current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

2ghiA
Query: 2ghi_A mol:protein length:260 transport protein, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst GLESFSLTSHEKKFGVNIEFSDVNFSYPKQTNHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAEGDIKIGGKNVNKYNRNSIRSIIGIVPQDTILFNETIKYNILYGKLDATDEEVIKATKSAQLYDFIEALPKKWDTIVGNKGMKLSGGERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRKNRTLIIIAHRLSTISSAESIILLNKGKIVEKGTHKDLLKLNGEYAEMWNMQSGGNDILast
1 -121.0002ghi_A mol:protein length:260 transport protein  ali model  100  1GLESFSLTSHEKKFGVNIEFSDVNFSYPKQTNHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAEGDIKIGGKNVNKYNRNSIRSIIGIVPQDTILFNETIKYNILYGKLDATDEEVIKATKSAQLYDFIEALPKKWDTIVGNKGMKLSGGERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRKNRTLIIIAHRLSTISSAESIILLNKGKIVEKGTHKDLLKLNGEYAEMWNMQSGGNDI 260
2 -111.0003nh6_A mol:protein length:306 ATP-binding cassette sub-family B member 6, m  ali model follow..  44  31EVKDLPGAGPLRFQKGRIEFENVHFSYA--DGRETLQDVSFTVMPGQTLALVGPSGAGKSTILRLLFRFYDISGCIRIDGQDISQVTQASLRSHIGVVPQDTVLFNDTIADNIRYGRVTAGNDEVEAAAQAAGIHDAIMAFPEGYRTQVGERGLKLSGGEKQRVAIARTILKAPGIILLDEATSALDTSNERAIQASLAKVCANRTTIVVAHRLSTVVNADQILVIKDGCIVERGRHEALLSRGGVYADMWQLQQGQEE. 288
3 -108.0001mv5_A mol:protein length:243 Multidrug resistance ABC transporter ATP-bind  ali model follow..  40  2.................LSARHVDFAYDD--SEQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPAGEITIDGQPIDNISLENWRSQIGFVSQDSAIMAGTIRENLTYGEGDYTDEDLWQVLDLAFARSFVENMPDQLNTEVGERGVKISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMKGRTTLVIAHRLSTIVDADKIYFIEKGQITGSGKHNELVATHPLYAKYVSEQLTVGQ. 243
4 -106.0002ff7_A mol:protein length:247 Alpha-hemolysin translocation ATP-binding pro  ali model follow..  44  1................DITFRNIRFRYKPDSP-VILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPNGQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHKELLSEESLYSYLYQLQSD.... 241
5 -104.0002ixe_A mol:protein length:271 ANTIGEN PEPTIDE TRANSPORTER 1  ali model follow..  32  1.MSPLSGSLAPLNMKGLVKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPGGKVLLDGEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYGLTTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPESRTVLLITQQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCYRSMVEALAAPSD. 262
6 -104.0001jj7_A mol:protein length:260 PEPTIDE TRANSPORTER TAP1  ali model follow..  32  3.....SGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPESRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAMVQAPADAPE. 260
7 -86.2002hyd_A mol:protein length:578 ABC transporter homolog  ali model follow..  44  324.IKNGVGAQPIEIKQGRIDIDHVSFQYNDN-EAPILKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTGQILIDGHNIKDFLTGSLRNQIGLVQQDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSGGQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDRTTLIVAHRLSTITHADKIVVIENGHIVETGTHRELIAKQGAYEHLYSIQN..... 577
8 -83.8003b5x_A mol:protein length:582 Lipid A export ATP-binding/permease protein m  ali model follow..  42  327..ERDNGKYEAERVNGEVDVKDVTFTYQG-KEKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVSGSICLDGHDVRDYKLTNLRRHFALVSQNVHLFNDTIANNIAYAEGEYTREQIEQAARQAHAMEFIENMPQGLDTVIGENGTSLSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDELQKNKTVLVIAHRLSTIEQADEILVVDEGEIIERGRHADLLAQDGAYAQLHRIQFGE... 582
9 -82.2003b5w_A mol:protein length:582 Lipid A export ATP-binding/permease protein m  ali model follow..  44  329....DEGKRVIERATGDVEFRNVTFTYPGR-DVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDGEILMDGHDLREYTLASLRNQVALVSQNVHLFNDTVANNIAYARTEQSREQIEEAARMAYAMDFINKMDNGLDTVIGENGVLLSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLSTIEKADEIVVVEDGVIVERGTHNDLLEHRGVYAQLHKMQFGQ... 582
10 -82.2003b5y_A mol:protein length:582 Lipid A export ATP-binding/permease protein m  ali model follow..  44  329....DEGKRVIDRATGDLEFRNVTFTYPGR-EVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDGHILMDGHDLREYTLASLRNQVALVSQNVHLFNDTVANNIAYARTEESREQIEEAARMAYAMDFINKMDNGLDTIIGENGVLLSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLSTIEQADEIVVVEDGIIVERGTHSELLAQHGVYAQLHKMQFGQ... 582
11 -79.7002yl4_A mol:protein length:595 ATP-BINDING CASSETTE SUB-FAMILY B MEMBER 10,  ali model follow..  44  328...NEGVILNEKSFQGALEFKNVHFAYPARPEVPIFQDFSLSIPSGSVTALVGPSGSGKSTVLSLLLRLYDPSGTISLDGHDIRQLNPVWLRSKIGTVSQEPILFSCSIAENIAYGADDVTAEEIQRVAEVANAVAFIRNFPQGFNTVVGEKGVLLSGGQKQRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDRLMDGRTVLVIAHRLSTIKNANMVAVLDQGKITEYGKHEELLSKNGIYRKLMNKQSFISA. 588
12 -79.7004aa3_A mol:protein length:619 ATP-BINDING CASSETTE SUB-FAMILY B MEMBER 10,  ali model follow..  44  359...NEGVILNEKSFQGALEFKNVHFAYPARPEVPIFQDFSLSIPSGSVTALVGPSGSGKSTVLSLLLRLYDPSGTISLDGHDIRQLNPVWLRSKIGTVSQEPILFSCSIAENIAYGADDPTAEEIQRVAEVANAVAFIRNFPQGFNTVVGEKGVLLSGGQKQRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDRLMDGRTVLVIAHHLSTIKNANMVAVLDQGKITEYGKHEELLSKNGIYRKLMNKQSFIS.. 618
13 -78.1003g5u_A mol:protein length:1284 Multidrug resistance protein 1a  ali model follow..  43  375....SKSGHKPDNIQGNLEFKNIHFSYPSRKEVQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPDGMVSIDGQDIRTINVRYLREIIGVVSQEPVLFATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFDGGVIVEQGNHDELMREKGIYFKLVMTQTAGNE. 630
14 -64.6001q3h_A mol:protein length:286 Cystic fibrosis transmembrane conductance reg  ali model follow..  27  33..............KHSSDENNVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELESEGIIKHSGR-------------VSFCSQFSWIMPGTIKENIIFGVS--DEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQ. 265
15 -64.4002cbz_A mol:protein length:237 MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1  ali model follow..  31  2...............NSITVRNATFTWARSDP-PTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDVEGHVAIKG-------------SVAYVPQQAWIQNDSLRENILFGCQ-LEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEF.......... 225
16 -64.3002pzg_A mol:protein length:241 Cystic fibrosis transmembrane conductance reg  ali model follow..  28  16..............TTEVVMENVTAFWEEGGT-PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELESEGKIKHSGR-------------ISFCSQFSWIMPGTIKENIIFGVS--DEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSK.......... 238
17 -62.7001xmi_A mol:protein length:291 Cystic fibrosis transmembrane conductance reg  ali model follow..  28  38..............DDSLSFSNFSLLG-----TPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELESEGKIKHSGR-------------ISFCSQFSWIMPGTIKENIIAGVS--DEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMGCDSFDQ. 265
18 -62.3002bbo_A mol:protein length:291 Cystic fibrosis transmembrane conductance reg  ali model follow..  27  38..............DDSLSFSNLSLLG-----TPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELESEGKIKHSGR-------------ISFCSQFSWIMPGTIKENIIFGVS--DEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSK.......... 256
19 -61.2002bbs_A mol:protein length:290 Cystic fibrosis transmembrane conductance reg  ali model follow..  29  38..............DDSLSFSNFSLLG-----TPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELESEGKIKHSGR-------------ISFCSQNSWIMPGTIKENIIGVSYD--EYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLRPDFSSK.......... 255
20 -60.6003gd7_A mol:protein length:390 Fusion complex of Cystic fibrosis transmembra  ali model follow..  25  17..............GGQMTVKDLTAKYTEG-GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLRLLNTEGEIQIDGVSWDSITLEQWRKAFGVIPQKVFIFSGTFRKNLDPNA-AHSDQEIWKVADEVGLRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPVTYQIIRRTLKQAFADCTVILCEARIEAMLECDQFLVIEENKVRQYDSILELYHYPA............... 245
21 -43.4002ihy_A mol:protein length:279 ABC transporter, ATP-binding protein  ali model follow..  22  16.................IQLDQIGRMKQ---GKTILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPASGTVNLFGKMPGKVSAETVRQHIGFVSHSKFQEGERVIDVVISGAFKSIG-QDIDDEIRNEAHQLLKLV--GMSAKAQQYIGYLSTGEKQRVMIARALMGQPQVLILDEPAAGLDFIARESLLSILDSLSDTLAMIYVTHFIEEITAFSKILLLKDGQSIQQGAVEDILTSE................ 248
22 -42.9003tui_C mol:protein length:366 Methionine import ATP-binding protein MetN  ali model follow..  22  15.................IKLSNITKVFHQGTRTQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLL-PTEGSVLVDGQELTTLSESELRRQIGMIFQHNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLV-----GLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLLCDQATSALDPATTRSILELLKDINRGLTILLITHEMDVVKRCDCVAVISNGELIEQDTVSEVFSH................. 244
23 -42.4002olj_A mol:protein length:263 Amino acid ABC transporter  ali model follow..  29  19.................IDVHQLKKSFG---SLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDGEIIIDGINLKDTNLNKVREEVGMVFQRFNLFHMTVLNNITLAPMKVRKWPREKAEAKAM--ELLDKV--GLKDKAHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANGMTMVVVTHEMGFAREGDRVLFMDGGYIIEEGKPEDLFDR................. 243
24 -42.3002pcj_A mol:protein length:224 Lipoprotein-releasing system ATP-binding prot  ali model follow..  23  5.................LRAENIKKVIRG----EILKGISLSVKKGEFVSIIGASGSGKSTLLYIL----PTEGKVFLEGKEVDYTNEKELNRKLGFVFQFHYLIPETALENVIVPMLKMGKPKKEAKERGEYLLSEL-----GLGDKLSRKPYELSGGEQQRVAIARALANEPILLFADEPTGNLDSANTKRVMDIFLKIEGGTSIVMVTHERELAELTHRTLEMKDGKVVGEITR....................... 223
25 -42.3001l7v_C mol:protein length:249 Vitamin B12 transport ATP-binding protein btu  ali model follow..  21  2.....................SIVMQLQDVAESTRLGPLSGEVRAGEILHLVGPNGAGKSTLLARMAGMTSGKGSIQFAGQPLEAWSATKLALHRAYLSQQQTPFATPVWHYLTLHQHDKTRTELLNDVAGA-----------ALDDKLGRSTNQLSGGEWQRVRLAAVVLQAGQLLLLDEPMNSLDVAQQSALDKILSALCQGLAIVMSSHDLNTLRHAHRAWLLKGGKMLASGRREEVLTPP................ 224
26 -41.7003tif_A mol:protein length:235 Uncharacterized ABC transporter ATP-binding p  ali model follow..  24  2.................VKLKNVTKTYKGEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNII----PTEGEVYIDNIKTNDLDDDELRDKIGFVFQQFNLIPLTALENVELPLIFKYRGAMSGEERRKRALECLKMAELE-ERFANHKPNQLSGGQQQRVAIARALANNPPIILADQPTWALDSKTGEKIMQLLKKLNEGKTVVVVTHDINVARFGERIIYLKDGEVEREEKLRGFDDR................. 235
27 -41.7001f3o_A mol:protein length:235 HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROT  ali model follow..  25  2.................IKLKNVTKTYKGEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNII----PTEGEVYIDNIKTNDLDDDELRDKIGFVFQQFNLIPLTALENVELPLIFKYRGAMSGEERRKRALECLKMAELE-ERFANHKPNQLSGGQQQRVAIARALANNPPIILADEPTGALDSKTGEKIMQLLKKLNEGKTVVVVTHDINVARFGERIIYLKDGEVEREEKLRGFDDR................. 235
28 -41.3001b0u_A mol:protein length:262 HISTIDINE PERMEASE  ali model follow..  24  7.................LHVIDLHKRYG---GHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSGAIIVNGQNIDKNQLRLLRTRLTMVFQHFNLWHMTVLENVMEAPIQVLGLSKHDARERALKYLAKVGIDERAQGKYPVH---LSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEGKTMVVVTHEMGFARHSSHVIFLHQGKIEEEGDPEQVFGN................. 243
29 -41.2001sgw_A mol:protein length:214 putative ABC transporter  ali model follow..  20  5.................LEIRDLSVGY----DKPVLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPKGEIIYNGVPITKV-----KGKIFFLPEEIIVPRKSVEDYLKA-GVKVNKNEIMDALESVEVLDLKKKLGE------------LSQGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKKGIVIISSREELSY--CDVNENLHKYSTKIDKKD....................... 208
30 -41.2003gfo_A mol:protein length:275 Cobalt import ATP-binding protein cbiO 1  ali model follow..  23  8.................LKVEELNYNYSD--GTHALKGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSGRILFDNKPISRKGIMKLRESIGIVFQDNQLFSASVYQDVSFGAVNMKLPEDEIRKRVDNALKRT-----GIEHLKDKPTHCLSFGQKKRVAIAGVLVMEPKVLILDEPTAGLDPMGVSEIMKLLVEMQKGITIIIATHDIDIVPLCDNVFVMKEGRVILQGNPKEVFAEKEVIRKV.......... 241
31 -40.8002onk_A mol:protein length:240 Molybdate/tungstate ABC transporter, ATP-bind  ali model follow..  28  15.....................................RLNVDFEMGDYCVLLGPTGAGKSVFLELIAGIVKPRGEVRLNGADITPLPPE--RRGIGFVPQDYALFHLSVYRNIAYGLRNVERVEVREMAEKLGIAHLLDRKPA-----------RLSGGERQRVALARALVIQPRLLLLDEPLSAVDLKTKGVLMEELRFVQRDVPILHVTHLIEAAMLADEVAVMLNGRIVEKGKLKELFSAKNGE............. 221
32 -40.7003d31_A mol:protein length:348 Sulfate/molybdate ABC transporter, ATP-bindin  ali model follow..  26  2.................IEIESLSRKWKN-----SLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPSGRILLDGKDVTDLSPE--KHDIAFVYQNYSLFHMNVKKNLEFGKKIKDPKRVLDTARDLKIEHLLDRNPL-----------TLSGGEQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKLTVLHITHQTEARIMADRIAVVMDGKLIQVGKPEEIFEK................. 218
33 -40.6002zu0_C mol:protein length:267 Probable ATP-dependent transporter sufC  ali model follow..  20  16.................LSIKDLHVSVE---DKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLEDYEVTGGTVEFKGKDLLALSPEDAGEGIFMAFQYPVEIPGSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIAKMPEDLLTRSVNFSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRGKRSFIIVTHRILDYIKPDYVHVLYQGRIVKSGDFTLVKQ.................. 249
34 -40.1001vpl_A mol:protein length:256 ABC transporter, ATP-binding protein  ali model follow..  21  10.................VVVKDLRKRIG---KKEILKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSGIVTVFGKNVVE-EPHEVRKLISYLPEEAGAYRNQGIEYLRF----AGFYASSSSEIEEMVERATEIA--GLGEKIKDRVSTYSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASEGLTILVSSHNMLEVEFCDRIALIHNGTIVETGTVEELKERYK............... 232
35 -39.4003fvq_A mol:protein length:359 Fe(3+) ions import ATP-binding protein fbpC  ali model follow..  22  5.................LHIGHLSKSFQ---NTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDGEISLSGKTIKNTNLPVRERRLGYLVQEGVLFHLTVYRNIAYGLGNGKGRTAQERQRIEAMLELT-----GISELAGRYPHELSGGQQQRAALARALAPDPELILLDEPFSALDEQLRRQIREDMIAALRGKSAVFVSHREEALQYADRIAVMKQGRILQTASPHELYRQ................. 229
36 -39.3002yz2_A mol:protein length:266 Putative ABC transporter ATP-binding protein  ali model follow..  27  2................RIEVVNVSHIFHRGTEKKALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPSGDVLYDGERK---KGYEIRRNIGIAFQEDQFFAERVFDEVAFAVKNYPDRDPVPLVKKA-----MEFVGLDFDSFKDRVPFFLSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWTLGKTVILISHDIETVINVDRVVVLEKGKKVFDGTRMEFLEK................. 228
37 -39.0001z47_A mol:protein length:355 putative ABC-transporter ATP-binding protein  ali model follow..  27  1..........MRGGSMTIEFVGVEKIYPG--GARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTGDVWIGGKRVTDLPPQ--KRNVGLVFQNYALFHMTVYDNVSFGPKDEMDARVRELLRFMRLESYANRFPH-----------ELSGGQQQRVALARALAPRPQVLLFDEPFAAIDTQIRRELRTFVRQVHDGVTSVFVTHQEEALEVADRVLVLHEGNVEQFGTPEEVYEK................. 229
38 -38.6002d2e_A mol:protein length:250 SufC protein  ali model follow..  23  4.................LEIRDLWASID---GETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILPEYTVERGEILLDGENILELSPDEARKGLFLAFQYPVEVPGTIANFLRLALQAKLGREVGVAEFWTKVKKALELLDWDESYLSRYLNEGFSGGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMGPNFGALVITHRILNYIQPDKVHVMMDGRVVATGGPELALELE................ 235
39 -38.4002pjz_A mol:protein length:263 Hypothetical protein ST1066  ali model follow..  20  2.................IQLKNVGITLSGKGERFSLENINLEVN-GEKVIILGPNGSGKTTLLRAISGLLPYSGNIFINGMEVRK-----IRNYIRYSTNEAYEIGVTVNDIVYLYEKGLDRDLFLEMLKALKLGEEILR----------RKLYKLSAGQSVLVRTSLALASQPEIVGLDEPFENVDAARRHVISRYIKEY--GKEGILVTHELDMLNLKEYKAYFVGNRLQGPISVSELLES................. 216
40 -36.9001oxs_C mol:protein length:353 ABC transporter, ATP binding protein  ali model follow..  25  2...............VRIIVKNVSKVFKK-GKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSGELYFDDRLVASNGKLIVDRKIGMVFQTWALYNLTAFENIAFPSKEEIRKRVEEVAKILDIHHVLNHFPR-----------ELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSGVTLLVVSHPADIFAIADRVGVLVKGKLVQVGKPEDLYDN................. 231
41 -36.7002nq2_C mol:protein length:253 Hypothetical ABC transporter ATP-binding prot  ali model follow..  24  1.............MNKALSVENLGFYYQAE--NFLFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPQGKI-------------EVYQSIGFVPQFFSSFAYSVLDIVLMGRKSHDYQVAMQALDYLNLTHLAKREFT-----------SLSGGQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDLAQNMTVVFTTHQPNQVVAANKTLLLNKQNFKF-GETRNILTSENL.............. 221
42 -36.5001g6h_A mol:protein length:257 HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID TRANS  ali model follow..  21  8.................LRTENIVKYFG---EFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADGRVYFENKDITNKEPAELHYGIVRTFQTPQPLKETVLENLLIGEICPGESPLNEEEMVEKAFKILEFL--KLSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKKGITFLIIEHRLDIVLNIDHLYVMFNGQIIAEGRGEEEIKN................. 243
43 -35.5002yyz_A mol:protein length:359 Sugar ABC transporter, ATP-binding protein  ali model follow..  25  2...............PSIRVVNLKKYFG---KVKAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTGEIYFDDVLVNDIPPKY--REVGMVFQNYALYHMTVFENIAFPSKDEVEKRVVEIARKLLIDNLLDRKPT-----------QLSGGQQQRVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHLQQGITSVYVTHQAEAMTMASRIAVFNQGKLVQYGTPDEVYDS................. 224
44 -35.2002it1_A mol:protein length:362 362aa long hypothetical maltose/maltodextrin  ali model follow..  27  2...............VEIKLENIVKKFG---NFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTGKIYFDEKDVTELPPKD--RNVGLVFQNWALYHMTVYKNIAFPPREEIDKKVREVAKMLHIDKLLNRYPW-----------QLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKGITTVYVTHQAEALAMADRIAVIREGEILQVGTPDEVYYK................. 224
45 -35.0001g29_1 mol:protein length:372 MALTOSE TRANSPORT PROTEIN MALK  ali model follow..  21  2...............AGVRLVDVWKVFG---EVTAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSGQIYIGDKLVADIFVPPKDRDIAMVFQSYALYHMTVYDNIAFPPRQEIDQRVREVAELLGLTELLNRKPR-----------ELSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLQRGVTTIYVTHQVEAMTMGDRIAVMNRGVLQQVGSPDEVYDK................. 230
46 -34.8002d62_A mol:protein length:375 multiple sugar-binding transport ATP-binding  ali model follow..  21  5...............AEVKLINIWKRFG---DVTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTGQIYIEDNLVADPEVPPKERDVAMVFQSYALYHMTVYDNIAFPPKQEIDKRVREVAEMLGLTELLNRKPR-----------ELSGGQRQRVALGRAIIRRPKVFLMDEPLSNLDAKLRVKMRAELKKLQRGVTTIYVTHQVEAMTMGDRIAVMNKGELQQVGTPDEVYYK................. 233
47 -34.3001vci_A mol:protein length:373 sugar-binding transport ATP-binding protein  ali model follow..  23  11...............VEVKLENLTKRFG---NFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTGRIYFGDRDVTYLPPKD--RNISMVFQSYAVWHMTVYENIAFPPKDEIDKRVRWAAELLQIEELLNRYPA-----------QLSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKVTTIYVTHQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLR................. 233
48 -34.2001q12_A mol:protein length:381 Maltose/maltodextrin transport ATP-binding pr  ali model follow..  26  2...............ASVQLQNVTKAWG---EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITGDLFIGEKRMNDTPPAE--RGVGMVFQSYALYHLSVAENMSFGKKEVINQRVNQVAEVLQLAHLLDRKPK-----------ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKGRTMIYVTHQVEAMTLADKIVVLDAGRVAQVGKPLELYHY................. 224
49 -33.6001ji0_A mol:protein length:240 ABC transporter  ali model follow..  25  7.................LEVQSLHVYYGA----HAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAKGKIIFNGQDITNKPAHVIRMGIALVPEGRRIFPETVYENLMMGAYNRKDKEGIKR-DLEWIFSLFPRLKERLKQLGG----TLSGGEQQMLAIGRALMSRPKLLMMDEPSLGLAPILVSEVFEVIQKINQEGTTILLVEQ-GALKVAHYGYVLETGQIVLEGKASELLDNEMV.............. 232
50 -31.9003j16_B mol:protein length:608 Rli1p  ali model follow..  19  78.................NLEAHVTHRYSANS---FKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGKQKPNGRFDFRGSELQNYFTKMLEDDIKAIPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKIL-----QLENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLATKYVICVEHDLSVLDYSDFVCIIYGVPSVYGVVTLPASVREGINIFL.......... 318
51 -31.0003ozx_A mol:protein length:538 RNase L inhibitor  ali model follow..  24  274.........................KIIKKLGDFQLVVDNGEAKEGEIIGILGPNGIGKTTFARILVGEITAEGSVTPEKQILSYKPQRIFPNYDGTVQQ---YLENASKDALS-----TSSWFFEEVTKRLNLHRLLESNVN-----------DLSGGELQKLYIAATLAKEADLYVLDQPSSYLDVEERYIVAKAIKRVTRKAVTFIIDHDLSIHDYIADRIIVFKGEPEKAGLATS..................... 471
52 -29.6003bk7_A mol:protein length:607 ABC transporter ATP-binding protein  ali model follow..  19  84.................ISIVNLPEQLDEDGVNAFVLYRLPIVKDGMVVGIVGPNGTGKTTAVKILAGQLNDSWDNVIRAFRGNELQNYFERLKNGEIRPVVKPQYVDLLPKAVKGKVRELLKKVDEVGKFEEVVKEL-----ELENVLDRELHQLSGGELQRVAIAAALLRKAHFYFFDEPSSYLDIRQRLKVARVIRRLANGKAVLVVEHDLAVLDYSDVIHVVYGEPGVYGIFSKPKGTRNGI.............. 321
53 -28.4001yqt_A mol:protein length:538 RNase l inhibitor  ali model follow..  19  19....................EDCVHRYGVNA---FVLYRLPVVKEGMVVGIVGPNGTGKSTAVKILAGQLNDSWDGVIRAFRGNELQNYFEKLKNGEIRPVVKPQYVDLIPKAVKGKVIELLKKADETGKLEEVVKAL-----ELENVLEREIQHLSGGELQRVAIAAALLRNATFYFFDEPSSYLDIRQRLNAARAIRRLSEGKSVLVVEHDLAVLDYSDIIHVVYGEPGVYGIFSQPKGTRNGI.............. 245
54 -26.2002iw3_A mol:protein length:986 ELONGATION FACTOR 3A  ali model follow..  17  430.................LCNCEFSLAYG---AKILLNKTQLRLKRARRYGICGPNGCGKSTLMRAIA------------NGQVDGFPTQE-ECRTVYVEHDIDGTHSDTS-DFVFESGVGTKEAIKDKLIEFGFTD------EMIAMPIS----ALSGGWKMKLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYLNTCG---TSITISHDSVFLDNCEYIINYEGLKLRKKGNFTEFVKKCPAAKAYEELSNTDLE. 646
55 -21.5003n73_A mol:protein length:251 Putative 4-hydroxy-2-oxoglutarate aldolase  ali model follow..  10..............KGRVALNVLANNIEN--AKDIFEAAEGYVVVGVLSKDYPTVEEAVTAMKAYGKEI--VSIGLGAGDNRQAAVVAEIAKHTRANLGGKDSWINSLVSPTGKVGYVNISTGPISAAGEIVPIKTAIALVRDMGGNSLKYFPMKGLAHEEEYRAVAKACAEEG---FALEPTGGIDKENFETIVRIALEAVERVIPHVYSSIIDKETGNTKVEDVRELLAVVKKLVDQ..................... 249
56 -18.5003qkr_B mol:protein length:179 DNA double-strand break repair rad50 ATPase  ali model follow..  29  89...........................................................................................................................................................LSGGERIRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKIPQVILVSHDEELKDAADHVIRIS................................. 167
57 -16.3003pih_A mol:protein length:916 UvrABC system protein A  ali model follow..  26  600...................................LKNIDVEIPLGVFVCVTGVSGSGKSSLVDSIEGHENIDKMIAIDQSPIGRTPRSNPATYTKVFDEIRSLFAMTFSFNLKGGRCEACQGQ-MTVDEALEFFKNIPSIKRTLQVKLGQPATTLSGGEAQRIKLASELRKRDTLYILDEPTVGLHFEDVRKLVEVLHRLVRGNTVIVIEHNLDVIKNADHIIDLEGGYIVATGTPEEIAKNPHSYTGRF......... 911
58 -16.2003qkt_A mol:protein length:339 DNA double-strand break repair rad50 ATPase  ali model follow..  17  14...................................HSDTVVEFKEGINL-IIGQNGSGKSSLLDAILRDTYIDLIFEKDGTKYR--AIYIRQGQIDAILESDEAREKVVREVLNLDKFETAYKKLSELKGGSGGTEELIEKVKKYKALAREAALSLSGGERIRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKPQVILVSHDEELKDAADHVIRIS----LENGSSKEVVS.................. 339
59 -15.8002vf7_A mol:protein length:842 EXCINUCLEASE ABC, SUBUNIT A.  ali model follow..  21  513...................................LDNLDVRFPLGVMTSVTGVSGSGKSTLVRLGGDLAQITRLVRVDQKPIGRTPRSNMATYTGLFDQVRKLFAATFSFNVKGGRVDEAHDFFADESAIFRALDTLREVGLGY-LRLGQPATELSGGEAQRIKLATELRRSGRVYVLDEPTTGLHPADVERLQRQLVKLVDGNTVIAVEHKMQVVAASDWVLDIDGGRLVAQGTPAEVAQAAGSVTAPY......... 836
60 -14.9001e69_A mol:protein length:322 CHROMOSOME SEGREGATION SMC PROTEIN  ali model follow..  17  12................................KSFGRPSLIGFSDRVT-AIVGPNGSGKSNIIDAIKWVFGEQSKKELRASEKFDMNTYYLNGSPVRLKDIRDRFAGTGLGVDFYSIVGQGQIDRIVNASPEEVSEAKSILDAGFEISIRKPGRRLSGGEKALVGLALLFIKPSPFYVLDEVDSPLDDYNAERFKRLLKENSKHTQFIVITHNKIVMEAADLLH----GVTMVNGVSAIV.................... 304
61 -14.9002r6f_A mol:protein length:972 Excinuclease ABC subunit A  ali model follow..  26  634...................................LKNVSVKIPLGTFVAVTGVSGSGKSTLVN-IRGLEHLDKVIDIDQSPIGRTPRSNPATYTGVFDDIRDVFASTFSFNVKGGRCEACHGD-VLDMTVEDALDFFASIPK---MKLGQPATTLSGGEAQRVKLAAELSNGRTLYILDEPTTGLHVDDIARLLDVLHRLVDGDTVLVIEHNLDVIKTADYIIDLRGGQIVAVGTPEEVAEVKESHTGRY......... 945
62 -14.7003zqj_A mol:protein length:993 UVRABC SYSTEM PROTEIN A  ali model follow..  23  648...................................LRGIDVSFPLGVLTSVTGVSGSGKSTLVTRVTGLDYLDKLVRVDQSPIGRTPRSNPATYTGVFDKIRTLFAAT---EVHYKGKTVSEVLDMSIEEAAEFFEPIAGVHRYLRTRLGQPAPTLSGGEAQRVKLASELSTGRTVYILDEPTTGLHFDDIRKLLNVINGLVDGNTVIVIEHNLDVIKTSDWIIDLGGGTVVAQGTPEDVAAVPASYTGKF......... 959
63 -14.3003ux8_A mol:protein length:670 Excinuclease ABC, A subunit  ali model follow..  25  332...................................LKNVSVKIPLGTFVAVTGVSGSGKSTLHRDIRGLEHLDKVIDID----QSPIGRTPRSNPATYTG--DVFASTFSFNVKGGRCEACHGD-VLDMTVEDALDFFASIPKGLGMKLGQPATTLSGGEAQRVKLAAELSNGRTLYILDEPTTGLHVDDIARLLDVLHRLVDGDTVLVIEHNLDVIKTADYIIDLRGGQIVAVGTPEEVAEVKESHTGRYLKPILERDR 652
64 -14.1003kta_B mol:protein length:173 Chromosome segregation protein smc  ali model follow..  23  44............................................................................................................................................FSGGLEIEAKPAGKDMSGGEKALTALAFVFFKPAPFYLFDEIDAHLDDANVKRVADLIKESSKESQFIVITLRDVMMANADKII----GVSMRDGVSKVV.................... 149
65 -13.6003qku_A mol:protein length:359 DNA double-strand break repair rad50 ATPase  ali model follow..  29  269...........................................................................................................................................................LSGGERIRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKPQVILVSHDEELKDAADHVIRIS................................. 347
66 -12.9002i3b_A mol:protein length:189 Human Cancer-Related NTPase  ali model follow..  15  1.............................................ARHVFLTGPPGVGKTTLIHKASEVLKSSG-VPVDGFYTEEVRQGGRRIGFDVVT--------------------------LSGTRGPLSRVGLEPPPGKRECRVGQYVVDLTSFEQLALPVLRNADCGQRVCVIDEI-GKMELFSQLFIQAVRQTLSTPGTIILGTIPVEEIRNRKDVKVFNVTKENRNHLLPDIVTC................. 183
67 -11.8001ye8_A mol:protein length:178 Hypothetical UPF0334 kinase-like protein AQ_1  ali model follow..  12  2...............................................KIIITGEPGVGKTTLVKKIVERLGKR----AIGFWTEEVRDPETKKRTGFRIITTEGKKKIFSSKFFTSKKLVGSYGVNV------------------------QYFEELAIPILERAYREAKKDRRKVIIIDE-IGKMELFSKKFRDLVRQIMHDPNVNVVTIPIRDVHPLVKEIRRLPGAVLIE........................... 159
68 -11.7002qor_A mol:protein length:204 Guanylate kinase  ali model follow..  13  1........................................MAMARIPPLVVCGPSGVGKGTLIKKVLSEFPSRFRFSINGVDYYFVDKDDFER---KLKEGQFLEFDKYANNF-YGTLKSEYDLAVGEGKICLFE-------------MNINGVKQLKESKHIQDGIYIFVKPPSIDILLGRLKNRNTEKPEEINKRMQELTREMDEFIVNDDLARTYAELREYLLGSYPQLRGG......................... 198
69 -11.2001w1w_A mol:protein length:430 STRUCTURAL MAINTENANCE OF CHROMOSOME 1  ali model follow..  13  259................................................................................LKIKKKRKELFEKTFDYVSDHLDAIYRELTKN------PNSNVELAGGNASLTIEDEDEPFNAGIKYHATPPLKRLSGGEKTVAALALLFYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQIVISLKNTMFEKSDALVGVY--RQQQENSSKII.................... 421
70 -11.2001z6g_A mol:protein length:218 guanylate kinase  ali model follow..  15  14..........................................MNNIYPLVICGPSGVGKGTLIKKLLNEFPNYFYFSVEGVDYYFIDKTIFED---KLKNEDFLEYDNYANNF-YGTLKSEYDKAKEQNKICLFEMNIN----------GVKQLKKSTHIKNALYI---FIKPPSTDVLLSRLLTRNTENQEQIQKRMEQLNIE--------HEANLLNFNLSIINDD................................ 187
71 -11.0003iuy_A mol:protein length:228 Probable ATP-dependent RNA helicase DDX53  ali model follow..  19  54..........................................ILQGIDLIVVAQTGTGKTLSYLMGFIHLDSQPISREQRNGPGMLVLTPTRELALHVEAECSKYSYGLKSICIYGGRNRNGQ--------------IEDISKGVDIIIATPGRLNDLQMNNSVNLRSI-----TYLVIDEADKMLDMEFEPQIRKILLDVRPDRQTVMTS................................................. 205
72 -10.9002bdt_A mol:protein length:189 BH3686  ali model follow..  12  3..............................................KLYIITGPAGVGKSTTCKRLAA--QLDNSAYIEGDIINHMVVGGYRPPWESDELLALTWKNDLTVNFLLAQNDVVLDYIAFPDEAEALAQTVQAKVDDVEIRF----IILWTNRE--ELLRRDALRKKDEQMGERCLELVEEFESKGIDERYFYNTSHLQPTNLNDIVKNLKTNPRFIFCMAGDPLE........................... 183
73 -10.9001lvg_A mol:protein length:198 Guanylate kinase  ali model follow..  13  1..........................................MAGPRPVVLSGPSGAGKSTLLKKLFQEHSSIFGFSVDGKDYYFVTREMMQR---DIAAGDFIEHAEFSGNL-YGTSKEAVRAVQAMNRICVLD------------------VDLQGVRSIKKTDLCIFVQPPSLDVLEQRLRLRNTETEESLAKRLAAARTDMESSKEPGLFDLVIINDDL..................................... 174
74 -10.7003fe2_A mol:protein length:242 Probable ATP-dependent RNA helicase DDX5  ali model follow..  18  63..........................................ALSGLDMVGVAQTGSGK-TLSYLLPAIVHINHQPFLERGD---LVLAPTRELAQQVQQVAAEYCRALKSTCIYGGAPKGPQ--------------IRDLERGVEICIATPGRLIDFLECGKTNLRRT-----TYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALE...................... 241
75 -10.6002gxq_A mol:protein length:207 heat resistant RNA dependent ATPase  ali model follow..  17  35..........................................ALEGKDLIGQARTGTGKTLAFAL---IAERLAPSQERGRKPRALVLTPTRELALQVASELTAVAPHLKVVAVYGGTGYGKQ--------------KEALLRGADAVVATPGRALDYLRQGVLDLSRV-----EVAVLDEADEMLSMGFEEEVEALLSATPPSRQTLLFSATLPS............................................ 187

FFAS is supported by the NIH grant R01-GM087218-01
6 1 2 2 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.