current user: public




2f51A
Query: 2f51_A mol:protein length:118 thioredoxin, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst MSDPIVHFNGTHEALLNRIKEAPGLVLVDFFATWCGPCQRLGQILPSIAEANKDVTFIKVDVDKNGNAADAYGVSSIPALFFVKKEGNEIKTLDQFVGADVSRIKADIEKFKLast
1 -71.4002f51_A mol:protein length:118 thioredoxin  ali model  100  1MSDPIVHFNGTHEALLNRIKEAPGLVLVDFFATWCGPCQRLGQILPSIAEANKDVTFIKVDVDKNGNAADAYGVSSIPALFFVKKEGNEIKTLDQFVGADVSRIKADIEKFK 112
2 -61.4001r26_A mol:protein length:125 Thioredoxin  ali model follow..  22  10.ARYPSVVDVYSVEQFRNIMSEDILTVAWFTAVWCGPCKTIERPMEKIAYEFPTVKFAKVDADNNSEIVSKCRVLQLPTFIIARSG----KMLGHVIGANPGMLRQKLRDI. 115
3 -61.3002fa4_A mol:protein length:111 Thioredoxin II  ali model follow..  35  2....MVTQLKSASEYDSALASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQYSDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGG----KEVTRVVGANPAAIKQAIASN. 104
4 -60.6001syr_A mol:protein length:112 thioredoxin  ali model follow..  33  3.....MVKIVTSQAEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECSKTYTKMVFIKVDVDEVSEVTEKENITSMPTFKVYKNG----SSVDTLLGANDSALKQLIEKY. 104
5 -60.3002oe0_A mol:protein length:114 Thioredoxin-3  ali model follow..  25  3.SSYTSITKLTNLTEFRNLIKQNDKLVIDFYATWCGPCKMMQPHLTKLIQAYPDVRFVKCDVDESPDIAKECEVTAMPTFVLGKDG----QLIGKIIGANPTALEKGIKD.. 107
6 -60.1002vim_A mol:protein length:104 THIOREDOXIN  ali model follow..  36  1.....MRVLATAADLEKLINENGRLIVVDFFAQWCGPCRNIAPKVEALAKEIPEVEFAKVDVDQNEEAAAKYSVTAMPTFVFIKDG----KEVDRFSGANETKLRETITRHK 104
7 -60.1003ul3_B mol:protein length:128 Thioredoxin  ali model follow..  21  20MFKKVPRLQQNGSNIINGVNMKNTVIVLYFFAKWCQACTMQSTEMDKLQKYYKRIYLLKVDLDKNESLARKFSVKSLPTIILLKNKTMLARKDHFV---SSNDLIALIKKH. 128
8 -59.8003ZZX Entity 1(prereleased)  ali follow..  33  1....MVYQVKDQEDFTKQLNEANKLVVIDFYATWCGPCKMIAPKLEELSQSMSDVVFLKVDVDECEDIAQDNQIACMPTFLFMKNG----QKLDSLSGANYDKLLELVEKNK 105
9 -59.5002o8v_B mol:protein length:128 Thioredoxin 1  ali model follow..  27  18......IIHLTDDSFDTDVLKADGAILVDFWAEWCGPAKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGAL---SKGQLKEFLDAN. 120
10 -59.3002j23_A mol:protein length:121 THIOREDOXIN  ali model follow..  29  5LVPRGSVQVISSYDQFKQVTGGDKVVVIDFWATWCGPCKMIGPVFEKISDTPDKVGFYKVDVDEQSQIAQEVGIRAMPTFVFFKNG----QKIDTVVGADPSKLQAAITQH. 113
11 -59.2003f3q_A mol:protein length:109 Thioredoxin-1  ali model follow..  31  1.....MVTQFKTASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQADFYKLDVDELGDVAQKNEVSAMPTLLLFKNG----KEVAKVVGANPAAIKQAIAAN. 102
12 -59.1001xfl_A mol:protein length:124 Thioredoxin h1  ali model follow..  33  15.....CHTVETWNEQLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKLPNVLFLKVDTDELKSVASDWAIQAMPTFMFLKEG----KILDKVVGAKKDELQSTIAKH. 116
13 -58.9002i1u_A mol:protein length:121 Thioredoxin  ali model follow..  28  12....SATIKVTDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERTDLTVAKLDVDTNPETARNFQVVSIPTLILFKDGQPVKRIVGAK---GKAALLRELSDV. 116
14 -58.7003cxg_A mol:protein length:133 Putative thioredoxin  ali model follow..  19  11QGQSIYIELKNTGSLNQVFSSTNSSIVIKFGAVWCKPCNKIKEYFKNQLNYY-YVTLVDIDVDIHPKLNDQHNIKALPTFEFYFNLNNEWVLVHTVEGANQNDIEKAFQKY. 121
15 -58.6001ti3_A mol:protein length:113 thioredoxin H  ali model follow..  33  9.....CHTVDTWKEHFEKGKGSQKLIVVDFTASWCPPCKMIAPIFAELAKKFPNVTFLKVDVDELKAVAEEWNVEAMPTFIFLKDG----KLVDKTVGADKDGLPTLVAKH. 110
16 -58.5003hz4_A mol:protein length:140 Thioredoxin  ali model follow..  16  8......IIEFEDMTWSQQVEDSKKPVVVMFYSPACPYCKAMEPYFEEYAKEYSSAVFGRINIATNPWTAEKYGVQGTPTFKFFCHGRPVWEQVGQI---YPSILKNAVRDM. 110
17 -58.4002l5l_A mol:protein length:136 Thioredoxin  ali model follow..  26  17.AEFLAKVYNFEKNPEEWKYEGDKPAIVDFYADWCGPCKMVAPILDELAKEYGQIVIYKVDTEKEQELAGAFGIRSIPSILFIPMEGKPEMAQGAM---PKASFKKAIDEF. 124
18 -58.2001faa_A mol:protein length:124 THIOREDOXIN F  ali model follow..  24  20......VTEVNKDTFWPIVKAADKPVVLDMFTQWCGPCKAMAPKYEKLAEEYLDVIFLKLDCNENKTLAKELGIRVVPTFKILKEN----SVVGEVTGAKYDKLLEAIQAAR 123
19 -58.1002i4a_A mol:protein length:107 thioredoxin  ali model follow..  34  4......TLAVSDSSFDQDVLKASGLVLVDFWAEWCGPCKMIGPALGEIGKEFGKVTVAKVNIDDNPETPNAYQVRSIPTLMLVRDGKVIDKKVGAL---PKSQLKAWVESAQ 107
20 -57.9002vm1_A mol:protein length:118 THIOREDOXIN H ISOFORM 1.  ali model follow..  28  4.EEGAVIACHTKQEFDTHMANTGKLVIIDFTASWCGPCRVIAPVFAEYAKKFPGAIFLKVDVDELKDVAEAYNVEAMPTFLFIKDG----EKVDSVVGGRKDDIHTKIVAL. 112
21 -57.6002iwt_A mol:protein length:125 THIOREDOXIN H ISOFORM 2  ali model follow..  28  20.....VHSLEQWTMQIEEANTAKKLVVIDFTASWCGPSRIMAPVFADLAKKFPNAVFLKVDVDELKPIAEQFSVEAMPTFLFMKEG----DVKDRVVGAIKEELTAKVGLH. 121
22 -57.5001dby_A mol:protein length:107 CHLOROPLAST THIOREDOXIN M CH2  ali model follow..  26  1....MEAGAVNDDTFKNVVLESSVPVLVDFWAPWCGPCRIIAPVVDEIAGEYDKLKCVKLNTDESPNVASEYGIRSIPTIMVFKGGKKCETIIGAV---PKATIVQTVEKY. 105
23 -57.5001wmj_A mol:protein length:130 Thioredoxin H-type  ali model follow..  27  12.EEGVVIACHNKDEFDAQMTKAGKVVIIDFTASWCGPCRFIAPVFAEYAKKFPGAVFLKVDVDELKEVAEKYNVEAMPTFLFIKDG----AEADKVVGARKDDLQNTIVKH. 120
24 -57.5003dyr_A mol:protein length:111 Thioredoxin-1  ali model follow..  26  2...SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGTPTLLLFKNGEVAATKVGAL---SKGQLKEFLDAN. 107
25 -57.3002eir_A mol:protein length:108 Thioredoxin 1  ali model follow..  27  1...SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGAL---SKGQLKCFLDCN. 106
26 -57.3001srx_A mol:protein length:108 THIOREDOXIN  ali model follow..  26  1...SDKIIHLTDDSFDTDLVKADGAILVDFWAEWCGPCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYIERGIPTLLLFKNGEVAATKVGAL---SKGQLKEFLDAN. 106
27 -57.2001t00_A mol:protein length:112 Thioredoxin  ali model follow..  29  3MAGTLKHV--TDDSFEQDVLKNDKPVLVDFWAAWCGPCRQIAPSLEAIAAEYDKIEIVKLNIDENPGTAAKYGVMSIPTLNVYQGGEVAKTIVGAK---PKAAIVRDLEDF. 109
28 -57.2001thx_A mol:protein length:115 THIOREDOXIN  ali model follow..  26  5MSKGVITI--TDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVI---SKDKLLSFLDTH. 111
29 -57.1001xwa_A mol:protein length:111 thioredoxin  ali model follow..  30  3.AAAMVYQVKDKADLDGQLTKSGKLVVLDFFATWCGPCKMISPKLVELSTQFDNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNG----VKVEEFAGANAKRLEDVIKAN. 110
30 -57.1002diy_A mol:protein length:130 Thioredoxin-like protein 2  ali model follow..  21  20.....VEEVGSAGQFEELLLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNS----QKIDRLDGAHAPELTKKVQRH. 122
31 -57.1001keb_A mol:protein length:108 Thioredoxin 1  ali model follow..  27  1...SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKLIASILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGAL---SKGQLKEFLDAN. 106
32 -57.0003kd0_A mol:protein length:105 Thioredoxin  ali model follow..  32  1....MVKQIESKTAFQEALDAADKLVVVDFSATWCGPSKMIKPFFHSLSEKYSNVIFLEVDVDDSQDVASESEVKSMPTFQFFKKG----QKVGEFSGANKEKLEATINEL. 104
33 -56.9001aiu_A mol:protein length:105 THIOREDOXIN  ali model follow..  31  1....MVKQIESKTAFQEALDAADKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKG----QKVGEFSGANKEKLEATINEL. 104
34 -56.9001m7t_A mol:protein length:107 Chimera of Human and E. coli thioredoxin  ali model follow..  27  1.....MVKQIESKTAFQEALDADKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDAQDVAPKYGIRGIPTLLLFKNGEVAATKVGAL---SKGQLKEFLDAN. 105
35 -56.8003hhv_A mol:protein length:110 Thioredoxin (TrxA-2)  ali model follow..  22  5...KEPVKHLNSKNF-DEFITKNKIVVVDFWAEWCAPCLILAPVIEELANDYPQVAFGKLNTEESQDIAMRYGIMSLPTIMFFKNGELVDQILGAV---PREEIEVRLKSL. 108
36 -56.8003e3e_A mol:protein length:105 Thioredoxin  ali model follow..  31  1....MVKQIESKTAFQEALDAADKLVVVDFSATWCGPSKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKRMPTFQFFKKG----QKVGEFSGANKEKLEATINEL. 104
37 -56.8001txx_A mol:protein length:108 PROTEIN (THIOREDOXIN)  ali model follow..  26  4......IIHLTDDSFDTDVLKADGAILVDFWAEWCVWCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGAL---SKGQLKEFLDAN. 106
38 -56.8001zcp_A mol:protein length:108 Thioredoxin 1  ali model follow..  25  4......IIHLTDDSFDTDVLKADGAILVDFWAEWCACAKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGAL---SKGQLKEFLDAN. 106
39 -56.8001erv_A mol:protein length:105 THIOREDOXIN  ali model follow..  33  1....MVKQIESKTAFQEALDAADKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKG----QKVGEFSGANKEKLEATINEL. 104
40 -56.8002xbq_A mol:protein length:117 THIOREDOXIN  ali model follow..  33  15.....LIELKQDGDLESLLEQHNKLVVVDFFATWCGPCKTIAPLFKELSEKY-DAIFVKVDVDKLEETARKYNISAMPTFIAIKNG----EKVGDVVGASIAKVEDMIKKF. 116
41 -56.7001cqg_A mol:protein length:105 THIOREDOXIN  ali model follow..  31  1....MVKQIESKTAFQEALDAADKLVVVDFSATWCGPAKMIKPFFHSLSEKYSNVIFLEVDVDDAQDVASEAEVKATPTFQFFKKG----QKVGEFSGANKEKLEATINEL. 104
42 -56.6002puk_C mol:protein length:106 Thioredoxin M-type, chloroplast (TRX-M)  ali model follow..  23  2......VQDVNDSSWKEFVLESEVPVMVDFWAPWCGPSKLIAPVIDELAKEYGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAV---PKSTLTDSIEKY. 104
43 -56.6003trx_A mol:protein length:105 THIOREDOXIN  ali model follow..  32  1....MVKQIESKTAFQEALDAADKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCTPTFQFFKKG----QKVGEFSGANKEKLEATINEL. 104
44 -56.6001uvz_A mol:protein length:119 THIOREDOXIN  ali model follow..  27  8.....TFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIK---DEDQLEAFLKKL. 111
45 -56.5001erw_A mol:protein length:105 THIOREDOXIN  ali model follow..  30  1....MVKQIESKTAFQEALDAADKLVVVDFSATWSGPSKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKG----QKVGEFSGANKEKLEATINEL. 104
46 -56.5003qfa_C mol:protein length:116 Thioredoxin  ali model follow..  30  1MRGSGSVKQIESKTAFQEALDADKLVVVDFSATWCGPSKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKG----QKVGEFSGANKEKLEATINEL. 109
47 -56.4003gnj_A mol:protein length:111 Thioredoxin domain protein  ali model follow..  15  1.SNAMSLEKLDTNTFEQLIYDEGKACLVMFSRKNCHVCQKVTPVLEELRLNYESFGFYYVDVEEEKTLFQRFSLKGVPQILYFKDGEYKGKMAGDV---EDDEVEQMIADV. 108
48 -56.3003hxs_A mol:protein length:141 Thioredoxin  ali model follow..  27  19.KPQSGTIHLTRAEFLKKIADGDKPAIVDFYADWCGPCKMVAPILEELSKEYGKIYIYKVNVDKEPELARDFGIQSIPTIWFVPMKGEPQVNMGAL---SKEQLKGYIDKV. 137
49 -56.3001ep7_A mol:protein length:112 THIOREDOXIN CH1, H-TYPE  ali model follow..  29  4.....VIVIDSKAAWDAQLAKEHKPIVVDFTATWCGPCKMIAPLFETLSNDYGKVIFLKVDVDAVAAVAEAAGITAMPTFHVYKDG----VKADDLVGASQDKLKALVAKH. 109
50 -56.1001gh2_A mol:protein length:107 THIOREDOXIN-LIKE PROTEIN  ali model follow..  25  2....GVKPVGSDPDFQPELSGASRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFQFFRNK----VRIDQYQGADAVGLEEKIKQH. 105
51 -56.0002e0q_A mol:protein length:104 thioredoxin  ali model follow..  26  1......VIHLDSKNF-DSFLASHEIAVVDFWAEWCAPCLILAPIIEELAEDYPQVGFGKLNSDENPDIAARYGVMSLPTVIFFKDGEPVDEIIGAV---PREEIEIRIKNL. 101
52 -55.9003VFI Entity 1(prereleased)  ali follow..  13  1......LRSLSDSDFQLEVRQHPDPIIIMFTGSWCQPCKKMKPTFEEMASQMGDIRFAYMDAEDAEKTMAELNIRTLPSLALFVDGMIREVFSGTM---NKSDLRYWINNN. 103
53 -55.8002wz9_A mol:protein length:153 GLUTAREDOXIN-3  ali model follow..  21  14.....VEEVGSAGQFEELLLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNS----QKIDRLDGAHAPELTKKVQRH. 116
54 -55.3002xbi_A mol:protein length:108 THIOREDOXIN  ali model follow..  33  6.....LIELKQDGDLESLLEQHNKLVVVDFFATWCGPCKTIAPLFKELSEKY-DAIFVKVDVDKLEETARKYNISAMPTFIAIKNG----EKVGDVVGASIAKVEDMIKKF. 107
55 -55.2002o7k_A mol:protein length:107 Thioredoxin  ali model follow..  27  1.GSHMAIVKVTDADFDSKVESG--VQLVDFWATWCGPCKMIAPVLEELAADYGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQ---PKENLAEVLDKH. 106
56 -55.1002o89_A mol:protein length:107 Thioredoxin  ali model follow..  25  1.GSHMAIVKVTDADFDSKVESG--VQLVDFWATWCGTSKMIAPVLEELAADYGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQ---PKENLAEVLDKH. 106
57 -55.1003d22_A mol:protein length:139 Thioredoxin H-type  ali model follow..  21  29.....ITTKERWDQKLSEASRDGKIVLANFSARWCGPSRQIAPYYIELSENYPSLMFLVIDVDELSDFSASWEIKATPTFFFLRDG----QQVDKLVGANKPELHKKITAI. 130
58 -55.0003d21_A mol:protein length:139 Thioredoxin H-type  ali model follow..  22  29.....ITTKERWDQKLSEASRDGKIVLANFSARWCGPCKQIAPYYIELSENYPSLMFLVIDVDELSDFSASWEIKATPTFFFLRDG----QQVDKLVGANKPELHKKITAI. 130
59 -54.7003d6i_A mol:protein length:112 Monothiol glutaredoxin-3  ali model follow..  21  3....IEINDQEQFTYLTTTAAGDKLIVLYFHTSWAEPCKALKQVFEAISNEPSNVSFLSIDADENSEISELFEISAVPYFIIIHKG----TILKELSGADPKEYVSLLEDC. 107
60 -54.5002voc_A mol:protein length:112 THIOREDOXIN  ali model follow..  26  1....MAIVKATDQSFSAET--SEGVVLADFWAPWCGPSKMIAPVLEELDQEMDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKDGEVVETSVGFK---PKEALQELVNKH. 103
61 -54.5002cvk_A mol:protein length:110 Thioredoxin  ali model follow..  29  1....MAKPIEVTDQNFDETLGQHPLVLVDFWAEWCAPCRMIAPILEEIAKEYGKLLVAKLDVDENPKTAMRYRVMSIPTVILFKDGQPVEVLVGAQ---PKRNYQAKIEKH. 105
62 -54.2003tco_A mol:protein length:109 Thioredoxin (TrxA-1)  ali model follow..  26  3...EDVTLVLTEENF-DEVIRNNKLVLVDCWAEWCAPCHLYEPIYKKVAEKYGKAVFGRLNVDENQKIADKYSVLNIPTTLIFVNGQLVDSLVGAV---DEDTLESTVNKY. 107
63 -54.1001nsw_A mol:protein length:105 THIOREDOXIN  ali model follow..  29  1.....ATMTLTDANF-QQAIQGDGPVLVDFWAAWCGPCRMMAPVLEEFAEAHDKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGRPVKQLIGYQ---PKEQLEAQLADV. 103
64 -54.0001nw2_A mol:protein length:105 THIOREDOXIN  ali model follow..  28  1.....ATMTLTDANF-QQAIQGDKPVLVDFWAAWCGPCRMMAPVLEEFAEAHDKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGEPVKQLIGYQ---PKEQLEAQLADV. 103
65 -53.4003aps_A mol:protein length:122 DnaJ homolog subfamily C member 10  ali model follow..  20  1LPQASIDL--TPQTFNEKVLQGKTHWVVDFYAPWCGPCQNFAPEFELLARMIGKVRAGKVDCQAYPQTCQKAGIKAYPSVKLYQYERAKKSIWEEQINSDAKTIAALIYGK. 111
66 -53.1001oaz_A mol:protein length:123 THIOREDOXIN 1  ali model follow..  30  1MSDKIIHL--TDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGAL---SKGQLKEFLDAN. 121
67 -53.0003emx_A mol:protein length:135 Thioredoxin  ali model follow..  14  18......LIYITPEEFRQLL---QGDAILAVYSKTCPHCHRDWPQLIQASKEVDGSLIGERELSAARLEMNKAGVEGTPTLVFYKEGRIVDKLVGA---TPWSLKVEKAREI. 124
68 -52.3002l6c_A mol:protein length:110 Thioredoxin  ali model follow..  16  3.....AIRDITTEAGMAHF-EGLSDAIVFFHKNLCPHCKNMEKVLDKFGARAPQVAISSVDSEARPELMKELGFERVPTLVFIRDGKVAKVFSGIM---NPRELQALYAS.. 103
69 -51.3002ppt_A mol:protein length:155 thioredoxin-2  ali model follow..  23  48......KVAGIDPAILARAERDDLPLLVDFWAPWCGPCRQMAPQFQAAAATLGQVRLAKIDTQAHPAVAGRHRIQGIPAFILFHKGRELARAAGAR---PASELVGFVRGK. 150
70 -50.9003p2a_A mol:protein length:148 Putative thioredoxin-like protein  ali model follow..  20  41.......INATAETL-DKLLQDDLPMVIDFWAPWCGPCRSFAPIFAETAAERGKVRFVKVNTEAEPALSTRFRIRSIPTIMLYRNGKMIDMLNGAV---PKAPFDNWLDEQ. 141
71 -50.7001v98_A mol:protein length:140 thioredoxin  ali model follow..  27  36.......VEADEKGFAQEVAGAP-LTLVDFFAPWCGPCRLVSPILEELARDHGRLKVVKVNVDEHPGLAARYGVRSVPTLVLFRRGAPVATWVGAS---PRRVLEERLRPY. 136
72 -50.2001x5d_A mol:protein length:133 Protein disulfide-isomerase A6  ali model follow..  20  4.GSSGDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDG---GRTRSDIVSRALDL. 115
73 -49.8002dj3_A mol:protein length:133 Protein disulfide-isomerase A4  ali model follow..  20  4.GSSGPVKVVVGKTFDAIVMDPKKDVLIEFYAPWCGHCKQLEPIYTSLGKKYKDLVIAKMDATANDITNDQYKVEGFPTIYFAPSGDKKNPIKFEGGNRDLEHLSKFIDEH. 116
74 -49.3003dxb_A mol:protein length:222 thioredoxin N-terminally fused to Puf60(UHM)  ali model follow..  30  4MSDKII--HLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGAL---SKGQLKEFLDAN. 110
75 -48.8002dj0_A mol:protein length:137 Thioredoxin-related transmembrane protein 2  ali model follow..  16  9......IKYFNDKTIDEELERDKRTWIVEFFANWSNDCQSFAPIYADLSLKYTGLNFGKVDVGRYTDVSTRYKVKQLPTLILFQGGKEAMRRPQI---DKKGRAVSWTFSEE 120

FFAS is supported by the NIH grant R01-GM087218-01
6 0 5 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Reed JC, Doctor KS, Godzik A. The domains of apoptosis: a genomics perspective. Sci STKE. 2004 Jun 22;2004(239):re9. Review.