current user: public




Query: 2f51_A mol:protein length:118 thioredoxin, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst MSDPIVHFNGTHEALLNRIKEAPGLVLVDFFATWCGPCQRLGQILPSIAEANKDVTFIKVDVDKNGNAADAYGVSSIPALFFVKKEGNEIKTLDQFVGADVSRIKADIEKFKLast
1 -72.2002f51_A mol:protein length:118 thioredoxin  ali model  100  1MSDPIVHFNGTHEALLNRIKEAPGLVLVDFFATWCGPCQRLGQILPSIAEANKDVTFIKVDVDKNGNAADAYGVSSIPALFFVKKEGNEIKTLDQFVGADVSRIKADIEKFK 112
2 -59.6002yoi_A mol:protein length:106 LECA THIOREDOXIN  ali model follow..  39  1....MVIQVTNKEEFEAILSEADKLVVVDFFATWCGPCKMIAPFFEELSEEYDKVVFIKVDVDEVPDVAAKYGITSMPTFKFFKNG----KKVDELVGANQEKLKQMILKH. 104
3 -59.0002j23_A mol:protein length:121 THIOREDOXIN  ali model follow..  29  5LVPRGSVQVISSYDQFKQVTGGDKVVVIDFWATWCGPCKMIGPVFEKISDTPDKVGFYKVDVDEQSQIAQEVGIRAMPTFVFFKNG----QKIDTVVGADPSKLQAAITQH. 113
4 -58.9002o8v_B mol:protein length:128 Thioredoxin 1  ali model follow..  29  14HSDKIIHL--TDDSFDTDVLKADGAILVDFWAEWCGPAKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGAL---SKGQLKEFLDAN. 120
5 -58.1001r26_A mol:protein length:125 Thioredoxin  ali model follow..  22  10.ARYPSVVDVYSVEQFRNIMSEDILTVAWFTAVWCGPCKTIERPMEKIAYEFPTVKFAKVDADNNSEIVSKCRVLQLPTFIIARSG----KMLGHVIGANPGMLRQKLRDI. 115
6 -58.1002fa4_A mol:protein length:111 Thioredoxin II  ali model follow..  35  2....MVTQLKSASEYDSALASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQYSDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGG----KEVTRVVGANPAAIKQAIASN. 104
7 -58.1004o32_A mol:protein length:138 Thioredoxin  ali model follow..  21  26MFKKVPRLQQNGSNIINGVNMKNTVIVLYFFAKWCQACTMQSTEMDKLQKYYKRIYLLKVDLDKNESLARKFSVKSLPTIILLKNKTMLARKDHFV---SSNDLIALIKKH. 134
8 -57.7002i1u_A mol:protein length:121 Thioredoxin  ali model follow..  28  10EKSATIKV--TDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERTDLTVAKLDVDTNPETARNFQVVSIPTLILFKDGQPVKRIVGAK---GKAALLRELSDV. 116
9 -57.7004wxt_A mol:protein length:125 Thioredoxin  ali model follow..  26  7.EKAIATIEVSDASFSTDVLASNKPVLVDFWATWCGPCKMVAPVLEEIASERDHLTVAKLDVDANPETAQNFQVVSIPTLILFKDGQPVKRIVGAK---GKAALLRELSDA. 114
10 -57.5004knd_A mol:protein length:112 Thioredoxin  ali model follow..  29  5ASNDVVVL--QDSTFEQEVLKSDTPVLVDFWAVWCGPCKAIAPVVDDLAARYGKLKVAKMDVDQHQGVPQQYGIRSIPTLLVFKGG----RVVDTVIGADKTRLEDSVKKA. 110
11 -57.2004dss_B mol:protein length:112 Thioredoxin-2  ali model follow..  34  3....MVTQLKSASEYDSALASGDKLVVVDFFATWCGPSKMIAPMIEKFAEQYSDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGG----KEVTRVVGANPAAIKQAIASN. 105
12 -56.6001t00_A mol:protein length:112 Thioredoxin  ali model follow..  29  3MAGTLKHV--TDDSFEQDVLKNDKPVLVDFWAAWCGPCRQIAPSLEAIAAEYDKIEIVKLNIDENPGTAAKYGVMSIPTLNVYQGGEVAKTIVGAK---PKAAIVRDLEDF. 109
13 -56.6002yj7_A mol:protein length:106 LPBCA THIOREDOXIN  ali model follow..  31  1....MSVIEVTDENFEQEVLKSDKPVLVDFWAPWCGPCRMIAPIIEELAKEYGKVKVVKVNVDENPNTAAQYGIRSIPTLLLFKNGQVVDRLVGAQ---PKEALKERIDKH. 105
14 -56.6003f3q_A mol:protein length:109 Thioredoxin-1  ali model follow..  31  1.....MVTQFKTASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQADFYKLDVDELGDVAQKNEVSAMPTLLLFKNG----KEVAKVVGANPAAIKQAIAAN. 102
15 -56.6004ba7_A mol:protein length:106 LBCA THIOREDOXIN  ali model follow..  33  1....MSVIEINDENFEEEVLKSDKPVLVDFWAPWCGPCRMIAPIIEELAEEYGKVKFAKVNVDENPETAAKYGIMSIPTLLLFKNGEVVDKLVGAR---PKEALKERIEKH. 105
16 -56.6003ziv_A mol:protein length:106 AECA THIOREDOXIN  ali model follow..  33  1....MSVIEINDENFDEVIKKSDKVVVVDFWAEWCGPCRMIAPIIEELAEEYGKVVFGKVNVDENPEIAAKYGIMSIPTLLFFKNGKVVDQLVGAR---PKEALKERIKKY. 105
17 -56.5002ynx_A mol:protein length:106 LACA THIOREDOXIN  ali model follow..  31  1....MSVVQLNDENFDEVIKKNNKVVVVDFWAEWCGPCRMIAPIIEELAKEYGKVVFGKLNVDENPEIAAKYGIMSIPTLLFFKNGKVVDQLVGAM---PKEALKERIKKY. 105
18 -56.5001thx_A mol:protein length:115 THIOREDOXIN  ali model follow..  26  5MSKGVITI--TDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVI---SKDKLLSFLDTH. 111
19 -56.4003dxb_A mol:protein length:222 thioredoxin N-terminally fused to Puf60(UHM)  ali model follow..  31  4MSDKIIHL--TDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGAL---SKGQLKEFLDAN. 110
20 -56.4001dby_A mol:protein length:107 CHLOROPLAST THIOREDOXIN M CH2  ali model follow..  26  1....MEAGAVNDDTFKNVVLESSVPVLVDFWAPWCGPCRIIAPVVDEIAGEYDKLKCVKLNTDESPNVASEYGIRSIPTIMVFKGGKKCETIIGAV---PKATIVQTVEKY. 105
21 -56.3002yn1_A mol:protein length:106 LGPCA THIOREDOXIN  ali model follow..  29  1....MSIIHVTDDSFDQDVLKADKPVLVDFWAEWCGPCKMIAPILDEIAEEYGKLKVAKVNIDENPETAAKYGIRGIPTLMLFKNGEVAATKVGAL---SKSQLKEFLDAN. 105
22 -56.3003dyr_A mol:protein length:111 Thioredoxin-1  ali model follow..  27  6.......IHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGTPTLLLFKNGEVAATKVGAL---SKGQLKEFLDAN. 107
23 -56.2004pob_A mol:protein length:117 Thioredoxin  ali model follow..  30  3MSDHAT-VTVTDDSFQEDVVSSNKPVLVDFWATWCGPCKMVAPVLEEIAKDHEALTIAKLDVDANPETARAFQVTSIPTLILFQNGEATKRIVGAK---SKSALLRELDGV. 110
24 -56.1001srx_A mol:protein length:108 THIOREDOXIN  ali model follow..  27  5.......IHLTDDSFDTDLVKADGAILVDFWAEWCGPCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYIERGIPTLLLFKNGEVAATKVGAL---SKGQLKEFLDAN. 106
25 -56.0002eir_A mol:protein length:108 Thioredoxin 1  ali model follow..  28  5.......IHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGAL---SKGQLKCFLDCN. 106
26 -56.0001txx_A mol:protein length:108 PROTEIN (THIOREDOXIN)  ali model follow..  26  5.......IHLTDDSFDTDVLKADGAILVDFWAEWCVWCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGAL---SKGQLKEFLDAN. 106
27 -56.0001zcp_A mol:protein length:108 Thioredoxin 1  ali model follow..  25  5.......IHLTDDSFDTDVLKADGAILVDFWAEWCACAKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGAL---SKGQLKEFLDAN. 106
28 -56.0004hu7_A mol:protein length:108 Thioredoxin-1  ali model follow..  27  5.......IHLTDDSFDTDVLKADGAILVDFWAEWCGACKMIAAILDEIADEYGKLTVAKLNIDQNAGTAAKYGIRGIPTLLLFKNGEVAATKVGAL---SKGQLKEFLDAN. 106
29 -55.9001keb_A mol:protein length:108 Thioredoxin 1  ali model follow..  28  5.......IHLTDDSFDTDVLKADGAILVDFWAEWCGPCKLIASILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGAL---SKGQLKEFLDAN. 106
30 -55.9003hhv_A mol:protein length:110 Thioredoxin (TrxA-2)  ali model follow..  24  4VKEPVKHLN---SKNFDEFITKNKIVVVDFWAEWCAPCLILAPVIEELANDYPQVAFGKLNTEESQDIAMRYGIMSLPTIMFFKNGELVDQILGAV---PREEIEVRLKSL. 108
31 -55.9002i4a_A mol:protein length:107 thioredoxin  ali model follow..  35  5.......LAVSDSSFDQDVLKASGLVLVDFWAEWCGPCKMIGPALGEIGKEFGKVTVAKVNIDDNPETPNAYQVRSIPTLMLVRDGKVIDKKVGAL---PKSQLKAWVESA. 106
32 -55.8001m7t_A mol:protein length:107 Chimera of Human and E. coli thioredoxin  ali model follow..  27  1.....MVKQIESKTAFQEALDADKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDAQDVAPKYGIRGIPTLLLFKNGEVAATKVGAL---SKGQLKEFLDAN. 105
33 -55.8003hz4_A mol:protein length:140 Thioredoxin  ali model follow..  16  9.......IEFEDMTWSQQVEDSKKPVVVMFYSPACPYCKAMEPYFEEYAKEYSSAVFGRINIATNPWTAEKYGVQGTPTFKFFCHGRPVWEQVGQI---YPSILKNAVRDM. 110
34 -55.7004j56_E mol:protein length:114 Thioredoxin  ali model follow..  32  7.......KIVTSQAEFDSIISQNELVIVDFFAEWCGPSKRIAPFYEECSKTYTKMVFIKVDVDEVSEVTEKENITSMPTFKVYKNG----SSVDTLLGANDSALKQLIEKYA 107
35 -55.6002puk_C mol:protein length:106 Thioredoxin M-type, chloroplast (TRX-M)  ali model follow..  23  3.......QDVNDSSWKEFVLESEVPVMVDFWAPWCGPSKLIAPVIDELAKEYGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAV---PKSTLTDSIEKY. 104
36 -55.6004cw9_A mol:protein length:109 THIOREDOXIN  ali model follow..  28  1....MAVLHINALDQLTALLSTEKVIVIDFFATWCGPSRSISPYFEELAGQYNNIKFVKVDVDQAEEICVNYKVRSMPTFVLVKDG----IEQKRFSGADRNALKQMVET.. 102
37 -55.4001xfl_A mol:protein length:124 Thioredoxin h1  ali model follow..  33  15.....CHTVETWNEQLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKLPNVLFLKVDTDELKSVASDWAIQAMPTFMFLKEG----KILDKVVGAKKDELQSTIAKH. 116
38 -55.2002oe0_A mol:protein length:114 Thioredoxin-3  ali model follow..  25  3.SSYTSITKLTNLTEFRNLIKQNDKLVIDFYATWCGPCKMMQPHLTKLIQAYPDVRFVKCDVDESPDIAKECEVTAMPTFVLGKDG----QLIGKIIGANPTALEKGIKD.. 107
39 -55.2001syr_A mol:protein length:112 thioredoxin  ali model follow..  34  6........IVTSQAEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECSKTYTKMVFIKVDVDEVSEVTEKENITSMPTFKVYKNG----SSVDTLLGANDSALKQLIEKY. 104
40 -55.2002mmn_A mol:protein length:104 Thioredoxin  ali model follow..  33  4........IVTSQSEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECSKTYTKMVFIKVDVDEVSEVTEKENITSMPTFKVYKNG----SSVDTLLGANDSALKQLIEKYA 103
41 -55.1002e0q_A mol:protein length:104 thioredoxin  ali model follow..  27  2.......IHLDSKNF-DSFLASHEIAVVDFWAEWCAPCLILAPIIEELAEDYPQVGFGKLNSDENPDIAARYGVMSLPTVIFFKDGEPVDEIIGAV---PREEIEIRIKNL. 101
42 -55.1003gnj_A mol:protein length:111 Thioredoxin domain protein  ali model follow..  15  1.SNAMSLEKLDTNTFEQLIYDEGKACLVMFSRKNCHVCQKVTPVLEELRLNYESFGFYYVDVEEEKTLFQRFSLKGVPQILYFKDGEYKGKMAGDV---EDDEVEQMIADV. 108
43 -55.1002ypm_A mol:protein length:106 LAFCA THIOREDOXIN  ali model follow..  37  1....MVIQVTNKDEFESILSEADKLVVVDFTATWCGPCKMIAPKFEELSEEYPDVVFLKVDVDEVEDVAAEYGISAMPTFQFFKNG----KKVDELTGANQEKLKAMIKKHA 105
44 -55.0003vfi_A mol:protein length:104 thioredoxin  ali model follow..  13  2.......RSLSDSDFQLEVRQHPDPIIIMFTGSWCQPCKKMKPTFEEMASQMGDIRFAYMDAEDAEKTMAELNIRTLPSLALFVDGMIREVFSGTM---NKSDLRYWINNN. 103
45 -55.0001ti3_A mol:protein length:113 thioredoxin H  ali model follow..  33  9.....CHTVDTWKEHFEKGKGSQKLIVVDFTASWCPPCKMIAPIFAELAKKFPNVTFLKVDVDELKAVAEEWNVEAMPTFIFLKDG----KLVDKTVGADKDGLPTLVAKHA 111
46 -55.0004xhm_A mol:protein length:137 Thioredoxin (Trx-3)  ali model follow..  26  36.......VKLNSSNF-DETLKNNENVVVDFWAEWCHPCKMIAPVIEELAKEYGKVVFGKLNTDENPTIAARYGISAIPTLIFFKKGKPVDQLVGAM---PKSELKRWVQRN. 136
47 -54.9002vm1_A mol:protein length:118 THIOREDOXIN H ISOFORM 1.  ali model follow..  30  11.....CHTKQEFDTHMANGKDTGKLVIIDFTASWCGPCRVIAPVFAEYAKKFPGAIFLKVDVDELKDVAEAYNVEAMPTFLFIKDG----EKVDSVVGGRKDDIHTKIVAL. 112
48 -54.9003zzx_A mol:protein length:105 THIOREDOXIN  ali model follow..  33  1....MVYQVKDQEDFTKQLNEANKLVVIDFYATWCGPCKMIAPKLEELSQSMSDVVFLKVDVDECEDIAQDNQIACMPTFLFMKNG----QKLDSLSGANYDKLLELVEKNK 105
49 -54.9002iwt_A mol:protein length:125 THIOREDOXIN H ISOFORM 2  ali model follow..  28  20.....VHSLEQWTMQIEEANTAKKLVVIDFTASWCGPSRIMAPVFADLAKKFPNAVFLKVDVDELKPIAEQFSVEAMPTFLFMKEG----DVKDRVVGAIKEELTAKVGLHA 122
50 -54.9002vim_A mol:protein length:104 THIOREDOXIN  ali model follow..  36  1.....MRVLATAADLEKLINENGRLIVVDFFAQWCGPCRNIAPKVEALAKEIPEVEFAKVDVDQNEEAAAKYSVTAMPTFVFIKDG----KEVDRFSGANETKLRETITRHK 104
51 -54.4001uvz_A mol:protein length:119 THIOREDOXIN  ali model follow..  26  4SGSTTFNIQ-DGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIK---DEDQLEAFLKKL. 111
52 -54.3002lrc_A mol:protein length:114 Probable thioredoxin  ali model follow..  17  1....MKTRYSAEAPARDELDRLAGPTLVEFGTDWCGHCQAAQPLLAEVFSDYPEVGHLKVEDGPGRRLGRSFQVKLWPTFVFLRDGREVARVVRP---GSASVLEEAFESL. 104
53 -54.2002o7k_A mol:protein length:107 Thioredoxin  ali model follow..  27  1.GSHMAIVKVTDADFDSKVESG--VQLVDFWATWCGPCKMIAPVLEELAADYGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQ---PKENLAEVLDKH. 106
54 -54.2002o89_A mol:protein length:107 Thioredoxin  ali model follow..  25  1.GSHMAIVKVTDADFDSKVESG--VQLVDFWATWCGTSKMIAPVLEELAADYGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQ---PKENLAEVLDKH. 106
55 -54.2001faa_A mol:protein length:124 THIOREDOXIN F  ali model follow..  22  15.AIVGKVTEVNKDTFWPIVKAADKPVVLDMFTQWCGPCKAMAPKYEKLAEEYLDVIFLKLDCNENKTLAKELGIRVVPTFKILKEN----SVVGEVTGAKYDKLLEAIQAAR 123
56 -54.0002mcs_A mol:protein length:128 Thioredoxin  ali model follow..  26  18.......EQIGDSEFDNKVTSDNILILVDFWAPWCGPCRSLEPQLEKLAQQYENVKIYKINIEDNQDVATQYGVSAIPTILMFKNGKKLSQVIGAD---ISKIISEINNN.. 120
57 -54.0002cvk_A mol:protein length:110 Thioredoxin  ali model follow..  29  1....MAKPIEVTDQNFDETLGQHPLVLVDFWAEWCAPCRMIAPILEEIAKEYGKLLVAKLDVDENPKTAMRYRVMSIPTVILFKDGQPVEVLVGAQ---PKRNYQAKIEKH. 105
58 -53.9003cxg_A mol:protein length:133 Putative thioredoxin  ali model follow..  19  11QGQSIYIELKNTGSLNQVFSSTNSSIVIKFGAVWCKPCNKIKEYFKNQL-NYYYVTLVDIDVDIHPKLNDQHNIKALPTFEFYFNLNNEWVLVHTVEGANQNDIEKAFQKY. 121
59 -53.8004pok_A mol:protein length:109 Thioredoxin  ali model follow..  33  2.AGTMVKQIESKTAFQKALKAADKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKG----QKVGEFSGANKKKLEATINKL. 108
60 -53.7004puf_C mol:protein length:117 Thioredoxin  ali model follow..  32  4.SGSMVKQIESKTAFQEALDAADKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKG----QKVGEFSGANKEKLEATINEL. 110
61 -53.6003qfa_C mol:protein length:116 Thioredoxin  ali model follow..  31  2RGSGSVKQIESKTAFQEALDAADKLVVVDFSATWCGPSKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKG----QKVGEFSGANKEKLEATINEL. 109
62 -53.6002voc_A mol:protein length:112 THIOREDOXIN  ali model follow..  26  1....MAIVKATDQSFSAET--SEGVVLADFWAPWCGPSKMIAPVLEELDQEMDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKDGEVVETSVGFK---PKEALQELVNKH. 103
63 -53.5003tco_A mol:protein length:109 Thioredoxin (TrxA-1)  ali model follow..  25  2KEDVTLVLT---EENFDEVIRNNKLVLVDCWAEWCAPCHLYEPIYKKVAEKYGKAVFGRLNVDENQKIADKYSVLNIPTTLIFVNGQLVDSLVGAV---DEDTLESTVNKY. 107
64 -53.4001wmj_A mol:protein length:130 Thioredoxin H-type  ali model follow..  32  19.....CHNKDEFDAQMTKAKEAGKVVIIDFTASWCGPCRFIAPVFAEYAKKFPGAVFLKVDVDELKEVAEKYNVEAMPTFLFIKDG----AEADKVVGARKDDLQNTIVKH. 120
65 -53.2001nsw_A mol:protein length:105 THIOREDOXIN  ali model follow..  29  3.......MTLTDANF-QQAIQGDGPVLVDFWAAWCGPCRMMAPVLEEFAEAHDKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGRPVKQLIGYQ---PKEQLEAQLADV. 103
66 -53.1003kd0_A mol:protein length:105 Thioredoxin  ali model follow..  32  1....MVKQIESKTAFQEALDAADKLVVVDFSATWCGPSKMIKPFFHSLSEKYSNVIFLEVDVDDSQDVASESEVKSMPTFQFFKKG----QKVGEFSGANKEKLEATINEL. 104
67 -53.0003m9j_A mol:protein length:105 Thioredoxin  ali model follow..  33  1....MVKQIESKTAFQEALDAADKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASESEVKSMPTFQFFKKG----QKVGEFSGANKEKLEATINEL. 104
68 -53.0001erw_A mol:protein length:105 THIOREDOXIN  ali model follow..  30  1....MVKQIESKTAFQEALDAADKLVVVDFSATWSGPSKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKG----QKVGEFSGANKEKLEATINEL. 104
69 -53.0001cqg_A mol:protein length:105 THIOREDOXIN  ali model follow..  31  1....MVKQIESKTAFQEALDAADKLVVVDFSATWCGPAKMIKPFFHSLSEKYSNVIFLEVDVDDAQDVASEAEVKATPTFQFFKKG----QKVGEFSGANKEKLEATINEL. 104
70 -53.0001nw2_A mol:protein length:105 THIOREDOXIN  ali model follow..  28  3.......MTLTDANF-QQAIQGDKPVLVDFWAAWCGPCRMMAPVLEEFAEAHDKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGEPVKQLIGYQ---PKEQLEAQLADV. 103
71 -53.0003e3e_A mol:protein length:105 Thioredoxin  ali model follow..  31  1....MVKQIESKTAFQEALDAADKLVVVDFSATWCGPSKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKRMPTFQFFKKG----QKVGEFSGANKEKLEATINEL. 104
72 -53.0001ep7_A mol:protein length:112 THIOREDOXIN CH1, H-TYPE  ali model follow..  32  7.....IDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGVIFLKVDVDAVAAVAEAAGITAMPTFHVYKDG----VKADDLVGASQDKLKALVAKH. 109
73 -52.8002l5l_A mol:protein length:136 Thioredoxin  ali model follow..  26  17.AEFLAKVYNFEKNPEEWKYEGDKPAIVDFYADWCGPCKMVAPILDELAKEYGQIVIYKVDTEKEQELAGAFGIRSIPSILFIPMEGKPEMAQGAM---PKASFKKAIDEF. 124
74 -52.5001gh2_A mol:protein length:107 THIOREDOXIN-LIKE PROTEIN  ali model follow..  25  3.....VKPVGSDPDFQPELSGASRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFQFFRNK----VRIDQYQGADAVGLEEKIKQH. 105
75 -52.5001xwa_A mol:protein length:111 thioredoxin  ali model follow..  32  3.AAAMVYQVKDKADLDGQLTKAGKLVVLDFFATWCGPCKMISPKLVELSTQFADVVVLKVDVDECEDIAMEYNISSMPTFVFLKNG----VKVEEFAGANAKRLEDVIKAN. 110

FFAS is supported by the NIH grant R01-GM087218-01
8 5 6 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.