current user: public




2fbiA
Query: 2fbi_A mol:protein length:142 probable transcriptional regulator, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst GHMSTPRPSLTLTLLQAREAAMSFFRPSLNQHGLTEQQWRVIRILRQQGEMESYQLANQACILRPSMTGVLARLERDGIVRRWKAPKDQRRVYVNLTEKGQQCFVSMSGDMEKNYQRIQERFGEEKLAQLLELLNELKKIKPLast
1 -63.0002fbi_A mol:protein length:142 probable transcriptional regulator  ali model  100  1GHMSTPRPSLTLTLLQAREAAMSFFRPSLNQHGLTEQQWRVIRILRQQGEMESYQLANQACILRPSMTGVLARLERDGIVRRWKAPKDQRRVYVNLTEKGQQCFVSMSGDMEKNYQRIQERFGEEKLAQLLELLNELKKIKP 142
2 -54.2002pfb_A mol:protein length:153 Transcriptional regulator OhrR  ali model follow..  24  12DTLLQLDNQLCFALYSANLAMHKLYRGLLKALDLTYPQYLVMLVLWETDERSVSEIGERLYLDSATLTPLLKRLQAAGLVTRTRAASDERQVIIALTETGRALRSKAGAVPEQVFCAS--ASSLDELRQLKQELEKLRS... 148
3 -54.1002pex_A mol:protein length:153 Transcriptional regulator OhrR  ali model follow..  24  12DTLLQLDNQLSFALYSANLAMHKLYRGLLKALDLTYPQYLVMLVLWETDERSVSEIGERLYLDSATLTPLLKRLQAAGLVTRTRAASDERQVIIALTETGRALRSKAGAVPEQVFCAS--ACSLDELRQLKQELEKLRS... 148
4 -53.3003oop_A mol:protein length:143 Lin2960 protein  ali model follow..  15  2NAMRGYYDEISFDVNTTAKKMHLFLMRSIASYDVTPEQWSVLEGIEANEPISQKEIALWTKKDTPTVNRIVDVLLRKELIVREISTEDRRISLLSLTDKGRKETTELRDIVEASCEKMFAGVTRTDLEQFTAILKNIST... 140
5 -53.1002a61_A mol:protein length:145 transcriptional regulator Tm0710  ali model follow..  23  2....SMKQPFERILREICFMVKVEGRKVLRDFGITPAQFDILQKIYFEGPKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYFLVITRKGEEVIEKVIERRENFIEKITSDLGKEKSSKILDYLKELKG... 136
6 -52.9001z91_A mol:protein length:147 Organic hydroperoxide resistance transcriptio  ali model follow..  19  6.DHMKLENQLSFLLYASSREMTKQYKPLLDKLNITYPQYLALLLLWEHETLTVKKMGEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERSVLISLTEDGALLKEKAVDIPGTILGLS--KQSGEDLKQLKSALYTLLE... 141
7 -52.8003cdh_A mol:protein length:155 Transcriptional regulator, MarR family  ali model follow..  23  9.DDTFVSGYLLYLLAASSEEASAQFHDHIRAQGLRVPEWRVLACLVDNDAMMITRLAKLSLMEQSRMTRIVDQMDARGLVTRVADAKDKRRVRVRLTDDGRALAESLVASARAHETRLLSALADTDAARIKGVLRTLLD... 146
8 -52.7003hrm_A mol:protein length:140 HTH-type transcriptional regulator sarZ  ali model follow..  16  1GSHMYLSKQLCFLFYVSSKEIIKKYTNYLKEYDLTYTGYIVLMAIENDEKLNIKKLGERVFLDSGTLTPLLKKLEKKDYVVRTREEKDERNLQISLTEQGKAIKSPLAEISVKVFNEF--NISEREASDIINNLRNFVS... 137
9 -52.6003bja_A mol:protein length:139 Transcriptional regulator, MarR family, putat  ali model follow..  24  4......NRELYGNIRDVYHLLQKNLDKAIEQYDISYVQFGVIQVLAKSGKVSMSKLIENMGCVPSNMTTMIQRMKRDGYVMTEKNPNDQRETLVYLTKKGEETKKQVDVQYSDFLKENCGCFTKEEEGILEDLLLKWKK... 136
10 -52.5002rdp_A mol:protein length:150 putative transcriptional regulator MarR  ali model follow..  21  11....RTVAELEKLLRYIAANLKQRGREILTNYPITPPQFVALQWLLEEGDLTVGELSNKMYLACSTTTDLVDRMERNGLVARVRDEHDRRVVRIRLLEKGERIIEEVIEKRQRDLANVLESFSDEEIVVFERCLRKLHQ... 145
11 -51.6003k0l_A mol:protein length:162 Repressor protein  ali model follow..  14  11DRKREEEPRLSYMIARVDRIISKYLTEHLSALEISLPQFTALSVLAAKPNLSNAKLAERSFIKPQSANKILQDLLANGWIEKAPDPTHGRRILVTVTPSGLDKLNQCNQVVQQLEAQMLQGVDINLAFLIRNNLELMVK... 149
12 -51.6001s3j_A mol:protein length:155 YusO protein  ali model follow..  19  2KSADQLMSDIQLSLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKKHGSLKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKAIMARYLSFLTEEEMLQAAHITAKLAQ... 140
13 -51.4003e6m_A mol:protein length:161 MarR family Transcriptional regulator  ali model follow..  22  22....ELNSFLPYLLTRITHIWSSELNQALASEKLPTPKLRLLSSLSAYGELTVGQLATLGVMEQSTTSRTVDQLVDEGLAARSISDADQRKRTVVLTRKGKKKLAEISPLINDFHAELVGNVDPDKLQTCIEVLGEILK... 156
14 -51.2003cjn_A mol:protein length:162 Transcriptional regulator, MarR family  ali model follow..  20  21....GLEGYAPYLMNRIMGRYNANLRKEMTALGLSTAKMRALAILSAKDGLPIGTLGIFAVVEQSTLSRALDGLQADGLVRREVDSDDQRSSRVYLTPAGRAVYDRLWPHMRASHDRMFQGITPQERQAFLATLNKMLA... 155
15 -50.6002nnn_A mol:protein length:140 Probable transcriptional regulator  ali model follow..  22  8....RLDDQIGFILRQANQRYAALFANGIGN-GLTPTQWAALVRLGETGPCPQNQLGRLTAMDAATIKGVVERLDKRGLIQRSADPDDGRRLLVSLSPAGRAELEAGLAAAREINRQALAPLSLQEQETLRGLLARL..... 139
16 -50.2002eb7_A mol:protein length:146 146aa long hypothetical transcriptional regul  ali model follow..  20  3.ESNENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSD-GPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRKILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILK... 139
17 -50.2002bv6_A mol:protein length:142 HTH-TYPE TRANSCRIPTIONAL REGULATOR MGRA  ali model follow..  18  1GSHMNLKEQLCFSLYNAQRQVNRYYNKVFKKYNLTYPQFLVLTILWDESPVNVKKVVTELALDTGTVSPLLKRMEQVDLIKRERSEVDQREVFIHLTDKSETIRPELSNASDKVASAS--SLSQDEVKELNRLLGKVIH... 138
18 -49.9001jgs_A mol:protein length:138 MULTIPLE ANTIBIOTIC RESISTANCE PROTEIN MARR  ali model follow..  19  1..LFNEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAACITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQLTKNLTADEVATLEYLLKKV..... 136
19 -49.6003fm5_A mol:protein length:150 Transcriptional regulator  ali model follow..  17  4AESQALSDDIGFLLSRVGGMVLGAVNKALVPTGLRVRSYSVLVLACEQAEVNQRGVAATMGLDPSQIVGLVDELEERGLVVRTLDPSDRRNKLIAATEEGRRLRDDAKARVDAAHGRYFEGIPDTVVNQMRDTLQSIAF... 143
20 -49.5003u2r_A mol:protein length:168 Regulatory protein MarR  ali model follow..  21  12.RFDSLTQEAYLQLWRTYDRMKAIEEEIFSQFELSAQQYNTLRLLRSVHPMATLQIADRLISRAPDITRLIDRLDDRGLVLRTRKPENRRVVEVALTDAGLKLLKDLEEPVRQCHERQLGHLAADELHELIRLMELART... 151
21 -49.3002fa5_A mol:protein length:162 transcriptional regulator marR/emrR family  ali model follow..  21  17....NLEQFLPYRLSVLSNRISGNIKVYGDRYGMAIPEWRVITILALYPGSSASEVSDRTAMDKVAVSRAVARLLERGFIRRETHGDDRRRSMLALSPAGRQVYETVAPLVNEMEQRLMSVFSAEEQQTLERLIDRLAK... 152
22 -48.9002fxa_A mol:protein length:207 Protease production regulatory protein hpr  ali model follow..  16  13KEALVFTQKMAQLSKALWKSIEKDWQQWLKPYDLNINEHHILWIAYQLNGASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSKRLNDKRNTYVQLTEEGTEVFWSLLEEFDPTRNAVFKGS--QPLYHLFGKFPEVAEM.. 150
23 -48.8003bj6_A mol:protein length:152 Transcriptional regulator, MarR family  ali model follow..  15  5THETDQLYQAVQATRPLLRNITAAVERGTLREGVTVGQRAILEGLSLTPGATAPQLGAALQMKRQYISRILQEVQRAGLIERRTNPEHARSHRYWLTPRGEAIITAIRADEMAKLALFSEGFSSVELTAYHKVQLALTR... 143
24 -48.5003ech_A mol:protein length:142 Multidrug resistance operon repressor  ali model follow..  21  4....PVNPDLMPALMAVFQHVRTRIQSELQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHLHAELIMSRVHDELFAPLTPVEQATLVHLLDQCLAAQ. 142
25 -48.3003s2w_A mol:protein length:159 Transcriptional regulator, MarR family  ali model follow..  15  15AEGLCDKEFIGKAISYLYRYGQIYIGKKIEPYGIGSGQFPFLMRLYREDGINQESLSDYLKIDKGTTARAIQKLVDEGYVFRQRDEKDRRSYRVFLTEKGKKLEPDMKKIASEWGEILFSSFDDRQRREITNSLEIMFE... 153
26 -48.1001lnw_A mol:protein length:147 Multidrug resistance operon repressor  ali model follow..  21  4....PVNPDLMPALMAVFQHVRTRIQSELQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDELFAPLTPVEQATLVHLLDQCLA... 140
27 -48.0002eth_A mol:protein length:154 transcriptional regulator, putative, Mar fami  ali model follow..  20  3SDKIMDALEIFKTLFSLVMRFSSYLPSNEEISDMKTTELYAFLYVALFGPKKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKGKEIFGEILSNFESLLKSVLEKFSEEDFKVVSEGFNRMVE... 141
28 -47.9003bro_A mol:protein length:141 Transcriptional regulator  ali model follow..  18  3....AMSRDLGRLLKIASNQMSTRFDIFAKKYDLTGTQMTIIDYLSRNKNVLQRDLESEFSIKSSTATVLLQRMEIKKLLYRKVSGKDSRQKCLKLTKKANKLETIILSYMDSDQSQMTSGLNKEEVVFLEKILKRMIESD. 141
29 -47.7003nrv_A mol:protein length:148 Putative transcriptional regulator (MarR/EmrR  ali model follow..  19  8....NIDRHATAQINMANKLMLKSSTAYTQKFGIGMTEWRIISVLSSASDCSVQKISDILGLDKAAVSRTVKKLEEKKYIEVNGHSEDKRTYAINLTEMGQELYEVASDFAIEREKQLLEEFEEAEKDQLFILLKKLRN... 143
30 -47.6003g3z_A mol:protein length:145 Transcriptional regulator, MarR family  ali model follow..  16  4........NQLDQLGTRINLICNVFDKWIGQQDLNYNLFAVLYTLATEGSRTQKHIGEKWSLPKQTVSGVCKTLAGQGLIEWQEGEQDRRKRLLSLTETGKAYAAPLTESAQEFSDKVFATFGDKRTTRLFADLDALAE... 134
31 -47.5002qww_A mol:protein length:154 Transcriptional regulator, MarR family  ali model follow..  18  10....ENISELLKTYWSIQRISAGYADQNAASLGLTIQQLAMINVIYSTPGISVADLTKRLIITGSSAAANVDGLISLGLVVKLNIPNDSMDLTLKLSKKGEDLSKRSTANMYKAMMKVFENLTENEIEELIRLNKKVET... 148
32 -47.4001lj9_A mol:protein length:144 transcriptional regulator SlyA  ali model follow..  16  1.......TDILREIGMIARALDSISNIEFKELSLTRGQYLYLVRVCENPGIIQEKIAELIKVDRTTAARAIKRLEEQGFIYRQEDASNKKIKRIYATEKGKNVYPIIVRENQHSNQVALQGLSEVEISQLADYLVRMRK... 132
33 -46.5003bdd_A mol:protein length:142 Regulatory protein MarR  ali model follow..  21  2...MQEMEDLLYRLKVADETISNLF---EKQLGISLTRYSILQTLLKDAPLHQLALQERLQIDRAAVTRHLKLLEESGYIIRKRNPDNQREVLVWPTEQAREALITNPSAHHQAIKTMNQILTVEESEQFLATLDKLLI... 135
34 -46.0003tgn_A mol:protein length:146 Adc operon repressor AdcR  ali model follow..  16  7....DINAFLNEVILQAENQHEILIGHCTSEVALTNTQEHILMLLSE-ESLTNSELARRLNVSQAAVTKAIKSLVKEGMLETSKDSKDARVIFYQLTDLARPIAEEEHTLLTY--EQVATQFTPNEQKVIQRFLTALVG... 138
35 -45.6003kp2_A mol:protein length:151 Transcriptional regulator TcaR  ali model follow..  12  3RRIEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEA-LTVGQITEKQGVNKAAVSRRVKKLLNAELVKLEKSNTDQRLKIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDY... 142
36 -45.6003bpx_A mol:protein length:148 Transcriptional regulator  ali model follow..  17  1GSHMDRDIPLKGLLSIILRSHRVFIGRELGHLNLTDAQVACLLRIHREPGIKQDELATFFHVDKGTIARTLRRLEESGFIEREQDPENRRRYILEVTRRGEEIIPLILKVEERWEDLLFRDFTEDERKLFRKMCRRLAE... 139
37 -45.6003q5f_A mol:protein length:147 Transcriptional regulator slyA  ali model follow..  22  3....AMESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQPPDQSQIQLAKAIGIEQPSLVRTLDQLEDKGLISRQTCASDRRAKRIKLTEKAEPLIAEMEEVIHKTRGEILAGISSEEIELLIKLIAKLEH... 138
38 -45.4002fbk_A mol:protein length:181 transcriptional regulator, MarR family  ali model follow..  19  42........LTLLLLERLHAALGREIERTYAASGLNAAGWDLLLTLYRSAPLRPTELSALAAISGPSTSNRIVRLLEKGLIERREDERDRRSASIRLTPQGRALVTHLLPAHLATTQRVLAPLSAQEQRTLEELAGRMLA... 175
39 -45.1002fbh_A mol:protein length:146 transcriptional regulator PA3341  ali model follow..  20  6....TDKHYFGTLLAQTSRAWRAELDRRLSHLGLSQARWLVLLHLARHDSPTQRELAQSVGVEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLTPKADVLIADIEAIAASVRNDVLTGIDESEQALCQQVLLRILA... 141
40 -45.1003eco_A mol:protein length:139 MepR  ali model follow..  18  1.....MEFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLS... 136
41 -44.9003deu_A mol:protein length:166 Transcriptional regulator slyA  ali model follow..  22  12....MLESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQPPDQSQIQLAKAIGIEQPSLVRTLDQLEDKGLISRQTCASDRRAKRIKLTEKAEPLIAEMEEVIHKTRGEILAGISSEEIELLIKLIAKLEH... 147
42 -44.7002hr3_A mol:protein length:147 Probable transcriptional regulator  ali model follow..  20  6......DLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRMHACLDESERALLAAAGPLLTRLEP 147
43 -44.3003jw4_A mol:protein length:148 Transcriptional regulator, MarR/EmrR family  ali model follow..  17  10....LMDTPYSYLIRSIGMKLKTSADARLAELGLNSQQGRMIGYIYEESGIIQKDLAQFFGRRGASITSMLQGLEKKGYIERRIPENNARQKNIYVLPKGAALVEEFNNIFLEVEESITKGLTKDEQKQLMSILIKVNR... 146
44 -43.9002nyx_A mol:protein length:168 Probable transcriptional regulatory protein,  ali model follow..  19  12....ESVDVITDALLTASRLLVAISAHSIADENITIPQFRTLVILSNHGPINLATLATLLGVQPSATGRMVDRLVGAELIDRLPHPTSRRELLAALTKRGRDVVRQVTEHRRTEIARIVEQMAPAERHGLVRALTAFTE... 148
45 -43.5003f3x_A mol:protein length:144 Transcriptional regulator, marR family, putat  ali model follow..  18  2.QKIDEKLQLMNTIAKIYRGSIKEFNRLGKLMNLSYLDFSILKATSE-EPRSMVYLANRYFVTQSAITAAVDKLEAKGLVRRIRDSKDRRIVIVEITPKGRQVLLEANEVLRNLVNEMLSDVENVELEGLNKILSRIGS... 141
46 -42.5002frh_A mol:protein length:127 Staphylococcal accessory regulator A  ali model follow..  12  2SHMAITKINDCFELLSMVTYADKLKSLIKKEFSISFEEFAVLTYISENKEYYLKDIINHLNYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQQRKKIESLLSRVNKRITEANNEIE................... 126
47 -42.3003boq_A mol:protein length:160 Transcriptional regulator, MarR family  ali model follow..  15  12.DRQQNQTRLWLNILRLHGLVFGDLNRQLDETGLSLAKFDAMAQLARNDGLSMGKLSGALKVTNGNVSGLVNRLIKDGMVVKAMSADDRRSFSAKLTDAGLTTFKQASEAHNRILAELLRAVSDQDMVEASAALRGILE... 151
48 -40.2003nqo_A mol:protein length:189 MarR-family transcriptional regulator  ali model follow..  18  9.KELFLMNQTYATLFTLTNKIQIEGDKYFG--ILTSRQYMTILSILHEEETTLNNIARKMGTSKQNINRLVANLEKNGYVDVIPSPHDKRAINVKVTDLGKKVMVTCSRTGINFMADVFHEFTKDELETLWSLLKKMYR... 146
49 -36.6001p4x_A mol:protein length:250 staphylococcal accessory regulator A homologu  ali model follow..  10  1..MKYNNHDKIRDFIIIEAYMFRFKKKVKPEVDMTIKEFILLTYLFHQQELPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKIAERVTLFDQIIKQF........................ 118
50 -33.5001ku9_A mol:protein length:152 hypothetical protein MJ223  ali model follow..  14  3............IMEEAKKLIIELFSELAKIHGLNKSVGAVYAILYSDKPLTISDIMEELKISKGNVSMSLKKLEELGFVRKVWIKGERKNYYEAVDGDIAKRKHDLIAKTYEDLKKLEEKCNEEEKEFIKQKIKGIERM.. 136
51 -31.1001tbx_A mol:protein length:99 Hypothetical 11.0 kDa protein  ali model follow..  16  1............................MKSTPFFYPEAIVLAYLYDNEGIATYDLYKKVNMSTATFYDAKKFLIQEGFVKERQ---ERGEKRLYLTEKGKLFAISLKTAIETYKQIKKR...................... 93
52 -30.8002d1h_A mol:protein length:109 109aa long hypothetical transcriptional regul  ali model follow..  14  2................MKEKLESKKDEIRCCYKITDTDVAVLLKMVEIEKITSEELADIFKLSKTTVENSLKKLIELGLVVRTKTEGKKIGRPKYYYSISSNILEKIRNDLLNCAKRMELAAT................... 109
53 -29.6003cta_A mol:protein length:230 Riboflavin kinase  ali model follow..  15  3.........................LETDDQYYRAIKKIKEAAEASNRAYLTSSKLADMLGISQQSASRIIIDLEKNGYITRTV---TKRGQILNITEKGLDVLYTEFADLSRILAIKNNVVITGTVTSGMGEGRYYVARK. 115
54 -28.0002qvo_A mol:protein length:95 Uncharacterized protein AF_1382  ali model follow..  10  1........................MEDERIKLLFKEKALEILMTIYGGNDVYIQYIASKVNSPHSYVWLIIKKFEEAKMVECEL---EGRTKIIRLTDKGQKIAQQIKSIIDIMENDT........................ 95
55 -27.0002wte_A mol:protein length:244 CSA3  ali model follow..  13  139............................ALMRDYSREEMKLLNVLYETKGTGITELAKMLDKSEKTLINKIAELKKFGILTQ-----KGKDRKVELNELGLNVIKLNKSVIEKSSEELVKENKGKEVNIP............ 237
56 -25.2003r0a_A mol:protein length:123 Putative transcriptional regulator  ali model follow..  3............AMIDFACKEFKVEDVIKCALNLTKADLNVMKSFLNEPDIDTDALSKSLKLDVSTVQRSVKKLHEKEILQRSQQNLDGGGYVYIYKIYSNQIRNIIQKIVQSWADRLGQELKEWENG.............. 121
57 -23.0002dk5_A mol:protein length:91 DNA-directed RNA polymerase III 39 kDa polype  ali model follow..  15  10.........................QNAGKMKGSDNQEKLVYQIIEDAGGIWSRDVRYKSNLPLTEINKILKNLESKKLIKAVKSVAASKKKVYMLYN............................................ 84
58 -22.7001ub9_A mol:protein length:100 Hypothetical protein PH1061  ali model follow..  15  15..................................NPVRLGIMIFLLPRRKAPFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYKVIADRPRTVVEITDFGMEEAKRFLSSLKAVIDGL........................ 98
59 -19.8001sfx_A mol:protein length:109 Conserved hypothetical protein AF2008  ali model follow..  14  3..................SNPLGELVKALEKLSFKPSDVRIYSLLLERGGMRVSEIARELDLSARFVRDRLKVLLKRGFVRREIVEKGWVGYIYSAEK--EKVLKEFKSSILGEIERIEKMFTDGS................ 109
60 -16.9002obp_A mol:protein length:96 Putative DNA-binding protein  ali model follow..  18  24.....................................VLREAGIENGATPWSLPKIAKRAQLPMSVLRRVLTQLQAAGLADVS--VEADGRGHASLTQEGAALAAQLFPDP............................... 95
61 -16.2003b73_A mol:protein length:111 PhiH1 repressor-like protein  ali model follow..  17  11.................................MTIWDDRILEIIHEEGNGSPKELEDRDEISKSSVSRRLKKLADHDLLQPLANG------VYVITEEGEAYLNG.................................... 79
62 -16.1001on1_A mol:protein length:142 Transcriptional regulator mntR  ali model follow..  13  13........................................IYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRG------LVLTSKGKKIGKRLVEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEE... 122
63 -16.1003R60 Entity 1(prereleased)  ali follow..  13  12........................................IYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRG------LVLTSKGKKIGKRLVEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEE... 121
64 -15.5002h09_A mol:protein length:155 Transcriptional regulator mntR  ali model follow..  16  45........................................ISDLIREVGEARQVDMAARLGVSQPTVAKMLKRLATMGLIEMIPWRG------VFLTAEGEKLAQESREIARRDAEGMEHHVSEETLDAFRLFTQK...... 151
65 -15.3001xn7_A mol:protein length:78 Hypothetical protein yhgG  ali model follow..  27  7........................................VRDLLALRGRMEAAQISQTLNTPQPMINAMLQQLESMGKAVRIQEEPD...................................................... 54
66 -15.3002g9w_A mol:protein length:138 conserved hypothetical protein  ali model follow..  18  7.................................LGDLERAVMDHLWSRTE--HEALSARRDLAYTTVMAVLQRLAKKNLVLQIR--DDRAHRYAPVHGRDELVAGLMVDALAQALVHFVERVGADEADALRRALAELEAGHG 127
67 -15.1001sd4_A mol:protein length:126 PENICILLINASE REPRESSOR  ali model follow..  15  4.............................KQVEISMAEWDVMNIIWDKKSVSANEIVVEIQ-SDKTIRTLITRLYKKEIIKRYK--SENIYFYSSNIKEDDIKMKTAKTFLNKLYGGDMEELNNKEIEELRDILNDISK... 125
68 -15.1002isy_A mol:protein length:157 Iron-dependent repressor ideR  ali model follow..  15  1............................MNELVDTTEMYLIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRH------LELTEKGRALAIAVMRKHRLAERLLVDVIGHAEACRWEHVMSE...... 110
69 -14.9001bi0_A mol:protein length:226 DIPHTHERIA TOXIN REPRESSOR  ali model follow..  12  1............................MKDLVDTTEMYLIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRS------LQMTPTGRTLATAVMRKHRLAERLLTDIIGHDEACRWEHVMSD...... 110
70 -14.8003hrs_A mol:protein length:214 Metalloregulator ScaR  ali model follow..  11  11........................................LYELGTRHNKITNKEIAQLMQVSPPAVTEMMKKLLAEELLIKDKKAG------YLLTDLGLKLVSDLYRKHRLIEVFLVHHLGHEEAEVLEHTVSD...... 106
71 -14.7001sfu_A mol:protein length:75 34L protein  ali model follow..  14  1.....................MDLLSCTVNDAEIFSLVKKEVLSLNTNDYTTAISLSNRLKINKKKINQQLYKLQKEDTVKMVPS......................................................... 64
72 -14.5001ri7_A mol:protein length:171 Putative transcriptional regulator  ali model follow..  14  11.........................RGSHMRVPLDEIDKKIIKILQNDGKAPLREISKITGLAESTIHERIRKLRESGVIKKFTAIIDPEAILVKVKAGKYSEVASNLAKYPEIVEDMVVKIRTKNSEELNNFLDLIGSIP. 142
73 -14.5001fx7_A mol:protein length:230 IRON-DEPENDENT REPRESSOR IDER  ali model follow..  15  1............................MNELVDTTEMYLIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRH------LELTEKGRALAIAVMRKHRLAERLLVDVIGHAEACRWEHVMSE...... 110
74 -14.4001xcv_A mol:protein length:139 Diphtheria toxin repressor mutant  ali model follow..  12  1............................MKDLVDTTEMYLIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRS------LQMTPTGRTLATAVMRKARLAERLLTDIIGHDEADRWEHVMSD...... 110
75 -14.3001okr_A mol:protein length:123 METHICILLIN RESISTANCE REGULATORY PROTEIN MEC  ali model follow..  16  8.................................ISSAEWEVMNIIWMKKYASANNIIEEIQMQKDTIRTLITRLYKKGFIDRKK--DNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFEDLSQDEIEELRNILNK...... 122

FFAS is supported by the NIH grant R01-GM087218-01
6 1 1 8 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Schwarzenbacher R, Godzik A, Jaroszewski L. The JCSG MR pipeline: optimized alignments, multiple models and parallel searches. Acta Crystallogr D Biol Crystallogr. 2008 Jan;64(Pt 1):133-40. Epub 2007 Dec 5.