVDLDPEEIKYHQHLGFMNVRKDDHKTAAEH. 165
8 -48.2003asd_A mol:protein length:200 MamA  ali model follow..  16  1.MGNDDIRQVYYE--DKGISHAKAGRYSQAVMLLEQVYDADAFDVDERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVA-------EANPINFNVR----FRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPH. 166
9 -48.2002q7f_A mol:protein length:243 YrrB protein  ali model follow..  17  43AIEENKEDAIPYINF--ANLLSSVNELERALAFYDKALELDSSAATAKALRAGMENGDLFYMLGTVLVKLEQPKLALPYLQRAV-------ELNENDTEAR----FQFGMCLANEGMLDEALSQFAAVTEQDPGHADAFYNAGVTYAYKENREKALEM. 209
10 -48.0003asg_A mol:protein length:186 MamA  ali model follow..  15  1.MGNDDIRQVYYR--DKGISHAKAGRYSQAVMLLEQVYDADAFDVDERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVA-------EANPINFNVR----FRLGVALKNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPH. 166
11 -48.0003as8_A mol:protein length:186 Magnetosome protein MamA  ali model follow..  17  1.MGNDDIRQVYYR--DKGISHAKAGRYSEAVVMLEQVYDADAFDVEERSIADAPDNIKVATVLGLTYVQVQKYDLAVPLLVKVA-------EANPVNFNVR----FRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAYSYEQMGSHEEALPH. 166
12 -46.2002pl2_A mol:protein length:217 Hypothetical conserved protein TTC0263  ali model follow..  17  31ALKENPQDPEALYWL--ARTQLKLGLVNPALENGKTLVARTPRYLGKDAERVNPRYAPLHLQRGLVYALLGERDKAEASLKQALALEDT------------PEIRSALAELYLSMGRLDEALAQYAKALEQAPKDLDLRVRYASALLLKGKAEEAARA. 207
13 -45.3001w3b_A mol:protein length:388 UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUC  ali model follow..  16  59AIKQNPLLAEAYSNL--GNVYKERGQLQEAIEHYRHALRLKPDFIDGSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAI-------ETQPNFAVAW----SNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAA. 225
14 -44.8003urz_A mol:protein length:208 Uncharacterized protein  ali model follow..  12  2......QSVDEM--LQKVSAAIEAGQNGQAVSYFRQTIALNIDRTETNVDKNSEISSKLATELALAYKKNRNYDKAYLFYKELL-------QKAPNNVDCL----EACAEMQVCRGQEKDALRMYEKILQLEADNLAANIFLGNYYYLTAEQEKK.... 141
15 -44.8003r9a_B mol:protein length:328 Peroxisomal targeting signal 1 receptor  ali model follow..  17  167AVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPN------------DYLLWNKLGATLANGNQSEEAVAAYRRAL-------ELQPGYIRSR----YNLGISCINLGAHREAVEHFLEALNMQRKSRGPWSTLRLALSMLGQSDAYGAA. 312
16 -44.6004gcn_A mol:protein length:127 Protein STI-1  ali model follow..  12  2..NAMTDAAIAEK--DLGNAAYKQKDFEKAHVHYDKAIELDPS------------NITFYNNKAAVYFEEKKFAECVQFCEKAVEVGRETRADYKLIAKAMS----RAGNAFQKQNDLSLAVQWFHRSLSEFRDPELVKKVKE................ 124
17 -44.2004j8d_A mol:protein length:175 Hsc70-interacting protein  ali model follow..  17  33ITEAMMDEANEKK--GAAIDALNDGELQKAIDLFTDAIKLNPR------------LAILYAKRASVFVKLQKPNAAIRDCDRAI-------EINPDSAQPY----KWRGKAHRLLGHWEEAARDLALACKLDYDEDASAMLREVQAQKIAEHRRKYE.. 166
18 -44.0003cvq_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  15  81ARALDPADIAVHAAL--AVSHTNEHNANAALASLRAWLLSQPQYEQHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAV-------ELRPDDAQLW----NKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQ. 262
19 -43.9003cv0_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  15  81ARMLDPKDIAVHAAL--AVSHTNEHNANAALASLRAWLLSQPQYEQHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAV-------ELRPDDAQLW----NKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQ. 262
20 -43.7001fch_A mol:protein length:368 PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR  ali model follow..  17  207AVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPN------------DYLLWNKLGATLANGNQSEEAVAAYRRAL-------ELQPGYIRSR----YNLGISCINLGAHREAVEHFLEALNMQRKSRGPWSTLRLALSMLGQSDAYGAA. 352
21 -43.5003uq3_A mol:protein length:258 Heat shock protein STI1  ali model follow..  17  131EAYVNPEKAEEAR--LEGKEYFTKSDWPNAVKAYTEMIKRAPE------------DARGYSNRAAALAKLMSFPEAIADCNKAI-------EKDPNFVRAY----IRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQLYYKASQ...... 258
22 -42.8001xnf_A mol:protein length:275 Lipoprotein nlpI  ali model follow..  10  1....SNTSWRKSEV--LAVPLQPTLQQEVILARMEQILASRA--------LTDDERAQLLYERGVLYDSLGLRALARNDFSQAL-------AIRPDMPEVF----NYLGIYLTQAGNFDAAYEAFDSVLELDPTYNYAHLNRGIALYYGGRDKLAQDD. 133
23 -42.6004eqf_A mol:protein length:365 PEX5-related protein  ali model follow..  10  159WIKQNPKYKYLVK--NKKGSPGLTRRMSKSPVDSSVLEGVKELYLEAAHQNGDMIDPDLQTGLGVLFHLSGEFNRAIDAFNAAL-------TVRPEDYSLW----NRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREAVSN. 303
24 -42.6004i17_A mol:protein length:228 hypothetical protein  ali model follow..  1..GAQTTDPNQLK--NEGNDALNAKNYAVAFEKYSEYLKLTNNQ-----------DSVTAYNCGVCADNIKKYKEAADYFDIAI-------KKNYNLANAY----IGKSAAYRDMKNNQEYIATLTEGIKAVPGYAIYYLKEGQKFQQAGNIEKAEEN. 139
25 -42.4002kck_A mol:protein length:112 TPR repeat  ali model follow..  19  1...MVDQNPEEYYL--EGVLQYDAGNYTESIDLFEKAIQLDPE------------ESKYWLMKGKALYNLERYEEAVDCYNYVI-------NVIEDEYNK--DVWAAKADALRYIGKEVEAEIAEARAK.............................. 104
26 -42.3004r7s_A mol:protein length:257 Tetratricopeptide repeat protein  ali model follow..  17  30AMRKEPANPLNYALLNLGTIQRRQGKLQEALISYTSALSGHTK------------NITILENRASLYTELGETEKALNDYNTLL-------IENPEHQEAL----YCRGLLYIQLQNYMWAEQDFDKILEVNEKSVRARLGHAILEKMRGNYDESERI. 165
27 -42.2001hxi_A mol:protein length:121 PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5  ali model follow..  9EANNPYMYHENP--MEEGLSMLKLANLAEAALAFEAVCQKEPE------------REEAWRSLGLTQAENEKDGLAIIALNHAR-------MLDPKDIAVH----AALAVSHTNEHNANAALASLRAWLLSQPQYEQ...................... 120
28 -42.0001zu2_A mol:protein length:158 Mitochondrial import receptor subunit TOM20-3  ali model follow..  6..............MDTETEFDRILLFEQIRQDAENTYKSNPL------------DADNLTRWGGVLLELSQFHSISDAIQEAITKFEEALLIDPKKDEAV----WCIGNAYTSFAFFDLATQFFQQAVDEQPDNTHYLKSLEMTAKAPQLHAEAYKQG 148
29 -41.8003hym_B mol:protein length:330 Cell division cycle protein 16 homolog  ali model follow..  14  117ATTLEKTYGPAWIAY--GHSFAVESEHDQAMAAYFTAAQLMKGCHLSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTV--DKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVD.. 291
30 -41.4004abn_A mol:protein length:474 TETRATRICOPEPTIDE REPEAT PROTEIN 5  ali model follow..  14  123AVKLEPELVEAWNQL--GEVYWKKGDVTSAHTCFSGALTHCKNKVSKLAVQMDVLDGRSWYILGNAYQNPKISQQALSAYAQAEKVDRK----ASSNPDLH----LNRATLHKYEESYGEALEGFSQAAALDPAWPEPQQREQQLLEFLSRLTSLLES. 308
31 -41.3001wm5_A mol:protein length:208 Neutrophil cytosol factor 2  ali model follow..  3MGSMSLVEAISLW--NEGVLAADKKDWKGALDAFSAVQD---------------PHSRICFNIGCMYTILKNMTEAEKAFTRSI-------NRDKHLAVAY----FQRGMLYYQTEKYDLAIKDLKEALQFKLFACEVLYNIAFMYAKKEEWKKAEEQ. 148
32 -41.1001hh8_A mol:protein length:213 NEUTROPHIL CYTOSOL FACTOR 2  ali model follow..  25ALAVQDPHSRICF--NIGCMYTILKNMTEAEKAFTRSINRDKHL------------AVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNLQFKLFACEVL----YNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWKQKLYE..... 173
33 -40.9003fp2_A mol:protein length:537 TPR repeat-containing protein YHR117W  ali model follow..  13  302AVDLNPEYPPTYY--HRGQMYFILQDYKNAKEDFQKAQSLNPENVYNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIEL. 484
34 -40.5002xpi_A mol:protein length:597 ANAPHASE-PROMOTING COMPLEX SUBUNIT CUT9  ali model follow..  10  399SSTMDPQFGPAWIGF--AHSFAIEGEHDQAISAYTTAARLFQGTHLQSSYALFQYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATW----ANLGHAYRKLKMYDAAIDALNQGLLLSTNDANVHTAIALVYLHKKIPGLAITH. 572
35 -40.1004nrh_B mol:protein length:178 Chaperone SycD  ali model follow..  2...............SHMASMSHLNYLLEKIAASSKEDFPFPDDLESKIFKISSEDLEKVYKEGYHAYLDKDYAKSITVFRWLVF-------FNPFVSKFW----FSLGASLHMSEQYSQALHAYGVTAVLRDKDPYPHYYAYICYTLTNEHEEAEKA. 150
36 -39.9004uzy_A mol:protein length:651 FLAGELLAR ASSOCIATED PROTEIN  ali model follow..  10  43QLQNVPESRAALSLL--GYCYYYTGQYDMASQMYEQLVTLYPS------------NEDYKLYYAQSLYKGGMYPEASKAVDDLTGCRRQLDKCAPEDPDTM----VNTGCIMFKEGKFEAARQKFNDAVQALGYQPELLYNIALCYYKTKQFGPALKH. 203
37 -39.8002vgy_A mol:protein length:148 CHAPERONE SYCD  ali model follow..  18  13LNEISSDTLEQLYSL--AFNQYQSGKYEDAHKVFQALCVLDHY------------DSRFFLGLGACRQAMGQYDLAIHSYEEGAVMDIKEPR-----------FPFHAAECLLQKGELAEAESGLFLAQELKPEFKELSTRVSSMLEAIKLKKEMKHE. 148
38 -39.7003wxx_A mol:protein length:151 AcrH  ali model follow..  18  18LNDVSTDTLEQLY--TLGFNQYHAGKHDEAHKIFQALCVLDHY------------EARFFLGLGACRQALGQFRLAIDSYSYGAMMDLQEPR-----------FPFHAAECLLQLGELEGAESGFHSAQLLKPELAELAARAGIMLEVVKTKKDM.... 150
39 -39.7002gw1_A mol:protein length:514 Mitochondrial precursor proteins import recep  ali model follow..  17  296ALKLDSNNSSVYYH--RGQMNFILQNYDQAGKDFDKAKELDPENIFPEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAI-------ELENKLDGIY----VGIAPLVGKVENFIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAITL. 471
40 -39.6002vgx_A mol:protein length:148 CHAPERONE SYCD  ali model follow..  18  13LNEISSDTLEQLYSL--AFNQYQSGKYEDAHKVFQALCVLDHY------------DSRFFLGLGACRQAMGQYDLAIHSYSYGAVMDIKEPR-----------FPFHAAECLLQKGELAEAESGLFLAQELKPEFKELSTRVSSMLEAIKLKKEMKHE. 148
41 -39.6002vq2_A mol:protein length:225 PUTATIVE FIMBRIAL BIOGENESIS AND TWITCHING MO  ali model follow..  16  34ALKSDPKNELAWLVR--AEIYQYLKVNDKAQESFRQALSIKPD------------SAEINNNYGWFLGRLNRPAESMAYFDKALA-----DPTYPTPYIAN----LNKGICSAKQGQFGLAEAYLKRSLAAQPQFPPAFKELARTKMLAGQLGDADYY. 169
42 -39.5002ho1_A mol:protein length:252 Type 4 fimbrial biogenesis protein PilF  ali model follow..  14  57ALEIDPSSADAHAAL--AVVFQTEMEPKLADEEYRKALASDSR------------NARVLNNYGGFLYEQKRYEEAYQRLLEASQ-----DTLYPERSRVF----ENLGLVSLQMKKPAQAKEYFEKSLRLNRNQPSVALEMADLLYKEREYVPA.... 188
43 -39.2004ui9_J mol:protein length:620 CELL DIVISION CYCLE PROTEIN 16 HOMOLOG  ali model follow..  14  326ATTLEKTYGPAWIAY--GHSFAVESEHDQAMAAYFTAAQLMKGCHLSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTV--DKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVD.. 500
44 -38.8002xcb_A mol:protein length:142 REGULATORY PROTEIN PCRH  ali model follow..  17  10LRGLSEDTLEQLY--ALGFNQYQAGKWDDAQKIFQALCMLDHY------------DARYFLGLGACRQSLGLYEQALQSYSYGA-------LMDINEPRFP----FHAAECHLQLGDLDGAESGFYSARALQPAHEALAARAGAMLEAVTARKDR.... 142
45 -38.6003ieg_A mol:protein length:359 DnaJ homolog subfamily C member 3  ali model follow..  180ASKLKSDNTEAF--YKISTLYYQLGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIRDGRYTDATSKYESVM-------KTEPSVAEYTVRSKERICHCFSKDEKPVEAIRICSEVLQMEPDNVNALKDRAEAYLIEEMYDEAIQD. 328
46 -38.6002fi7_A mol:protein length:265 type 4 fimbrial biogenesis protein PilF  ali model follow..  14  70ALEIDPSSADAHAAL--AVVFQTEMEPKLADEEYRKALASDSR------------NARVLNNYGGFLYEQKRYEEAYQRLLEASQ-----DTLYPERSRVF----ENLGLVSLQMKKPAQAKEYFEKSLRLNRNQPSVALEMADLLYKEREYVPARQ.. 203
47 -38.4004XNH Entity 1(prereleased)  ali follow..  12AAKIALKKENDQ--FLEALKLYEGKQYKKSLKLLDAILKKDGS------------HVDSLALKGLDLYSVGEKDDAASYVANAIRKIEG----ASASPICC----HVLGIYMRNTKEYKESIKWFTAALNNGSTNKQIYRDLATLQSQIGDFKNALVS. 147
48 -38.3005dse_A mol:protein length:837 Tetratricopeptide repeat protein 7B  ali model follow..  18  682PLHPWMTLAQIW--LHAAEVYIGIGKPAEATACTQEAANLFPM------------SHNVLYMRGQIAELRGSMDEARRWYEEAL-------AISPTHVKSM----QRLALILHQLGRYSLAEKILRDAVQVNSTAHEVWNGLGEVLQAQGNDAAATEC. 814
49 -38.2004rg6_A mol:protein length:560 Cell division cycle protein 27 homolog  ali model follow..  13  329AIQVDPNYAYAYTLL--GHEFVLTEELDKALACFRNAIRVNPRHYNAKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPELKQIVPKESLVY----FLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQ. 529
50 -37.3004kvm_A mol:protein length:734 N-terminal acetyltransferase A complex subuni  ali model follow..  36LLERHPEHGESLAI--KGILLHSLGNTKEGYDNVRLGLRNDVG------------SGVCWHIFGLISRADKDYVQAAKCYINAHKLEKNNSSL-----------LRDLALLQSQLRQYKALADTRNALLQDNPGVRANWSALAVAQFLRGEYASAYK.. 167
51 -37.3004ui9_F mol:protein length:824 CELL DIVISION CYCLE PROTEIN 27 HOMOLOG  ali model follow..  13  593AIQVDPNYAYAYTLL--GHEFVLTEELDKALACFRNAIRVNPRHYNAKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPELKQIVPKESLVY----FLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQ. 793
52 -37.0002kat_A mol:protein length:115 uncharacterized protein  ali model follow..  14  1..........................MQAITERLEAMLAQGTD------------NMLLRFTLGKTYAEHEQFDAALPHLRAAL-------DFDPTYSVAW----KWLGKTLQGQGDRAGARQAWESGLAAAQSRQQVVKELQVFLRRLAREDAL.... 108
53 -37.0004hou_A mol:protein length:273 Interferon-induced protein with tetratricopep  ali model follow..  14  81DNQANVRSLVTWGNF--AWMYYHMGRLAEAQTYLDKVENICKKLSNPFRYRMECPEIDCEEGWALLKCGGKNYERAKACFEKVLEVDPQAVRLNPDNGYIK----VLLALKLQDEGQEAEGEKYIEEALANMSSQTYVFRYAAKFYRRKGSVDKALE.. 266
54 -36.7005a31_C mol:protein length:597 CELL DIVISION CYCLE PROTEIN 23 HOMOLOG  ali model follow..  14  357ALKLNPRYLGAWTLM--GHEYMEMKNTSAAIQAYRHAIEVNKR------------DYRAWYGLGQTYEILKMPFYCLYYYRRAH-------QLRPNDSRML----VALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQLTESEQAAQ.. 488
55 -36.5001na3_A mol:protein length:91 designed protein CTPR2  ali model follow..  23  6.....................................................GNSAEAWYNLGNAYYKQGDYDEAIEYYQKAL-------ELDPNNAEAW----YNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAKQNLGNAKQKQG......... 91
56 -36.1002vyi_A mol:protein length:131 SGTA PROTEIN  ali model follow..  16  4..GSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPA------------NAVYFCNRAAAYSKLGNYAGAVQDCERAI-------CIDPAYSKAY----GRMGLALSSLNKHVEAVAYYKKALELDPDNETYKSNLKIAELKLRE........ 129
57 -36.1003fwv_A mol:protein length:128 Hsc70/Hsp90-organizing protein  ali model follow..  10  2........KQALKEKELGNDAYKKKDFDTALKHYDKAKELDPT------------NMTYIVNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRMIAYAYA----RIGNSYFKEEKYKDAIHFYNKSLAEHRT......................... 111
58 -36.0004ga2_A mol:protein length:150 E3 SUMO-PROTEIN LIGASE RANBP2  ali model follow..  14  23STPSPRQKSIKGFYF--AKLYYEAKEYDLAKKYICTYINVQER------------DPKAHRFLGLLYELEENTDKAVECYRRSV-------ELNPTQKDLV----LKIAELLCKNDVTDGRAKYWERAAKLFPGSPAVYKLKEQLLDCEGE........ 149
59 -35.9003zgq_A mol:protein length:482 INTERFERON-INDUCED PROTEIN WITH TETRATRICOPEP  ali model follow..  14  43EFLTTKSRLALYNLL--AYVKHLKGQNKDALECLEQAEEIIQQ---EHSDKEEVRSLVTWGNYAWVYYHMDQLEEAQKYTGKIGNVCKKLSSPSNYKLEC-TDCEKGWALLKFGGKYYQKAKAAFEKALEVEPDNPEFNIGYAITVYRLDDSDREGSV. 196
60 -35.9004hnw_A mol:protein length:863 N-terminal acetyltransferase A complex subuni  ali model follow..  12AAKIALKKENDQ--FLEALKLYEGKQYKKSLKLLDAILKKDGS------------HVDSLALKGLDLYSVGEKDDAASYVANAIRKIEG----ASASPICC----HVLGIYMRNTKEYKESIKWFTAALNNGSTNKQIYRDLATLQSQIGDFKNALVS. 147
61 -35.9004ga0_A mol:protein length:150 E3 SUMO-protein ligase RanBP2  ali model follow..  14  23STPSPRQKSMKGFYF--AKLYYEAKEYDLAKKYICTYINVQER------------DPKAHRFLGLLYELEENTDKAVECYRRSV-------ELNPTQKDLV----LKIAELLCKNDVTDGRAKYLERAAKLFPGSPAIYKLKEQLLDCEGE........ 149
62 -35.8003k9i_A mol:protein length:117 BH0479 protein  ali model follow..  17  2......................VLGLEAQAVPYYEKAIASGLQ---------GKDLAECYLGLGSTFRTLGEYRKAEAVLANGVKQFPNHQAL-----------RVFYAMVLYNLGRYEQGVELLLKIIAETSDDETIQSYK----QAILFYADKLDET 114
63 -35.6002lni_A mol:protein length:133 Stress-induced-phosphoprotein 1  ali model follow..  18  1.MGSHMNPDLALMVKNKGNECFQKGDYPQAMKHYTEAIKRNPK------------DAKLYSNRAACYTKLLEFQLALKDCEECIQLEPT-----------FIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYN........ 127
64 -35.3004ga1_A mol:protein length:150 E3 SUMO-PROTEIN LIGASE RANBP2  ali model follow..  15  23STPSPRQKSMKGFYF--AKLYMEAKEYDLAKKYICTYINVQER------------DPKAHRFLGLLYELEENTDKAVECYRRSV-------ELNPMQKDLV----LKIAELLCKNDVTDGAKYWVERAAKLFPGSPAVYKLKEQLLDCEGE........ 149
65 -35.1004cgv_A mol:protein length:136 RNA POLYMERASE II-ASSOCIATED PROTEIN 3  ali model follow..  16  6..GIHVDSQKALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPY------------NPVLPTNRASAYFRLKKFAVAESDCNLAVALNRS-----------YTKAYSRRGAARFALQKLEEAKKDYERVLELEPNNFEATNELRKISQALASKENS.... 135
66 -35.1005aio_A mol:protein length:448 TRANSCRIPTION FACTOR TAU 131 KDA SUBUNIT  ali model follow..  13  36VIKKDARNFAAYETL--GDIYQLQGRLNDCCNSWFLAAHLNAS------------DWEFWKIVAILSADLDHVRQAIYCFSRVISLNPMEWE-----------SIYRRSMLYKKTGQLARALDGFQRLYMYNPYDANILRELAILYVDYDRIEDSIEL. 168
67 -35.0005a31_X mol:protein length:599 ANAPHASE-PROMOTING COMPLEX SUBUNIT 7  ali model follow..  13  365AIQLNSNSVQALLL--KGAALRNMGRVQEAIIHFREAIRLAPCRLDNKALTQEPDYIKAVVKKAELLSREQKYEDGIALLRNALANQSD------------CVLHRILGDFLVAVNEYQEAMDQYSIALSLDPNDQKSLEGMQKMEKEESPTDATQEE. 565
68 -34.8003u4t_A mol:protein length:272 TPR repeat-containing protein  ali model follow..  12  100AVDRDTTRLDMYGQI--GSYFYNKGNFPLAIQYMEKQIRPTTT------------DPKVFYELGQAYYYNKEYVKADSSFVKVLELKPNIAPGGAKYKDELIEANEYIAYYYTINRDKVKADAAWKNILALDPTNKKAIDGLKMKLE............ 266
69 -34.6004ynw_A mol:protein length:339 ACL4  ali model follow..  95AVKVDEDGSLPEELGGGPEKFLWLAQLHDSVAWFERGATVLRAQIQTEATMIAPEWPETWQTVANVRISQERTEEAREALRRSLGLWTHLPPEDPGVPP--FPSRVSLVRLLIEVDMEEEALEVTERLIAEDDLSVEVWYLGGYARYRLGEKEREASG. 311
70 -34.3003ks2_A mol:protein length:151 Chaperone protein ipgC  ali model follow..  14  24INAIPDDMMDDIYSY--AYDFYNKGRIEEAEVFFRFLCIYDFY------------NVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYT-----------PVFHTGQCQLRLKAPLKAKECFELVIQHSNDEKLKIKAQS-YLDAIQDIKE..... 151
71 -34.3001a17_A mol:protein length:166 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model follow..  18  7....DGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPS------------NAIYYGNRSLAYLRTECYGYALGDATRAIELDKK-----------YIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQ........ 130
72 -34.3001elr_A mol:protein length:131 TPR2A-DOMAIN OF HOP  ali model follow..  11  3.........QALKEKELGNDAYKKKDFDTALKHYDKAKELDPT------------NMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYA----RIGNSYFKEEKYKDAIHFYNKSLAEHRT--------PDVLKKCQQAEKILKEQ 128
73 -34.2004g1t_A mol:protein length:472 Interferon-induced protein with tetratricopep  ali model follow..  15  164ALEKKPKNPEFTSGLA--YRLDNWPPSQNAIDPLRQAIRLNPDNQYEEALEKAPGVTDVLRSAAKFYRRKDEPDKAIELLKKALEYIPNNAYLHCQIGCCYRAK-NGMYGKRKLLELIGHAVAHLKKADEANDNLFRVCSILASLHALADQYEEAEY.. 355
74 -34.1004gco_A mol:protein length:126 Protein STI-1  ali model follow..  15  5..LAYINPELAQEEKNKGNEYFKKGDYPTAMRHYNEAVKRDPE------------NAILYSNRAACLTKLMEFQRALDDCDTCIRLDSK-----------FIKGYIRKAACLVAMREWSKAQRAYEDALQVDPSNEEAREGVRNC.............. 124
75 -34.0003gyz_A mol:protein length:151 Chaperone protein ipgC  ali model follow..  14  28INAIPDDMMDDIYSY--AYDFYNKGRIEEAEVFFRFLCIYDFY------------NVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYT-----------PVFHTGQCQLRLKAPLKAKECFELVIQHSNDEKLKIKAQSYL.............. 147

FFAS is supported by the NIH grant R01-GM087218-01
8 2 8 4 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Jaroszewski L, Godzik A. Clustering of highly homologous sequences to reduce the size of large protein databases. Bioinformatics. 2001 Mar;17(3):282-3.