current user: public




Query: 2fbi_A mol:protein length:142 probable transcriptional regulator, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst GHMSTPRPSLTLTLLQAREAAMSFFRPSLNQHGLTEQQWRVIRILRQQGEMESYQLANQACILRPSMTGVLARLERDGIVRRWKAPKDQRRVYVNLTEKGQQCFVSMSGDMEKNYQRIQERFGEEKLAQLLELLNELKKIKPLast
1 -67.8002fbi_A mol:protein length:142 probable transcriptional regulator  ali model  100  1GHMSTPRPSLTLTLLQAREAAMSFFRPSLNQHGLTEQQWRVIRILRQQGEMESYQLANQACILRPSMTGVLARLERDGIVRRWKAPKDQRRVYVNLTEKGQQCFVSMSGDMEKNYQRIQERFGEEKLAQLLELLNELKKIKP 142
2 -61.7005aip_A mol:protein length:146 TRANSCRIPTIONAL REGULATOR, MARR FAMILY  ali model follow..  47  3..TQSKHASINIGLIQAREALMTQFRPILNQANITDQQWRIIRLLAENGTLDFQDLANQACILRPSLTGILTRLEKAGLVVRLKPSNDQRRVFLKLTAEGEKLYEEIGEEVDERYDAIEEVLGREKMLLLKDLLAELAKI.. 140
3 -56.3002rdp_A mol:protein length:150 putative transcriptional regulator MarR  ali model follow..  21  11....RTVAELEKLLRYIAANLKQRGREILTNYPITPPQFVALQWLLEEGDLTVGELSNKMYLACSTTTDLVDRMERNGLVARVRDEHDRRVVRIRLLEKGERIIEEVIEKRQRDLANVLESFSDEEIVVFERCLRKLHQ... 145
4 -52.9003cdh_A mol:protein length:155 Transcriptional regulator, MarR family  ali model follow..  23  9.DDTFVSGYLLYLLAASSEEASAQFHDHIRAQGLRVPEWRVLACLVDNDAMMITRLAKLSLMEQSRMTRIVDQMDARGLVTRVADAKDKRRVRVRLTDDGRALAESLVASARAHETRLLSALADTDAARIKGVLRTLLD... 146
5 -51.3003hrm_A mol:protein length:140 HTH-type transcriptional regulator sarZ  ali model follow..  16  1GSHMYLSKQLCFLFYVSSKEIIKKYTNYLKEYDLTYTGYIVLMAIENDEKLNIKKLGERVFLDSGTLTPLLKKLEKKDYVVRTREEKDERNLQISLTEQGKAIKSPLAEISVKVFNEF--NISEREASDIINNLRNFVS... 137
6 -51.0002eb7_A mol:protein length:146 146aa long hypothetical transcriptional regul  ali model follow..  20  3.ESNENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSD-GPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRKILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILK... 139
7 -51.0003bja_A mol:protein length:139 Transcriptional regulator, MarR family, putat  ali model follow..  24  4......NRELYGNIRDVYHLLQKNLDKAIEQYDISYVQFGVIQVLAKSGKVSMSKLIENMGCVPSNMTTMIQRMKRDGYVMTEKNPNDQRETLVYLTKKGEETKKQVDVQYSDFLKENCGCFTKEEEGILEDLLLKWKK... 136
8 -50.6004hbl_A mol:protein length:149 Transcriptional regulator, MarR family  ali model follow..  20  7.EQMRLANQLCFSAYNVSRLFAQFYEKKLKQFGITYSQYLVMLTLWEENPQTLNSIGRHLDLSSNTLTPMLKRLEQSGWVKRERQQSDKRQLIITLTDNGQQQQEAVFEAISSC---LPQEFDTTEYDETKYVFEELEQ... 141
9 -50.3004xrf_A mol:protein length:142 Transcriptional regulator, MarR family  ali model follow..  19  6........KIQALAFSIGKKMQTELLEQMQATGLTPPQFYILKILDHYGASRATTLAKKMYVKPSAITVMIDRLIDQELVERYHDKDDRRVVIIELTKKGKARVEEAMTARNEHIAKYFSHLELQEREDLLRLFEKLETI.. 137
10 -50.1002a61_A mol:protein length:145 transcriptional regulator Tm0710  ali model follow..  23  2....SMKQPFERILREICFMVKVEGRKVLRDFGITPAQFDILQKIYFEGPKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYFLVITRKGEEVIEKVIERRENFIEKITSDLGKEKSSKILDYLKELKG... 136
11 -49.9001z91_A mol:protein length:147 Organic hydroperoxide resistance transcriptio  ali model follow..  19  6.DHMKLENQLSFLLYASSREMTKQYKPLLDKLNITYPQYLALLLLWEHETLTVKKMGEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERSVLISLTEDGALLKEKAVDIPGTILGLS--KQSGEDLKQLKSALYTLLE... 141
12 -49.8002pfb_A mol:protein length:153 Transcriptional regulator OhrR  ali model follow..  24  12DTLLQLDNQLCFALYSANLAMHKLYRGLLKALDLTYPQYLVMLVLWETDERSVSEIGERLYLDSATLTPLLKRLQAAGLVTRTRAASDERQVIIALTETGRALRSKAGAVPEQVFCAS--ASSLDELRQLKQELEKLRS... 148
13 -49.8002pex_A mol:protein length:153 Transcriptional regulator OhrR  ali model follow..  24  12DTLLQLDNQLSFALYSANLAMHKLYRGLLKALDLTYPQYLVMLVLWETDERSVSEIGERLYLDSATLTPLLKRLQAAGLVTRTRAASDERQVIIALTETGRALRSKAGAVPEQVFCAS--ACSLDELRQLKQELEKLRS... 148
14 -48.9001s3j_A mol:protein length:155 YusO protein  ali model follow..  19  2KSADQLMSDIQLSLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKKHGSLKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKAIMARYLSFLTEEEMLQAAHITAKLAQ... 140
15 -48.8002bv6_A mol:protein length:142 HTH-TYPE TRANSCRIPTIONAL REGULATOR MGRA  ali model follow..  18  1GSHMNLKEQLCFSLYNAQRQVNRYYNKVFKKYNLTYPQFLVLTILWDESPVNVKKVVTELALDTGTVSPLLKRMEQVDLIKRERSEVDQREVFIHLTDKSETIRPELSNASDKVASAS--SLSQDEVKELNRLLGKVIH... 138
16 -48.6002fxa_A mol:protein length:207 Protease production regulatory protein hpr  ali model follow..  16  14.EALVFTQKMAQLSKALWKSIEKDWQQWLKPYDLNINEHHILWIAYQLNGASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSKRLNDKRNTYVQLTEEGTEVFWSLLEEFDPTRNAVFKGSQPGKFPEVAEMMCMIRHI.. 157
17 -46.6003e6m_A mol:protein length:161 MarR family Transcriptional regulator  ali model follow..  22  22....ELNSFLPYLLTRITHIWSSELNQALASEKLPTPKLRLLSSLSAYGELTVGQLATLGVMEQSTTSRTVDQLVDEGLAARSISDADQRKRTVVLTRKGKKKLAEISPLINDFHAELVGNVDPDKLQTCIEVLGEILK... 156
18 -46.4003cjn_A mol:protein length:162 Transcriptional regulator, MarR family  ali model follow..  20  21....GLEGYAPYLMNRIMGRYNANLRKEMTALGLSTAKMRALAILSAKDGLPIGTLGIFAVVEQSTLSRALDGLQADGLVRREVDSDDQRSSRVYLTPAGRAVYDRLWPHMRASHDRMFQGITPQERQAFLATLNKMLA... 155
19 -46.4003oop_A mol:protein length:143 Lin2960 protein  ali model follow..  15  2NAMRGYYDEISFDVNTTAKKMHLFLMRSIASYDVTPEQWSVLEGIEANEPISQKEIALWTKKDTPTVNRIVDVLLRKELIVREISTEDRRISLLSLTDKGRKETTELRDIVEASCEKMFAGVTRTDLEQFTAILKNIST... 140
20 -45.6002eth_A mol:protein length:154 transcriptional regulator, putative, Mar fami  ali model follow..  20  3SDKIMDALEIFKTLFSLVMRFSSYLPSNEEISDMKTTELYAFLYVALFGPKKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKGKEIFGEILSNFESLLKSVLEKFSEEDFKVVSEGFNRMVE... 141
21 -45.2003g3z_A mol:protein length:145 Transcriptional regulator, MarR family  ali model follow..  17  9.............LGTRINLICNVFDKWIGQQDLNYNLFAVLYTLATEGSRTQKHIGEKWSLPKQTVSGVCKTLAGQGLIEWQEGEQDRRKRLLSLTETGKAYAAPLTESAQEFSDKVFATFGDKRTTRLFADLDALAEV.. 135
22 -45.1003vb2_A mol:protein length:144 Multiple antibiotic resistance protein marR  ali model follow..  19  6.DLFNEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLSSIRSAASITPVELKKVLSVDLGALTRMLDRLVSKGWVERLPNPNDKRGVLVKLTTGGAAISEQSHQLVGQDLQELTKNLTADEVATLEYLLKKV..... 142
23 -45.0003vod_A mol:protein length:144 Multiple antibiotic resistance protein marR  ali model follow..  19  6.DLFNEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAACITPVELKKVLSVDLGALTRMLDRLVSKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLQELTKNLTADEVATLEYLLKKV..... 142
24 -44.8004rbr_A mol:protein length:139 HTH-type transcriptional regulator rot  ali model follow..  15  1..MKKVNNDTVFGILQLETDINSIFSEIESEYKMSREEILILLTLWQKGSMTLKEMDRFVEVKPYKRTRTYNNLVELEWIYKERPVDDERTVIIHFNEKLQQEKVELLNFISDAIAS-----RATAMQNSLNAIIAV..... 133
25 -44.8004q77_A mol:protein length:139 HTH-type transcriptional regulator rot  ali model follow..  15  1..MKKVNNDTVFGILQLETDINSIFSEIESEYKMSREEILILLTLWQKGSMTLKEMDRFVEVKPYKRTRTYNNLVELEWIYKERPVDDERTVIIHFNEKLQQEKVELLNFISDAIAS-----RATAMQNSLNAIIAV..... 133
26 -44.6004em0_B mol:protein length:178 Uncharacterized HTH-type transcriptional regu  ali model follow..  15  29GSDFMLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVANISQDQMQETINVMNQIHE... 169
27 -44.6003bdd_A mol:protein length:142 Regulatory protein MarR  ali model follow..  22  2...MQEMEDLLYRLKVADETISNLFE---KQLGISLTRYSILQTLLKDAPLHQLALQERLQIDRAAVTRHLKLLEESGYIIRKRNPDNQREVLVWPTEQARELITNPSAHHQAIKTSMNQILTVEESEQFLATLDKL..... 133
28 -44.5003u2r_A mol:protein length:168 Regulatory protein MarR  ali model follow..  21  11LRFDSLTQEAYLQLWRTYDRMKAIEEEIFSQFELSAQQYNTLRLLRSVHPMATLQIADRLISRAPDITRLIDRLDDRGLVLRTRKPENRRVVEVALTDAGLKLLKDLEEPVRQCHERQLGHLAADELHELIRLMELART... 151
29 -44.4003bj6_A mol:protein length:152 Transcriptional regulator, MarR family  ali model follow..  16  13........QAVQATRPLLRNITAAVERGTLREGVTVGQRAILEGLSLTPGATAPQLGAALQMKRQYISRILQEVQRAGLIERRTNPEHARSHRYWLTPRGEAIITAIRADEMAKLALFSEGFSSVELTAYHKVQLALTR... 143
30 -44.2003ech_A mol:protein length:142 Multidrug resistance operon repressor  ali model follow..  21  5.....VNPDLMPALMAVFQHVRTRIQSELQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHLHAELIMSRVHDELFAPLTPVEQATLVHLLDQCLAAQ. 142
31 -44.1001lnw_A mol:protein length:147 Multidrug resistance operon repressor  ali model follow..  21  5.....VNPDLMPALMAVFQHVRTRIQSELQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDELFAPLTPVEQATLVHLLDQCLA... 140
32 -44.0002qww_A mol:protein length:154 Transcriptional regulator, MarR family  ali model follow..  18  14........ELLKTYWSIQRISAGYADQNAASLGLTIQQLAMINVIYSTPGISVADLTKRLIITGSSAAANVDGLISLGLVVKLNIPNDSMDLTLKLSKKGEDLSKRSTANAYKAMMKVFENLTENEIEELIRLNKKVETL.. 149
33 -43.3003tgn_A mol:protein length:146 Adc operon repressor AdcR  ali model follow..  16  7....DINAFLNEVILQAENQHEILIGHCTSEVALTNTQEHILMLLSEES-LTNSELARRLNVSQAAVTKAIKSLVKEGMLETSKDSKDARVIFYQLTDLARPIAEEEHTLLTY--EQVATQFTPNEQKVIQRFLTALVG... 138
34 -43.2002nnn_A mol:protein length:140 Probable transcriptional regulator  ali model follow..  22  8....RLDDQIGFILRQANQRYAALFANGIGN-GLTPTQWAALVRLGETGPCPQNQLGRLTAMDAATIKGVVERLDKRGLIQRSADPDDGRRLLVSLSPAGRAELEAGLAAAREINRQALAPLSLQEQETLRGLLARL..... 139
35 -43.0003f3x_A mol:protein length:144 Transcriptional regulator, marR family, putat  ali model follow..  19  9........QLMNTIAKIYRGSIKEFNRLGKLMNLSYLDFSILKATSE-EPRSMVYLANRYFVTQSAITAAVDKLEAKGLVRRIRDSKDRRIVIVEITPKGRQVLLEANEVLRNLVNEMLSDVENVELEGLNKILSRIGS... 141
36 -42.9002fa5_A mol:protein length:162 transcriptional regulator marR/emrR family  ali model follow..  20  13PVLLNLEQFLPYRLSVLSNRISGNIAKVYGRYGMAIPEWRVITILALYPGSSASEVSDRTAMDKVAVSRAVARLLERGFIRRETHGDDRRRSMLALSPAGRQVYETVAPLVNEMEQRLMSVFSAEEQQTLERLIDRLAK... 152
37 -42.7003nrv_A mol:protein length:148 Putative transcriptional regulator (MarR/EmrR  ali model follow..  19  8....NIDRHATAQINMLANKLMLKSSTAYQKFGIGMTEWRIISVLSSASDCSVQKISDILGLDKAAVSRTVKKLEEKKYIEVNGHSEDKRTYAINLTEMGQELYEVASDFAIEREKQLLEEFEEAEKDQLFILLKKLRN... 143
38 -42.7003k0l_A mol:protein length:162 Repressor protein  ali model follow..  14  15....EEEPRLSYMIARVDRIISKYLTEHLSALEISLPQFTALSVLAAKPNLSNAKLAERSFIKPQSANKILQDLLANGWIEKAPDPTHGRRILVTVTPSGLDKLNQCNQVVQQLEAQMLQGVDINLAFLIRNNLELMVK... 149
39 -42.1004b8x_A mol:protein length:147 POSSIBLE MARR-TRANSCRIPTIONAL REGULATOR  ali model follow..  18  12............SIMRAQQILLGEVDAVVKPYGLTFARYEALVLLTKSGELPMSKIGERLMVHPTSVTNTVDRLVRSGLVAKRPNPNDGRGTLATITDKGREVVEAATRDLMAM-DFGLGAYDAEECGEIFAMLRPLRV... 139
40 -41.8004l9t_A mol:protein length:145 MepR  ali model follow..  18  1.....MEFTYSYLFRMISHEMKQKADQKLEQLDITNEQGHTLGYLYQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLS... 136
41 -41.6004l9n_A mol:protein length:145 MepR  ali model follow..  18  1.....MEFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEVFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLS... 136
42 -41.6004fx0_A mol:protein length:148 PROBABLE TRANSCRIPTIONAL REPRESSOR PROTEIN  ali model follow..  18  1...MAFDECACYTTRRAARQLGQAYDRALRPSGLTNTQFSTLAVISLSIDLTMSELAARIGVERTTLTRNLEVMRRDGLV-RVMAGADARCKRIELTAKGRAALQKAVPLWRGVQAEVTASVG--DWPRVRRDIANLGQA.. 139
43 -41.5003fm5_A mol:protein length:150 Transcriptional regulator  ali model follow..  17  4AESQALSDDIGFLLSRVGGMVLGAVNKALVPTGLRVRSYSVLVLACEQAEVNQRGVAATMGLDPSQIVGLVDELEERGLVVRTLDPSDRRNKLIAATEEGRRLRDDAKARVDAAHGRYFEGIPDTVVNQMRDTLQSIAF... 143
44 -41.5004ld5_A mol:protein length:145 MepR  ali model follow..  18  1.....MEFTYSYLFRMISHEMKPKADQKLEQFDITNEQGHTLGYLYQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLS... 136
45 -41.1003kp2_A mol:protein length:151 Transcriptional regulator TcaR  ali model follow..  13  4.RIEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEA-LTVGQITEKQGVNKAAVSRRVKKLLNAELVKLEKSNTDQRLKIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDY... 142
46 -41.1004l9j_A mol:protein length:140 MepR  ali model follow..  18  3......EFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLS... 137
47 -41.1005FB2 Entity 1(prereleased)  ali follow..  18  3......EFTYSYLFRMISHEMKQKADQKLEQLDITNEQGHTLGYLYQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLS... 137
48 -40.9002frh_A mol:protein length:127 Staphylococcal accessory regulator A  ali model follow..  12  2SHMAITKINDCFELLSMVTYADKLKSLIKKEFSISFEEFAVLTYISENKEYYLKDIINHLNYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQQRKKIESLLSRVNKRITEA........................ 121
49 -40.8004aih_A mol:protein length:151 TRANSCRIPTIONAL REGULATOR SLYA  ali model follow..  21  1.....MESTLGSDLARLVRVWRALIDHRLKPLELTQTHWVTLYNINRLPPQSQIQLAKAIGIEQPSLVRTLDQLEEKGLITRHTSANDRRAKRIKLTEQSSPIIEQVDGVISSTRKEILGGISSDEIAVLSGLIDKLEK... 135
50 -40.8003bpx_A mol:protein length:148 Transcriptional regulator  ali model follow..  17  1GSHMDRDIPLKGLLSIILRSHRVFIGRELGHLNLTDAQVACLLRIHREPGIKQDELATFFHVDKGTIARTLRRLEESGFIEREQDPENRRRYILEVTRRGEEIIPLILKVEERWEDLLFRDFTEDERKLFRKMCRRLAE... 139
51 -40.2005F6F Entity 1(prereleased)  ali follow..  18  16....SNEFTYSYLFRMISHEMKQKADQKLEQFDITNEQRHTLGYLYQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLS... 152
52 -40.1004mnu_A mol:protein length:153 SlyA-like transcription regulator  ali model follow..  16  1...SNAMKDILRDIGVIARALDSISNIEFKELNLAKGQFIYLVRICENQGIIQEKLVDILKIDRTTASRAIKNLEKNGLIIKKQNKNNKKNKLLFPTEKGQQLYPLIIRENEYSNAVALKGFTEAEINMLTDALKKVKE... 136
53 -40.1003q5f_A mol:protein length:147 Transcriptional regulator slyA  ali model follow..  22  3....AMESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPQSQIQLAKAIGIEQPSLVRTLDQLEDKGLISRQTCASDRRAKRIKLTEKAEPLIAEMEEVIHKTRGEILAGISSEEIELLIKLIAKLEH... 138
54 -39.8003jw4_A mol:protein length:148 Transcriptional regulator, MarR/EmrR family  ali model follow..  17  10....LMDTPYSYLIRSIGMKLKTSADARLAELGLNSQQGRMIGYIYENSGIIQKDLAQFFGRRGASITSMLQGLEKKGYIERRIPENNARQKNIYVLPKGAALVEEFNNIFLEVEESITKGLTKDEQKQLMSILIKVNR... 146
55 -39.8003bro_A mol:protein length:141 Transcriptional regulator  ali model follow..  20  3....AMSRDLGRLLKIASNQMSTRFDIFAKKYDLTGTQMTIIDYLSRNKNKEVRDLESEFSIKSSTATVLLQRMEIKKLLYRKVSGKDSRQKCLKLTKKANKLETIILSYMDSDQSQMTSGLNKEEVVFLEKILKRMIE... 139
56 -39.6003s2w_A mol:protein length:159 Transcriptional regulator, MarR family  ali model follow..  15  21......KEFIGKAISYLYRYGQIYIGKKIEPYGIGSGQFPFLMRLYREDGINQESLSDYLKIDKGTTARAIQKLVDEGYVFRQRDEKDRRSYRVFLTEKGKKLEPDMKKIASEWGEILFSSFDDRQRREITNSLEIMFE... 153
57 -39.0003nqo_A mol:protein length:189 MarR-family transcriptional regulator  ali model follow..  19  16........QTYATLFTLTNKIQIEGDKYFG--ILTSRQYMTILSILHEEETTLNNIARKMGTSKQNINRLVANLEKNGYVDVIPSPHDKRAINVKVTDLGKKVMVTCSRTGINFMADVFHEFTKDELETLWSLLKKMYR... 146
58 -39.0002fbh_A mol:protein length:146 transcriptional regulator PA3341  ali model follow..  20  6....TDKHYFGTLLAQTSRAWRAELDRRLSHLGLSQARWLVLLHLARHRDPTQRELAQSVGVEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLTPKADVLIADIEAIAASVRNDVLTGIDESEQALCQQVLLRILA... 141
59 -39.0003deu_A mol:protein length:166 Transcriptional regulator slyA  ali model follow..  22  12....MLESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPQSQIQLAKAIGIEQPSLVRTLDQLEDKGLISRQTCASDRRAKRIKLTEKAEPLIAEMEEVIHKTRGEILAGISSEEIELLIKLIAKLEH... 147
60 -38.9003boq_A mol:protein length:160 Transcriptional regulator, MarR family  ali model follow..  16  13..RQQNQTRLWLNILRLHGLVFGDLNRQLDETGLSLAKFDAMAQLARNDGLSMGKLSGALKVTNGNVSGLVNRLIKDGMVVKAMSADDRRSFSAKLTDAGLTTFKQASEAHNRILAELLRAVSDQDMVEASAALRGILE... 151
61 -38.8001lj9_A mol:protein length:144 transcriptional regulator SlyA  ali model follow..  16  2........DILREIGMIARALDSISNIEFKELSLTRGQYLYLVRVCENPGIIQEKIAELIKVDRTTAARAIKRLEEQGFIYRQEDASNKKIKRIYATEKGKNVYPIIVRENQHSNQVALQGLSEVEISQLADYLVRMRK... 132
62 -38.3002nyx_A mol:protein length:168 Probable transcriptional regulatory protein,  ali model follow..  20  16........VITDALLTASRLLVAISAHSIAQVNITIPQFRTLVILSNHGPINLATLATLLGVQPSATGRMVDRLVGAELIDRLPHPTSRRELLAALTKRGRDVVRQVTEHRRTEIARIVEQMAPAERHGLVRALTAFTEA.. 149
63 -38.0004fht_A mol:protein length:157 PcaV transcriptional regulator  ali model follow..  15  8....DLATHPGHLARRLQQAHYLLWNTMVSE-ETTSPQYAVLNALVAEPGLDQRTVGERVGLDRSTIAEVVSRLGRRGLLDKVRDPQDGRRSLLRLTDEGLRVHRRLGVRIARMNQVFLAPLAADEQAVFFDLIRRVAD... 141
64 -36.5002fbk_A mol:protein length:181 transcriptional regulator, MarR family  ali model follow..  20  47.............LERLHAALGREIERTYAASGLNAAGWDLLLTLYRSAPLRPTELSALAAISGPSTSNRIVRLLEKGLIERREDERDRRSASIRLTPQGRALVTHLLPAHLATTQRVLAPLSAQEQRTLEELAGRM..... 173
65 -33.2004yif_A mol:protein length:164 Uncharacterized HTH-type transcriptional regu  ali model follow..  23  22........RLASDLSLAVMRLSRQLRFRNPSSPVSLSQLSALTTLANEGAMTPGALAIRERVRPPSMTRVIASLADMGFVDRAPHPIDGRQVLVSVSESGAELVKAARRARQEWLAERLATLNRSERDILRSLMLALVDESP 158
66 -33.2001p4x_A mol:protein length:250 staphylococcal accessory regulator A homologu  ali model follow..  10  1..MKYNNHDKIRDFIIIEAYMFRFKKKVKPEVDMTIKEFILLTYLFHQNTLPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKIAERVTLFDQIIKQFESQMIPKDSKEFLNLMMYTMYFK. 147
67 -32.4003zmd_A mol:protein length:178 PUTATIVE TRANSCRIPTIONAL REGULATOR  ali model follow..  18  24..LTDTEQCAWRTHLEVNRLLTHQLEKDLQPFGLTMNDYEILVNLSESEGMRMSDLATATMQSKSRLSHQITRMENANLVRRENCESDRRGLFAVLTEHGLETMRKVAPHHVASVRRFIDLLAPEDLTELDKALKPIAE... 163
68 -30.3002hr3_A mol:protein length:147 Probable transcriptional regulator  ali model follow..  19  8........QLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREELVRAMHACLDESERALLAAAGPLLTRL.. 141
69 -30.3001tbx_A mol:protein length:99 Hypothetical 11.0 kDa protein  ali model follow..  16  1............................MKSTPFFYPEAIVLAYLYDNEGIATYDLYKKVNMSTATFYDAKKFLIQEGFVKERQ---ERGEKRLYLTEKGKLFAISLKTAIETY............................ 87
70 -29.6003zpl_A mol:protein length:177 PUTATIVE MARR-FAMILY TRANSCRIPTIONAL REPRESSO  ali model follow..  19  16..LTAEEQLVWRSYIEAATLLEDHLDRQLQDAGMPHVYYGLLVKLAESPRLRMTELAKYAKITRSRLSHAVARLEKNGWVRREDCPSDKRGQFAILTDEGYEVLRRTAPGHVDAVRQVFDRLTPEQQKSLGEIMRIVAE... 156
71 -26.3002obp_A mol:protein length:96 Putative DNA-binding protein  ali model follow..  17  6.........................GNEQNGDGIDPAIVEVLLVLREATPWSLPKIAKRAQLPMSVLRRVLTQLQAAGLADVSVEADGRGH--ASLTQEGAALAAQLFPDP............................... 95
72 -25.9003cta_A mol:protein length:230 Riboflavin kinase  ali model follow..  16  7.............................DQYYRAIKKIKEAAEASNRAYLTSSKLADMLGISQQSASRIIIDLEKNGYITRTV---TKRGQILNITEKGLDVLYTEFADLSRILAIKNNVVITGTVTSGMGEGRYYVARK. 115
73 -23.5004asn_A mol:protein length:101 TUBR  ali model follow..  19  7............................EVMRKLTIEDVSILGWLFQNEAIKKSSIADELEYSTANFRKTLNKLEAIHFIGTVTGGKEHK---LYLTEYGQQAVQQAIHHGEENEE.......................... 97
74 -22.0002wte_A mol:protein length:244 CSA3  ali model follow..  14  143................................DYSREEMKLLNVLYETKGTGITELAKMLDKSEKTLINKIAELKKFGILTQ-----KGKDRKVELNELGLNVI-KLNKSVIESSKSSEELVKENKGKEVNIPY........ 238
75 -20.0002qvo_A mol:protein length:95 Uncharacterized protein AF_1382  ali model follow..  12  1........................MEDERIKLLFKEKALEILMTIYGGNDVYIQYIASKVNSPHSYVWLIIKKFEEAKMVECEL---EGRTKIIRLTDKGQKIAQQI................................... 84

FFAS is supported by the NIH grant R01-GM087218-01
8 5 6 6 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.