current user: public




Query: 2ghi_A mol:protein length:260 transport protein, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst GLESFSLTSHEKKFGVNIEFSDVNFSYPKQTNHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAEGDIKIGGKNVNKYNRNSIRSIIGIVPQDTILFNETIKYNILYGKLDATDEEVIKATKSAQLYDFIEALPKKWDTIVGNKGMKLSGGERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRKNRTLIIIAHRLSTISSAESIILLNKGKIVEKGTHKDLLKLNGEYAEMWNMQSGGNDILast
1 -123.0002ghi_A mol:protein length:260 transport protein  ali model  100  1GLESFSLTSHEKKFGVNIEFSDVNFSYPKQTNHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAEGDIKIGGKNVNKYNRNSIRSIIGIVPQDTILFNETIKYNILYGKLDATDEEVIKATKSAQLYDFIEALPKKWDTIVGNKGMKLSGGERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRKNRTLIIIAHRLSTISSAESIILLNKGKIVEKGTHKDLLKLNGEYAEMWNMQSGGNDI 260
2 -107.0003nh6_A mol:protein length:306 ATP-binding cassette sub-family B member 6, m  ali model follow..  45  32.VKDLPGAGPLRFQKGRIEFENVHFSYA--DGRETLQDVSFTVMPGQTLALVGPSGAGKSTILRLLFRFYDISGCIRIDGQDISQVTQASLRSHIGVVPQDTVLFNDTIADNIRYGRVTAGNDEVEAAAQAAGIHDAIMAFPEGYRTQVGERGLKLSGGEKQRVAIARTILKAPGIILLDEATSALDTSNERAIQASLAKVCANRTTIVVAHRLSTVVNADQILVIKDGCIVERGRHEALLSRGGVYADMWQLQQGQEE. 288
3 -104.0005dgx_A mol:protein length:256 Lipid A export ATP-binding/permease protein M  ali model follow..  38  3.AEKETGSKELAKVDGNVTIKDLSFAFG---EHKVLSGVSVDIKAGQTVAFVGKSGSGKTTLTSIISRFYTQHGEILLDGVDTRELTLENLRSHLSIVSQNVHLFDDTVYNNIAFGSREVSEEEVIDALKRANAYEFVQELSDGINTNIGNNGSKLSGGQRQRISIARALLKNAPVLIFDEATSALDNESERVVQQALESLTKSCTTIVIAHRLSTVENADKIVVMDGGRVVESGKHQELLEQGGLYTRLYQSGLQ.... 256
4 -103.0005eum_A mol:protein length:258 Lipid A export ATP-binding/permease protein M  ali model follow..  45  6.....DGAYKAEPAKGELEFKNVSFAYQGK-EELALNNISFSVPAGKTVALVGRSGSGKSTIANLVTRFYDIEGEILLDGVNIQDYRLSNLRENCAVVSQQVHLFNDTIANNIAYAAQDKSREEIIAAAKAAYALEFIEKLPQGFDTVIGENGASLSGGQRQRLAIARALLRNSPVLILDEATSALDTESERAIQSALEELKKDRTVVVIAHRLSTIENADEILVIDHGEIRERGNHKTLLEQNGAYKQLHSMQFTG... 258
5 -103.0005idv_A mol:protein length:279 Lipid A export ATP-binding/permease protein M  ali model follow..  39  19...EQNSGELKPQLQGAIRFDHVVLNYAD--GTQAIKDFSLDIRPGETVALVGRSGAGKTSLVNMLVRFQEVSGQIYLDDLPIRDIELSSLRTQIAMVNQQVVLFNRTVRENIAYGQHNASDEDVIAAAKAAYAHDFIMNLPNGYDTVLGAQGLNLSGGQRQRIAIARAILKNAPILILDEATSALDNESEHFIQQAFDEAMQDRTTIVIAHRLSTIENADRIVVMDRGQIVEQGTHQELLAKHGAYYQLHQRNFEDH.. 273
6 -101.0001mv5_A mol:protein length:243 Multidrug resistance ABC transporter ATP-bind  ali model follow..  40  2.................LSARHVDFAYDD--SEQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTGEITIDGQPIDNISLENWRSQIGFVSQDSAIMAGTIRENLTYGEGDYTDEDLWQVLDLAFARSFVENMPDQLNTEVGERGVKISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMKGRTTLVIAHRLSTIVDADKIYFIEKGQITGSGKHNELVATHPLYAKYVSEQLTVGQ. 243
7 -100.0002ff7_A mol:protein length:247 Alpha-hemolysin translocation ATP-binding pro  ali model follow..  44  1................DITFRNIRFRYKPD-SPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPEGQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHKELLSEESLYSYLYQLQSD.... 241
8 -95.8001jj7_A mol:protein length:260 PEPTIDE TRANSPORTER TAP1  ali model follow..  32  3.....SGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPESRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAMVQAPADAPE. 260
9 -95.6002ixe_A mol:protein length:271 ANTIGEN PEPTIDE TRANSPORTER 1  ali model follow..  32  1.MSPLSGSLAPLNMKGLVKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQTGGKVLLDGEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPESRTVLLITQQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCYRSMVEALAAPSD. 262
10 -94.9004mrn_A mol:protein length:614 ABC transporter related protein  ali model follow..  44  345.VADVPNAPALVVNRPSVTFDNVVFGYD--RDREILHGLSFEVAAGSRVAIVGPSGAGKSTIARLLFRFYDPWGRILIDGQDIAHVTQTSLRAALGIVPQDSVLFNDTIGYNIAYGRDGASRAEVDAAAKGAAIADFIARLPQGYDTEVGERGLKLSGGEKQRVAIARTLVKNPPILLFDEATSALDTRTEQDILSTMRAVASHRTTISIAHRLSTIADSDTILVLDQGRLAEQGSHLDLLRRDGLYAEMWARQAAESA. 601
11 -94.4003vx4_A mol:protein length:273 Putative ABC transporter, ATP-binding protein  ali model follow..  35  19.FEKDGDLSENSFLDGDISFENLSYKYG--FGRDTLSDINLSIKKGSKVSLVGASGSGKTTLAKLIVNFYEPNGIVRINGNDLKVIDKTALRRHISYLPQQAYVFSGSIMDNLVLGAKEGTSEDIIRACEIAEIRSDIEQMPQGYQTELSD-GAGISGGQKQRIALARALLTQAPVLILDAATSSLDILTEKKIISNLLQM-TEKTIIFVAHRLSISQRTDEVIVMDQGKIVEQGTHKELLAKQGFYYNLFN........ 267
12 -93.6004q7l_A mol:protein length:256 Uncharacterized ABC transporter ATP-binding p  ali model follow..  47  1.............MSGEIEFKNVWFSYD--KKKPVLKDITFHIKPGQKVALVGPTGSGKTTIVNLLMRFYDVDGQILVDGIDIRKIKRSSLRSSIGIVLQDTILFSTTVKENLKYGNPGATDEEIKEAAKLTHSDHFIKHLPEGYETVLTDNGEDLSQGQRQLLAITRAFLANPKILILDEATSNVDTKTEKSIQAAMWKLMEGKTSIIIAHRLNTIKNADLIIVLRDGEIVEMGKHDELIQKRGFYYELFTSQYGLVV. 245
13 -92.4004q7m_B mol:protein length:271 Uncharacterized ABC transporter ATP-binding p  ali model follow..  47  1.............MSGEIEFKNVWFSYD--KKKPVLKDITFHIKPGQKVALVGPTGSGKTTIVNLLMRFYDVDGQILVDGIDIRKIKRSSLRSSIGIVLQDTILFSTTVKENLKYGNPGATDEEIKEAAKLTHSDHFIKHLPEGYETVLTDNGEDLSQGQRQLLAITRAFLANPKILILDEATSNVDTKTEKSIQAAMWKLMEGKTSIIIAHRLNTIKNADLIIVLRDGEIVEMGKHDELIQKRGFYYELFTSQYGLVV. 245
14 -92.2004myc_A mol:protein length:598 Iron-sulfur clusters transporter ATM1, mitoch  ali model follow..  45  322.IKNAERPLMLPEVPYDITFENVTFGYH--PDRKILKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPEGRILINGRDIKEYDIDALRKVIGVVPQDTPLFNDTIWENVKFGRIDATDEEVITVVEKAQLAPLIKKLPQGFDTIVGERGLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRDTSGSRTSVYIAHRLRTIADADKIIVLDNGRVREEGKHLELLAMPGLYRELWTIQEDLDH. 582
15 -89.7002hyd_A mol:protein length:578 ABC transporter homolog  ali model follow..  44  324.IKNGVGAQPIEIKQGRIDIDHVSFQYNDN-EAPILKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTGQILIDGHNIKDFLTGSLRNQIGLVQQDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSGGQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDRTTLIVAHRLSTITHADKIVVIENGHIVETGTHRELIAKQGAYEHLYSIQN..... 577
16 -83.4003g5u_A mol:protein length:1284 Multidrug resistance protein 1a  ali model follow..  43  373..SFSKSGHKPDNIQGNLEFKNIHFSYPSRKEVQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDLDGMVSIDGQDIRTINVRYLREIIGVVSQEPVLFATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFDGGVIVEQGNHDELMREKGIYFKLVMTQTAGNE. 630
17 -83.0003zdq_A mol:protein length:595 ATP-BINDING CASSETTE SUB-FAMILY B MEMBER 10,  ali model follow..  45  339..............QGALEFKNVHFAYPARPEVPIFQDFSLSIPSGSVTALVGPSGSGKSTVLSLLLRLYDPSGTISLDGHDIRQLNPVWLRSKIGTVSQEPILFSCSIAENIAYGADDVTAEEIQRVAEVANAVAFIRNFPQGFNTVVGEKGVLLSGGQKQRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDRLMDGRTVLVIAHRLSTIKNANMVAVLDQGKITEYGKHEELLSKNGIYRKLMNKQSFISA. 588
18 -82.9004ayw_A mol:protein length:619 ATP-BINDING CASSETTE SUB-FAMILY B MEMBER 10  ali model follow..  45  370..............QGALEFKNVHFAYPARPEVPIFQDFSLSIPSGSVTALVGPSGSGKSTVLSLLLRLYDPSGTISLDGHDIRQLNPVWLRSKIGTVSQEPILFSCSIAENIAYGADDPTAEEIQRVAEVANAVAFIRNFPQGFNTVVGEKGVLLSGGQKQRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDRLMDGRTVLVIAHHLSTIKNANMVAVLDQGKITEYGKHEELLSKNGIYRKLMNKQSFI... 617
19 -82.9003b5w_A mol:protein length:582 Lipid A export ATP-binding/permease protein m  ali model follow..  45  331......GKRVIERATGDVEFRNVTFTYPGR-DVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDGEILMDGHDLREYTLASLRNQVALVSQNVHLFNDTVANNIAYARTEYSREQIEEAARMAYAMDFINKMDNGLDTVIGENGVLLSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLSTIEKADEIVVVEDGVIVERGTHNDLLEHRGVYAQLHKMQFGQ... 582
20 -82.9003b5x_A mol:protein length:582 Lipid A export ATP-binding/permease protein m  ali model follow..  42  330.....NGKYEAERVNGEVDVKDVTFTYQGK-EKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDGSICLDGHDVRDYKLTNLRRHFALVSQNVHLFNDTIANNIAYAAGEYTREQIEQAARQAHAMEFIENMPQGLDTVIGENGTSLSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDELQKNKTVLVIAHRLSTIEQADEILVVDEGEIIERGRHADLLAQDGAYAQLHRIQFGE... 582
21 -82.8003b5y_A mol:protein length:582 Lipid A export ATP-binding/permease protein m  ali model follow..  45  331......GKRVIDRATGDLEFRNVTFTYPGR-EVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIEGHILMDGHDLREYTLASLRNQVALVSQNVHLFNDTVANNIAYARTEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVLLSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLSTIEQADEIVVVEDGIIVERGTHSELLAQHGVYAQLHKMQFGQ... 582
22 -80.8003wme_A mol:protein length:612 ATP-binding cassette, sub-family B, member 1  ali model follow..  43  336..PGAEVVTQPLVLKQGIVFENVHFRYPTRMNVEVLRGISLTIPNGKTVAIVGGSGAGKSTIIQLLMRFYDIEGLLLFDGTPAWNYDFHALRSQIGLVSQEPVLFSGTIRDNILYGKRDATDEEVIQALREANAYSFVMALPDGLDTEVGERGLALSGGQKQRIAIARAILKHPTLLCLDESTSALDAESEALVQEALDRMSDGVTSVVIAHRLSTVARADLILVMQDGVVVEQGNHSELMAPSGFYYQLVEKQLASGD. 600
23 -80.8003wmf_A mol:protein length:621 ATP-binding cassette, sub-family B, member 1  ali model follow..  43  336..PGAEVVTQPLVLKQGIVFENVHFRYPTRMNVEVLRGISLTIPNGKTVAIVGGSGAGKSTIIQLLMRFYDIEGLLLFDGTPAWNYDFHALRSQIGLVSQEPVLFSGTIRDNILYGKRDATDEEVIQALREANAYSFVMALPDGLDTEVGERGLALSGGQKQRIAIARAILKHPTLLCLDESTSALDAESEALVQEALDRMSDGVTSVVIAHRLSTVARADLILVMQDGVVVEQGNHSELMAPSGFYYQLVEKQLASGD. 600
24 -80.4004pl0_A mol:protein length:580 Microcin-J25 export ATP-binding/permease prot  ali model follow..  28  330.TSPSIPFLNME-RKLNLSIRELSFSYS--DDKKILNSVSLDLFTGKMYSLTGPSGSGKSTLVKIISGYYKNFGDIYLNDISLRNISDEDLNDAIYYLTQDDYIFMDTLRFNLRLANYDASENEIFKVLKLANL-SVVNNEPVSLDTHLINRGNNYSGGQKQRISLARLFLRKPAIIIIDEATSALDYINESEILSSIRTHFPDALIINISHRINLLECSDCVYVLNEGNIVASGHFRDLMVSNEYISGLASVTE..... 580
25 -80.4005EG1 Entity 1(prereleased)  ali follow..  28  330.TSPSIPFLNME-RKLNLSIRELSFSYS--DDKKILNSVSLDLFTGKMYSLTGPSGSGKSTLVKIISGYYKNFGDIYLNDISLRNISDEDLNDAIYYLTQDDYIFMDTLRFNLRLANYDASENEIFKVLKLANL-SVVNNEPVSLDTHLINRGNNYSGGQKQRISLARLFLRKPAIIIIDEATSALDYINESEILSSIRTHFPDALIINISHRINLLECSDCVYVLNEGNIVASGHFRDLMVSNEYISGLASVTE..... 580
26 -80.0003qf4_A mol:protein length:587 ABC transporter, ATP-binding protein  ali model follow..  36  325AIEEADNALALPNVEGSVSFENVEFRYFE-NTDPVLSGVNFSVKPGSLVAVLGETGSGKSTLMNLIPRLIDPEGRVEVDELDVRTVKLKDLRGHISAVPQETVLFSGTIKENLKWGREDATDDEIVEAAKIAQIHDFIISLPEGYDSRVERGGRNFSGGQKQRLSIARALVKKPKVLILDDCTSSVDPITEKRILDGLKRYTKGCTTFIITQKIPTALLADKILVLHEGKVAGFGTHKELLEHCKPYREIYESQFGNGVM 584
27 -79.9004q4j_A mol:protein length:587 ABC transporter  ali model follow..  35  325AIEEADNALALPNVEGSVSFENVEFRYFE-NTDPVLSGVNFSVKPGSLVAVLGETGSGKSTLMNLIPRLIDPEGRVEVDELDVRTVKLKDLRGHISAVPQETVLFSGTIKENLKWGREDATDDEIVEAAKIAQIHDFIISLPEGYDSRVERGGRNFSGGQKQRLSIARALVKKPKVLILDDSTCSVDPITEKRILDGLKRYTKGSTTFIITQKIPTALLADKILVLHEGKVAGFGTHKELLEHSKPYREIYESQFGNGVM 584
28 -79.6003qf4_B mol:protein length:598 Uncharacterized ABC transporter ATP-binding p  ali model follow..  46  340..KDDPDAVELREVRGEIEFKNVWFSYD--KKKPVLKDITFHIKPGQKVALVGPTGSGKTTIVNLLMRFYDVDGQILVDGIDIRKIKRSSLRSSIGIVLQDTILFSTTVKENLKYGNPGATDEEIKEAAKLTHSDHFIKHLPEGYETVLTDNGEDLSQGQRQLLAITRAFLANPKILILDEATSNVDTKTEKSIQAAMWKLMEGKTSIIIAHRLNTIKNADLIIVLRDGEIVEMGKHDELIQKRGFYYELFTSQYGL... 593
29 -79.1004ry2_A mol:protein length:730 ABC-type bacteriocin transporter  ali model follow..  46  482..........VISLKGDIEFRNVDFRYG--LRKPVLKNINLTIPKGKTVAIVGESGSGKTTLAKLLMNFYSPKGDILINGHSIKNISLELIRKKIAFVSQDVFIFSGTVKENLCLGNENVDMDEIIKAAKMANAHDFIEKLPLKYDTFLNESGANLSEGQKQRLAIARALLKKPDILILDEATSNLDSITENHIKDAIYGLEDDVTVIIIAHRLSTIVNCDKIYLLKDGEIVESGSHTELIALKGCYFKMWKQTEN.... 726
30 -79.0004f4c_A mol:protein length:1321 Multidrug resistance protein pgp-1  ali model follow..  41  403....SKAGRKDMKIKGDITVENVHFTYPSRPDVPILRGMNLRVNAGQTVALVGSSGCGKSTIISLLLRYYDLKGKITIDGVDVRDINLEFLRKNVAVVSQEPALFNCTIEENISLGKEGITREEMVAACKMANAEKFIKTLPNGYNTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDAESEGIVQQALDKAAKGRTTIIIAHRLSTIRNADLIISCKNGQVVEVGDHRALMAQQGLYYDLVTAQTFTDA. 658
31 -66.2005c73_C mol:protein length:564 Protein glycosylation K  ali model follow..  37  346..............NQELKICNLSFGYEG--KKYLFKNLNLNIKKGEKIAFIGESGCGKSTLVDLIIGLLKPKGQILIDKQELNASNAKNYRQKIGYIPQNIYLFNDSIAKNITFGD-AVDEEKLNKVIKQANLEHFIKNLPQGVQTKVGDGGSNLSGGQKQRIAIARALYLEPEILVLDQATSALDTQSEAKIMDEIYKISKDKTMIIIAHRLSTITQCDKVYRLEHGKLKEE.......................... 563
32 -61.7001q3h_A mol:protein length:286 Cystic fibrosis transmembrane conductance reg  ali model follow..  27  33..............KHSSDENNVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELESEGIIKHSGR-------------VSFCSQFSWIMPGTIKENIIFGVS-YDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQ. 265
33 -61.4002pzg_A mol:protein length:241 Cystic fibrosis transmembrane conductance reg  ali model follow..  28  15.............TTTEVVMENVTAFWEEGGT-PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELESEGKIKHSGR-------------ISFCSQFSWIMPGTIKENIIFGVS-YDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSK.......... 238
34 -61.1001xmi_A mol:protein length:291 Cystic fibrosis transmembrane conductance reg  ali model follow..  27  33..............KTSNGDDSLSFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELESEGKIKHSGR-------------ISFCSQFSWIMPGTIKENIIAGVS--DEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMGCDSFDQ. 265
35 -60.8002cbz_A mol:protein length:237 MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1  ali model follow..  31  2...............NSITVRNATFTWARSDP-PTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDVEGHVAIKGS-------------VAYVPQQAWIQNDSLRENILFGCQ-LEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEF.......... 225
36 -60.7004c3z_A mol:protein length:266 MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1  ali model follow..  29  20..............TNSITVRNATFTWARSDP-PTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDVEGHVAIKGS-------------VAYVPQQAWIQNDSLRENILFGC-QLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQ. 253
37 -60.1002bbo_A mol:protein length:291 Cystic fibrosis transmembrane conductance reg  ali model follow..  26  40.....................SLSFSNLSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELESEGKIKHSGR-------------ISFCSQFSWIMPGTIKENIIFGVS--DEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMGCDSFDQ. 265
38 -59.5002bbs_A mol:protein length:290 Cystic fibrosis transmembrane conductance reg  ali model follow..  27  33..............KTSNGDDSLSFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELESEGKIKHSGR-------------ISFCSQNSWIMPGTIKENIIGVSYD--EYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLRPDFSSKLMGCDSFDQ. 264
39 -57.1003gd7_A mol:protein length:390 Fusion complex of Cystic fibrosis transmembra  ali model follow..  25  16.............SGGQMTVKDLTAKYTEG-GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLRLLNTEGEIQIDGVSWDSITLEQWRKAFGVIPQKVFIFSGTFRKNLDPNA-AHSDQEIWKVADEVGLRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPVTYQIIRRTLKQAFADCTVILCEARIEAMLECDQFLVIEENKVRQYDSILELYHYPA............... 245
40 -43.9004huq_B mol:protein length:279 Energy-coupling factor transporter ATP-bindin  ali model follow..  28  6.................ISVDHLTYQYDEN-QAPALTDVSFTVHAGEWLAIVGHNGSGKSTLAKSL--LPFTQGSVTVGGITLTPETVWQVREQIGMIFQDNQFVGATVEDDVAFGSRDEMVPRVQAALAQVGMTSFAQREPS-----------SLSGGQKQRVALAGIVAIAPKILILDEATSMLDPQGRIEMLAIVRQLRQQQTVISITHDIDEAASADRVLVIDDGRLVDEAVPSQIFERGTQLVEM.......... 237
41 -43.4004hlu_D mol:protein length:268 Energy-coupling factor transporter ATP-bindin  ali model follow..  24  1......GSGGSHMGSGRIELNSVSFRYNGD---YVLKDVNAEFETGKIYVVVGKNGSGKTTLLKILAGLLAAAGEIFLDGSP---ADPFLLRKNVGYVFQSSQIIGATVEEDVAFSDESEMRKRIKKVLELVGLSGLAAADPL-----------NLSGGQKQRLAIASMLARDTRFLALDEPVSMLDPPSQREIFQVLESLNEGKGIILVTHELEYLDDMDFILHISNGTIDFCGSWEEFVERE................ 230
42 -43.2005d7t_A mol:protein length:300 Energy-coupling factor transporter ATP-bindin  ali model follow..  27  14.................ISFDHVTFTYPDS-PRPALSDLSFAIERGSWTALIGHNGSGKSTVSKLINGLLAPDSSITVDGVKLGADTVWEVREKVGIVFQDNQFVGATVSDDVAFGPRPEMLKIVAQAVADVGMADYADSEPS-----------NLSGGQKQRVAIAGILAVKPQVIILDESTSMLDPEGKEQILDLVRKIKEDNTVISITHDLEEAAGADQVLVLDDGQLLDQGKPEEIFPKVEMLKRI.......... 248
43 -41.3001l7v_C mol:protein length:249 Vitamin B12 transport ATP-binding protein btu  ali model follow..  22  13................................STRLGPLSGEVRAGEILHLVGPNGAGKSTLLARMAGMTSGKGSIQFAGQPLEAWSATKLALHRAYLSQQQTPFATPVWHYLTLHQHDKTRTELLNDVAGA-----------ALDDKLGRSTNQLSGGEWQRVRLAAVVLQAGQLLLLDEPMNSLDVAQQSALDKILSALCQGLAIVMSSHDLNTLRHAHRAWLLKGGKMLASGRREEVLTPP................ 224
44 -41.3002pjz_A mol:protein length:263 Hypothetical protein ST1066  ali model follow..  20  2.................IQLKNVGITLSGKGERFSLENINLEVN-GEKVIILGPNGSGKTTLLRAISGLLPYSGNIFINGMEVRK-----IRNYIRYSTNEAYEIGVTVNDIVYLYEKGLDRDLFLEMLKALKLGEEILR----------RKLYKLSAGQSVLVRTSLALASQPEIVGLDEPFENVDAARRHVISRYIKEY--GKEGILVTHELDMLNLYKEAYFLVGNRLQGPISVSELLES................. 216
45 -41.1003d31_A mol:protein length:348 Sulfate/molybdate ABC transporter, ATP-bindin  ali model follow..  26  2.................IEIESLSRKWKN-----SLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDGRILLDGKDVTDLSPE--KHDIAFVYQNYSLFHMNVKKNLEFGKKIKDPKRVLDTARDLKIEHLLDRNPL-----------TLSGGEQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKLTVLHITHQTEARIMADRIAVVMDGKLIQVGKPEEIFEK................. 218
46 -41.1002olj_A mol:protein length:263 Amino acid ABC transporter  ali model follow..  30  19.................IDVHQLKKSFG---SLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFDGEIIIDGINLKATNLNKVREEVGMVFQRFNLFHMTVLNNITLAPMKVRKWPREKAEAKAMELLDKVGLKDKAHAYPDS----LSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANGMTMVVVTHEMGFAREGDRVLFMDGGYIIEEGKPEDLFDR................. 243
47 -41.0004u00_A mol:protein length:244 Amino acid ABC transporter, ATP-binding prote  ali model follow..  27  5.................IRIRNLHKWFGP----HVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQGEVVVDGLSVKD-ALREIRREVGMVFQQFNLFHMTVLENVTLAPMRVRRWPREKAEKKALELLERVGILDQARKYPAQ----LSGGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGMTMVVVTHEMGFAREADRVVFMDGGQIVEEGRPEEIFTR................. 228
48 -41.0004fi3_C mol:protein length:249 Vitamin B12 import ATP-binding protein BtuD  ali model follow..  21  13................................STRLGPLSGEVRAGEILHLVGPNGAGKSTLLARMAGMTSGKGSIQFAGQPLEAWSATKLALHRAYLSQQQTPFATPVWHYLTLHQHDKTRTELLNDVAGA-----------ALDDKLGRSTNQLSGGEWQRVRLAAVVLQAGQLLLLDQPMCSLDVAQQSALDKILSALSQGLAIVMSSHDLNTLRHAHRAWLLKGGKMLASGRREEVLTPP................ 224
49 -40.9004yms_J mol:protein length:240 ABC-type polar amino acid transport system, A  ali model follow..  27  2.................IFVNDVYKNFGS---LEVLKGVTLKVNKGEVVVIIGPSGSGKSTLLRCINLLEEPTGEVFIDGVKINNVNINKVRQKVGMVFQHFNLFHLTAIENITLAPVKVKKMNKKEAEELAV--DLLAKV--GLLDKKDQYPIKLSGGQKQRLAIARALAMQPEVMLFDEPTSALDPEMVKEVLNVMKQLANGMTMVVVTHEMGFAREGDRVIFMDDGVIVEEGTPEEIFYR................. 226
50 -40.8003fvq_A mol:protein length:359 Fe(3+) ions import ATP-binding protein fbpC  ali model follow..  22  5.................LHIGHLSKSFQNTP---VLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDGEISLSGKTIFSTNLPVRERRLGYLVQEGVLFHLTVYRNIAYGLGNGKGRTAQERQRIEAMLELT-----GISELAGRYPHELSGGQQQRAALARALAPDPELILLDEPFSALDEQLRRQIREDMIAALRGKSAVFVSHREEALQYADRIAVMKQGRILQTASPHELYRQ................. 229
51 -40.1003tui_C mol:protein length:366 Methionine import ATP-binding protein MetN  ali model follow..  22  15.................IKLSNITKVFHQGTRTQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLL-PTEGSVLVDGQELTTLSESELRRQIGMIFQHNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLV-----GLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLLCDQATSALDPATTRSILELLKDINRGLTILLITHEMDVVKRCDCVAVISNGELIEQDTVSEVFSH................. 244
52 -40.0004g1u_C mol:protein length:266 Hemin import ATP-binding protein HmuV  ali model follow..  24  12.................LEASHLHYHVQ---QQALINDVSLHIASGEMVAIIGPNGAGKSTLLRLLTGYLSPHGECHLLGQNLNSWQPKALARTRAVMRQYSELFPFSVSEVIQMGRAPYGGSQDRQALQQVMAQTDCLALAQR----------VLSGGEQQRVQLARVLAQTPRWLFLDEPTSALDLYHQQHTLRLLRQLTRPLAVCCVLHDLNAALYADRIMLLAQGKLVACGTPEEVLNAE................ 239
53 -39.9003gfo_A mol:protein length:275 Cobalt import ATP-binding protein cbiO 1  ali model follow..  23  1..........MSLEDYILKVEELNYNYSD--GTHALKGINMNIKRGEVTAILGGNGVGKSTLFQNF--LKPSSGRILFDNKPISRKGIMKLRESIGIVFQDNQLFSASVYQDVSFGPEDEIRKRVDNALKRTGIEHLKDKPTH-----------CLSFGQKKRVAIAGVLVMEPKVLILDEPTAGLDPMGVSEIMKLLVEMQKGITIIIATHDIDIVPLCDNVFVMKEGRVILQGNPKEVFAEKEVIRKV.......... 241
54 -39.8001b0u_A mol:protein length:262 HISTIDINE PERMEASE  ali model follow..  24  7.................LHVIDLHKRYG---GHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSGAIIVNGQNINKNQLRLLRTRLTMVFQHFNLWHMTVLENVMEAPIQVLGLSKHDARERALKYLAKVGIDERAQGKYPVH---LSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEGKTMVVVTHEMGFARHSSHVIFLHQGKIEEEGDPEQVFGN................. 243
55 -39.5001z47_A mol:protein length:355 putative ABC-transporter ATP-binding protein  ali model follow..  25  1..........MRGGSMTIEFVGVEKIYPG--GARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTGDVWIGGKRVTDLPPQ--KRNVGLVFQNYALFQHTVYDNVSFGLREKRVPKDEMDARVRELLRFM-----RLESYANRFPHELSGGQQQRVALARALAPRPQVLLFDEPFAAIDTQIRRELRTFVRQVHDGVTSVFVTHQEEALEVADRVLVLHEGNVEQFGTPEEVYEK................. 229
56 -39.4002onk_A mol:protein length:240 Molybdate/tungstate ABC transporter, ATP-bind  ali model follow..  27  23............................................GRDYCVLLGPTGAGKSVFLELIAGIVKPDGEVRLNGADITPLPPE--RRGIGFVPQDYALFHLSVYRNIAYGLRNVERVEVREMAEKLGIAHLLDRKPA-----------RLSGGERQRVALARALVIQPRLLLLDEPLSAVDLKTKGVLMEELRFVQRDVPILHVTHLIEAAMLADEVAVMLNGRIVEKGKLKELFSAKNGEVA........... 223
57 -39.2004hlu_A mol:protein length:268 Putative ABC transporter ATP-binding protein  ali model follow..  26  5.................IEVVNVSHIFHRGTEKKALENVSLVINEGECLLVAGNTGSGKSTLLQIV--IEPTSGDVLYDGERK---KGYEIRRNIGIAFQEDQFFAERVFDEVAFAVKNFYPDR----DPVPLVKKAMEFVGLDFDSFKDRVPFFLSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWTLGKTVILISHDIETVINVDRVVVLEKGKKVFDGTRMEFLEK................. 230
58 -39.2002pcj_A mol:protein length:224 Lipoprotein-releasing system ATP-binding prot  ali model follow..  23  5.................LRAENIKKVIRG----EILKGISLSVKKGEFVSIIGASGSGKSTLLYIL----PTEGKVFLEGKEVDYTNEKELNRKLGFVFQFHYLIPETALENVIVPMLKMGKPKKEAKERGEYLLSEL-----GLGDKLSRKPYELSGGEQQRVAIARALANEPILLFADEPTGNLDSANTKRVMDIFLKIEGGTSIVMVTHERELAELTHRTLEMKDGKVVG........................... 219
59 -38.3003tif_A mol:protein length:235 Uncharacterized ABC transporter ATP-binding p  ali model follow..  23  2.................VKLKNVTKTYKGEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNII----PTEGEVYIDNIKTNDLDDDELRDKIGFVFQQNLIPLLTALENVELPLIFKYRGAMSGEERRKRALECLKMAELE-ERFANHKPNQLSGGQQQRVAIARALANNPPIILADQPTWALDSKTGEKIMQLLKKLEDGKTVVVVTHDINVARFGERIIYLKDGEVEREEKLRGFDDR................. 235
60 -38.3001f3o_A mol:protein length:235 HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROT  ali model follow..  24  2.................IKLKNVTKTYKGEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNII----PTEGEVYIDNIKTNDLDDDELRDKIGFVFQQNLIPLLTALENVELPLIFKYRGAMSGEERRKRALECLKMAELE-ERFANHKPNQLSGGQQQRVAIARALANNPPIILADEPTGALDSKTGEKIMQLLKKLEDGKTVVVVTHDINVARFGERIIYLKDGEVEREEKLRGFDDR................. 235
61 -38.2001sgw_A mol:protein length:214 putative ABC transporter  ali model follow..  20  1.............AGSKLEIRDLSVGY----DKPVLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKLKGEIIYNGVPITKV-----KGKIFFLPEEIIVPRKSVEDYLKA-GVKVNKNEIMDALESVEVLDLKKKLGE------------LSQGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEKGIVIISREELSY--CDVNENLHKYSTKIDKKD....................... 208
62 -38.2001vpl_A mol:protein length:256 ABC transporter, ATP-binding protein  ali model follow..  22  10.................VVVKDLRKRIGK---KEILKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSGIVTVFGKNVVE-EPHEVRKLISYLPEEAGAYRNQGIEYLRF----AGFYASSSSEIEEMVERATEIA--GLGEKIKDRVSTYSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQGLTILVSSHNMLEVEFCDRIALIHNGTIVETGTVEELKERYK............... 232
63 -38.1004huq_A mol:protein length:290 Energy-coupling factor transporter ATP-bindin  ali model follow..  25  2................AIAFEHVTYTYQAGTAHTALTDVSLTVPDRGYLAIIGHTGSGKSTLIQQL--LKPTSGTIKIDEFTITNAALKPLRQHVGMVFQENQLFEETVRQDIAFGPKNFGMADADALALADEMLTTV-----GLDQSYAERSFELSGGQMRRVAIAGVLAMQPKVLVLDEPTAGLDPQGRQEMMRLFARLHQEQTIVLVTHQMEDVAQAEQVAVMHEGRLMKFGTPADVFSN................. 236
64 -37.8004mki_B mol:protein length:298 Energy-coupling factor transporter ATP-bindin  ali model follow..  29  6................PIKVENVSFIYNEGTATVALKDINFSIDDEEFVGIIGHTGSGKSTLIQQL--LKPSKGKIYINGIDIKKVSLKDIRKQVGLVFQEYQLFEETVFKDIAFGPSNLGLSEEEVKERVYEAMEIV-----GISKELADKSFELSGGQKRRVAIAGILAMRPKILILDEPTAGLDPKGKQEILNKIKEIHDKYITILVSHNMEDIARADKIIVMNRGKIELIGTPREVFREAERLEKI.......... 245
65 -37.4005d3m_B mol:protein length:287 Energy-coupling factor transporter ATP-bindin  ali model follow..  24  2................AIKFENVSYVYSPGSEAIGLDQLNFSLEEGKFIALVGHTGSGKSTLMQHF--LKPTSGKIEIAGYTIGNKGLKDLRRKVSLAFQEAQLFENTVLKDVEYGPRNFGFSEDEAREAALKWLKKV-----GLKDDLIEHSFDLSGGQMRRVALAGVLAYEPEIICLDEPAAGLDPMGRLEMMQLFKDYAAGHTVILVTHNMDDVADADDVLALEHGRLIKHASPKEVFKD................. 235
66 -36.7001oxs_C mol:protein length:353 ABC transporter, ATP binding protein  ali model follow..  25  2...............VRIIVKNVSKVFKK-GKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSGELYFDDRLVASNGKLIVDRKIGMVFQTWALYNLTAFENIAFPSKEEIRKRVEEVAKILDIHHVLNHFPR-----------ELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSGVTLLVVSHPADIFAIADRVGVLVKGKLVQVGKPEDLYDN................. 231
67 -35.6002it1_A mol:protein length:362 362aa long hypothetical maltose/maltodextrin  ali model follow..  26  2...............VEIKLENIVKKFGN----TALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTGKIYFDEKDVTELPPKD--RNVGLVFQNWALYHMTVYKNIAFPPREEIDKKVREVAKMLHIDKLLNRYPW-----------QLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKGITTVYVTHQAEALAMADRIAVIREGEILQVGTPDEVYYK................. 224
68 -35.5001q12_A mol:protein length:381 Maltose/maltodextrin transport ATP-binding pr  ali model follow..  27  2...............ASVQLQNVTKAWGE----VVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITGDLFIGEKRMNDTPPAE--RGVGMVFQSYALYHLSVAENMSFGKKEVINQRVNQVAEVLQLAHLLDRKPK-----------ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKGRTMIYVTHQVEAMTLADKIVVLDAGRVAQVGKPLEL.................... 221
69 -35.4004fwi_B mol:protein length:334 ABC-type dipeptide/oligopeptide/nickel transp  ali model follow..  25  5.................IRVEDLRAVYLVREGTKAADGISLDILENSVTAIVGESASGKSTIIEAMTKTLPLSGRVLYKGKDLLTMREEELRKEIALVPQATMKVIEHFKDTVEAHGVRWSHSELIEKAS-----EKLRMVRLNPEAVLNSYPLQLSGGMKQRVLIALALLLDPVVLILDEPTSALDVLTQAHIIQLLKELKKKITLIFVTHDIAVAAEADKVAVIYGGNLVEYNSTFQIFKN................. 245
70 -35.4002yyz_A mol:protein length:359 Sugar ABC transporter, ATP-binding protein  ali model follow..  25  2...............PSIRVVNLKKYFGK----KAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTGEIYFDDVLVNDIPPKY--REVGMVFQNYALYHMTVFENIAFPSKDEVEKRVVEIARKLLIDNLLDRKPT-----------QLSGGQQQRVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHLQQGITSVYVTHQAEAMTMASRIAVFNQGKLVQYGTPDEVYDS................. 224
71 -35.2002nq2_C mol:protein length:253 Hypothetical ABC transporter ATP-binding prot  ali model follow..  24  5.................LSVENLGFYYQAE--NFLFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPQGKI-------------EVYQSIGFVPQFSSPFAYSVLDIVLMGRSTHINTFAKPKSHDYQVAMQALDY--NLTHLAKREFTSLSGGQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDLAQSQTVVFTTHQPNVVAIANKTLLLNKQNFKF-GETRNILTSENL.............. 221
72 -35.1004hzi_A mol:protein length:294 ABC transporter ATP-binding protein  ali model follow..  24  29.................LSLEKISY---KPTGKTILDSVSFEIKTNEHCVLLGRNGAGKSTLVNLI-MIWATSGTIRLFQETYGEIAIQDLRKRIGILDENSIQRKLTVKDTILTGLFHTSPEEETKTLQILKDSDLLSKKDQLYNT--------LSSGEKKKILFLRSIVNEPDFLIMDEPCSSLDLTAREDFLGFLKEYHSKKTSLYITHRPEEIPDFSKAVLLKEGKVIHFGPIEECFTEKNL.............. 261
73 -33.9004tqu_S mol:protein length:363 AlgS  ali model follow..  26  3...............ASVSIQNVVKRYDK----TVVHGVSLDIEPGEFVVLVGPSGCGKSTTLRMVAGLEEISGTIRIDGRVINDLAPKD--RDVAMVFQNYALYHLNVRDNISFGKKSVIDAAVKTAADILGLQPLLERKPS-----------DLSGGQRQRVAMGRAIVRDPKVFLFDQPLSNLDAKLRTQMRAEIKRLHQGTTVIYVTHQVEAMTLADRIVVMRDGLIEQIGKPMDLFLH................. 225
74 -32.8002ihy_A mol:protein length:279 ABC transporter, ATP-binding protein  ali model follow..  23  16.................IQLDQIGR---MKQGKTILKKISWQIAKGDKWILYGLNGAGKTTLLNIL-YEPATSGTVNLFGKMPGKVGYSTVRQHIGFVSLEKFQEGERVIDVVISGAFKSDDEIRNEAHQLLKLVGMSAKAQQYIGY--------LSTGEKQRVMIARALMGQPQVLILDEPAAGLDFIARESLLSILDSLSDSYAMIYVTHFIEEITANSKILLLKDGQSIQQGAVEDILTSENM.............. 250
75 -32.5004rvc_A mol:protein length:245 ABC transporter ATP-binding protein  ali model follow..  22  4.................LEVKDLSGGYT---AQNVLEDVTFVVDRGEMVALIGLNGAGKSTTIKHIIGLMEPRGAISINGYRLAD-GPETYRRQFAYIPETPVLYEELTLEE--HLRLAAMAYGLSEAEYERRLPPLLREF--RLERRLSSFPAHFSKGMKQKVMIVCAFLLEPPLYIIDEPFLGLDPLAIHALLERMNEQKKGAGILLSTHILATAERCDSFVILHNGRVKAKGTLDDIRRQFGL.............. 227

FFAS is supported by the NIH grant R01-GM087218-01
8 5 6 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.