current user: public




Query: 2egg_A mol:protein length:297 Shikimate 5-dehydrogenase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290
# Score Template Links and tools%idFirst MGSSSSGENLYFQGHMEKVYGLIGFPVEHSLSPLMHNDAFARLGIPARYHLFSVEPGQVGAAIAGVRALGIAGVNVTIPHKLAVIPFLDEVDEHARRIGAVNTIINNDGRLVGYNTDGLGYVQALEEEMNITLDGKRILVIGAGGGARGIYFSLLSTAAERIDMANRTVEKAERLVREGDERRSAYFSLAEAETRLAEYDIIINTTSVGMHPRVEVQPLSLERLRPGVIVSDIIYNPLETKWLKEAKARGARVQNGVGMLVYQGALAFEKWTGQWPDVNRMKQLVIEALRRLast
1 -117.0002egg_A mol:protein length:297 Shikimate 5-dehydrogenase  ali model  100  1MGSSSSGENLYFQGHMEKVYGLIGFPVEHSLSPLMHNDAFARLGIPARYHLFSVEPGQVGAAIAGVRALGIAGVNVTIPHKLAVIPFLDEVDEHARRIGAVNTIINNDGRLVGYNTDGLGYVQALEEEMNITLDGKRILVIGAGGGARGIYFSLLSTAAERIDMANRTVEKAERLVREGDERRSAYFSLAEAETRLAEYDIIINTTSVGMHPRVEVQPLSLERLRPGVIVSDIIYNPLETKWLKEAKARGARVQNGVGMLVYQGALAFEKWTGQWPDVNRMKQLVIEALRR 291
2 -105.0001nvt_A mol:protein length:287 Shikimate 5`-dehydrogenase  ali model follow..  47  2......PLGSMINAKT-KVIGLIGHPVEHSFSPIMHNAAFKDKGLNYVYVAFDVLPENLKYVIDGAKALGIVGFNVTIPHKIEIMKYLDEIDKDAQLIGAVNTIKIEDGKAIGYNTDGIGARMALEEE-IGRVKDKNIVIYGAGGAARAVAFELAKDN--NIIIANRTVEKAEALAKEIAEKLGEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVAFKIWTGVEPNIEVMKNAIIDKITK 287
3 -104.0001vi2_A mol:protein length:300 Shikimate 5-dehydrogenase 2  ali model follow..  33  1.......MSLDVTAKY-ELIGLMAYPIRHSLSPEMQNKALEKAGLPFTYMAFEVDNDSFPGAIEGLKALKMRGTGVSMPNKQLACEYVDELTPAAKLVGAINTIVNDDGYLRGYNTDGTGHIRAIKES-GFDIKGKTMVLLGAGGASTAIGAQGAIEGLKEIKLFNRRFDKALAFAQRVNENTDCVVTVQAFAEALASADILTNGTKVGMKPLENESLVDISLLHPGLLVTECVYNPHMTKLLQQAQQAGCKTIDGYGMLLWQGAEQFTLWTGKDFPLEYVKQVMGFGAE. 291
4 -102.0003tnl_A mol:protein length:315 Shikimate dehydrogenase  ali model follow..  36  17.NAMTNKITERITGHT-ELIGLIATPIRHSLSPTMHNEAFAKLGLDYVYLAFEVGDKELKDVVQGFRAMNLRGWNVSMPNKTNIHKYLDKLSPAAELVGAVNTVVNDDGVLTGHITDGTGYMRALKEA-GHDIIGKKMTICGAGGAATAICIQAALDGVKEISIFNRKYANAEKTVEKINSKTDCKAQLEQLRKEIAESVIFTNATGVGMKPFEGETLLSADMLRPELIVSDVVYKPTKTRLLEIAEEQGCQTLNGLGMMLWQGAKAFEIWTHKEMPVDYIKEILF..... 309
5 -101.0003t4e_A mol:protein length:312 Quinate/shikimate dehydrogenase  ali model follow..  34  11.NLYFQSNAMDVTAKY-ELIGLMAYPIRHSLSPEMQNKALEKAGLPYTYMAFEVDNTTFASAIEGLKALKMRGTGVSMPNKQLACEYVDELTPAAKLVGAINTIVNDDGYLRGYNTDGTGHIRAIKES-GFDMRGKTMVLLGAGGAATAIGAQAAIEGIKEIKLFNRKFEKAVAFAKRVNENTDCVVTVHAFTEALASADILTNGTKVGMKPLENESLIDVSLLRPELLVTECVYNPHMTKLLQQAQQAGCKTIDGYGMLLWQGAEQFELWTGKAFPLDYVKQVM...... 302
6 -101.0003fbt_A mol:protein length:282 chorismate mutase and shikimate 5-dehydrogena  ali model follow..  32  1...........MSLNT-SIYGLIGEKLGHSHSSYIHKLIFEKVGIKGIYNLFEVPKEKLKESVDTFKIIKCGGLNVTIPYKVEVMKELYEISEKARKIGAVNTLKFSREGISGFNTDYIGFGKMLSKF-RVEIKNNICVVLGSGGAARAVLQYLKDNFAKDIYVVTRNPEKTSEIYGEFK-----VISYDELSNL--KGDVIINCTPKGMYPKEGESPVDKEVVAKFSSAVDLIYNPVETLFLKYARESGVKAVNGLYMLVSQAAASEEIWNDISIDEIIVDEIFEVLEEK 271
7 -99.7005dzs_A mol:protein length:276 Shikimate dehydrogenase (NADP(+))  ali model follow..  31  2.................NFFGLVGEKLSHSVSPQIHKRVFEILNIESAYKNFEISKEDISKLDGAIKLLGIQGVNVTVPYKERIMKYLDFISPEAKRIGAVNTILLRENMLYGYNTDYFGLDSMFKMA-NIDVQGKVAVILGTGGASKAALTYFIDSGIEKLYVSTRKKDDKKLLNSKAI-------LIDYEELKHIKGDIILNATPVGMYPNVGISPVSKSIIQNFDILIDLIYNPGETEFLRIGNSMGKKTCDGLYMLVGQAIKSQEIWQDTKIDNSILDVIYNELKLE 267
8 -99.7003don_A mol:protein length:277 Shikimate dehydrogenase  ali model follow..  41  3...................FAVIGNPISHSLSPLMHHANFQSLNLENTYEAINVPVNQFQDIKKIISEKSIDGFNVTIPHKERIIPYLDDINEQAKSVGAVNTVLVKDGKWIGYNTDGIGYVNGLKQI-YEGIEDAYILILGAGGASKGIANELYKIVRPTLTVANRTMSRFNNWSLNIN-----KINLSHAESHLDEFDIIINTTPAGMNGNTD-SVISLNRLASHTLVSDIVYNPYKTPILIEAEQRGNPIYNGLDMFVHQGAESFKIWTNLEPDIKAMKNIVIQKLKG 267
9 -96.8001wxd_A mol:protein length:263 shikimate 5-dehydrogenase  ali model follow..  37  2.................LRFAVLGHPVAHSLSPAMHAFALESLGLEGSYEAWDTPLEALPGRLKEVRR-AFRGVNLTLPLKEAALAHLDWVSPEAQRIGAVNTVLQVEGRLFGFNTDAPGFLEALKAGGI----KGPALVLGAGGAGRAVAFALREAGL-EVWVWNRTPQRALALAEEFGLRAVPL-------EKAREARLLVNATRVGLEDP-SASPLPAELFPEEGAAVDLVYRPLWTRFLREAKAKGLKVQTGLPMLAWQGALAFRLWTGLLPDPSGMEEAARRAL.. 261
10 -96.3002hk9_A mol:protein length:275 Shikimate dehydrogenase  ali model follow..  36  1..........MINAQT-QLYGVIGFPVKHSLSPVFQNALIRYAGLNAVYLAFEINPEELKKAFEGFKALKVKGINVTVPFKEEIIPLLDYVEDTAKEIGAVNTVKFENGKAYGYNTDWIGFLKSLKSL-IPEVKEKSILVLGAGGASRAVIYALVKEGA-KVFLWNRTKEKAIKLAQKFP-----LEVVNSPEEVIDKVQVIVNTTSVGLKDE-DPEIFNYDLIKKDHVVVDIIYKE--TKLLKKAKEKGAKLLDGLPMLLWQGIEAFKIWNGCEVPYSVAERSVRDLR.. 268
11 -95.8001npy_A mol:protein length:271 Hypothetical shikimate 5-dehydrogenase-like p  ali model follow..  28  1..........MINKDTQLCMSLSGRP--SNFGTTFHNYLYDKLGLNFIYKAFTT--QDIEHAIKGVRALGIRGCAVSMPFKETCMPFLDEIHPSAQAIESVNTIVNDNGFLRAYNTDYIAIVKLIEKYH--LNKNAKVIVHGSGGMAKAVVAAFKNSGFEKLKIYARNVKTGQYLAALYGYAYINSLE-------NQQADILVNVTSIGMKGGKEEMDLPKAFIDNASVAFDVVAMPVETPFIRYAQARGKQTISGAAVIVLQAVEQFELYTHQRPSDELIAEAAAFARTK 270
12 -86.2003u62_A mol:protein length:253 Shikimate dehydrogenase  ali model follow..  33  3...................FCIIGYPVRHSISPRLYNEYFKRAGMNHSYGMEEIPPESFDTEIRRILE-EYDGFNATIPHKERVMRYVEPSED-AQRIKAVNCVF----RGKGYNTDWVGVVKSLEGVE----VKEPVVVVGAGGAARAVIYALLQMGVKDIWVVNRTIERAKALDFPVK-----IFSLDQLDEVVKKAKSLFNTTSVGMKG--EELPVSDDSLKNLSLVYDVIYFD--TPLVVKARKLGVKIIKGNLMFYYQAMENLKIWGIYDEEVF............ 244
13 -84.6002nlo_A mol:protein length:302 Shikimate dehydrogenase  ali model follow..  27  1MSGGSEQLYFQGAMNDSILLGLIGQGLDLSRTPAMHEAEGLAQGRATVYRRIDASGQDLKTLLDAALYLGFNGLNITHPYKQAVLPLLDEVSEQATQLGAVNTVVDATGHTTGHNTDVSGFGRGMEEGLP-NAKLDSVVQVGAGGVGNAVAYALVTHGVQKLQVADLDTSRAQALADVINNAAVVGVDARGIEDVIAAADGVVNATPMGMPAHPG-TAFDVSCLTKDHWVGDVVYMPIETELLKAARALGCETLDGTRMAIHQAVDAFRLFTGLEPDVSRMRETFLS.... 295
14 -81.6004p4g_A mol:protein length:277 Shikimate 5-dehydrogenase AroE (5-dehydroshik  ali model follow..  26  4...............GPKKAGVLGSPIAHSRSPQLHLAAYRALGLDWTYERIECGAAELPVVVGGFGP-EWVGVSVTMPGKFAALRFADERTARADLVGSANTLVRTPHGWRADNTDIDGVAGALGA------AAGHALVLGSGGTAPAAVVGLAELGVTDITVVARNSDKAARLVDLGTRTRFCAFDSGGLADAVAAAEVLVSTIPAEVAAGY------AGTLAAIPVLLDAIYDPWPTPLAAAVGSAGGRVISGLQMLLHQAFAQVEQFTGLPAPREAMTCALAALDLD 271
15 -79.9004k28_A mol:protein length:269 Shikimate dehydrogenase family protein  ali model follow..  25  1..........MIRGST-ELVAIVGSPIAQVKSPQNFNTWFNHNNCNLAMLPIDLHEAALDSFADTLRGWNLRGCVVTVPYKQALANRVDGLSERAAALGSINVIRREDGRLLGDNVDGAGFLGAAHKH-GFEPAGKRALVIGCGGVGSAIAYALAEAGIASITLCDPSTARMGAVCELLGN-GFPGLTVSTQFSGLEDFDLVANASPVGMGTRAELSAALLATLQPDTLVADVVTSPEITPLLNRARQVGCRIQTGPEMAFAQLG-HLGAFMGVTP............... 266
16 -76.8004xij_A mol:protein length:275 Shikimate 5-dehydrogenase  ali model follow..  26  1..........MAMVPDSRKAAVLGSPITHSRSPQLHLAAYRALGLSWTYERIECTAEQLPGLVSALGP-EWVGLSVTMPGKFAALEFADQRTDRAQLVGSANTLVMPTGGWRADNTDVDGVTGALGT------AGDSALVIGSGGTAPAAVVALAELGVQRITIVARDEGKASRLVDLARRGGWCDIGGAALADAVASADAAVSTIPADAAA------VYADALARVPRVLDAIYDPWPTPLAQAVEAAGGEAINGLQMLLNQAFAQVEQFTGMPAPKEAMRAAL...... 268
17 -75.9002gpt_A mol:protein length:523 3-dehydroquinate dehydratase/ shikimate 5-deh  ali model follow..  35  234................TKVYGIIGKPVSHSKSPIVHNQAFKSVDFNGVYVHLLV--DNLVSFLQAYSSSDFAGFSCTIPHKEAALQCCDEVDPLAKSIGAVNTILRSDGKLLGYNTDCIGSISAIEDGLSSPLASKTVVVIGAGGAGKALAYGAKEKGA-KVVIANRTYERALELAEAIGGKALSLTDLDNYH--PEDGMVLANTTSMGMQPNVEETPISKDALKHYALVFDAVYTPRITRLLREAEESGAITVSGSEMFVRQAYEQFEIFTGLPAPKELYWQIMSKYGSR 517
18 -74.6004fsh_A mol:protein length:271 Shikimate dehydrogenase  ali model follow..  26  2...............KLKSFGVFGNPIKHSKSPLIHNACFKKLGFLGHYRPILLPLESH--IKNEFLHLGLSGANVTLPFKERAFQVCDKIKGIALECASINTLVLENDELVGYNTDALGFYLSLKHQ-----NYQNALILGSGGSAKALACGLKKQGL-KVSVLNRSPRGLDFFQRLGCDCFM--------EPPKSAFDLIINATSASLNNELPNKEVLKGYFKEAKLAYDLAYGF-LTPFLALAKELKIPFQDGKDMLIYQASLSFEKFSASQIPYSKAFEVMRSVFLE 265
19 -74.4004foo_A mol:protein length:271 Shikimate dehydrogenase  ali model follow..  28  2...............KLKSFGVFGNPIKHSKSPLIHNACFKELRFLGHYHPILLPLESH--IKSEFLHLGLSGANVTLPFKERAFQVCDKIKGIALECGAVNTLVLENDELVGYNTDALGFYLSLKQK-----NYQNALILGAGGSAKALACELKKQGL-QVSVLNRSSRGLDFFQRLGCDCFM--------EPPKSAFDLIINATSASLHNELPNKEVLKGYFKEGKLAYDLAYGF-LTPFLSLAKELKTPFQDGKDMLIYKAALSFEKFSASQIPYSKAFEVMRSVFLE 265
20 -71.6003pwz_A mol:protein length:272 Shikimate dehydrogenase 3  ali model follow..  30  1...............MSDRYAVIGRPINHTKSPLIHGLFAQASNQQLEYGAIEGSLDDFEAQVLQFRSEGGKGMNITAPFKLRAFELADRRSERAQLARAANALKFEDGRIVAENFDGIGLLRDIEENLGEPLRNRRVLLLGAGGAVRGALLPFLQAGPSELVIANRDMAKALALRNELDHSRLRISRYEALEG--QSFDIVVNATSASLTA--DLPPLPADVLGEAALAYELAYGKGLTPFLRLAREQGQRLADGVGMLVEQAAEAFAWWRGVRPDTRAVINQLTIPLE. 272
21 -65.1004omu_A mol:protein length:283 Shikimate dehydrogenase  ali model follow..  35  4...................YVVFGNPIGHSKSPLIHRLFAEQTGQDLEYATLLAPLDEFSDCARGFFKQG-SGGNVTVPFKEEAFRLCDSLTPRARRAGAVNTLSLADGTLQGDNTDGAGLVRDLTVNAGVELAGKRILILGAGGAVRGVLEPILAHKPQSLVIANRTVEKAEQLAREFDELGP--VVASGFAWLQEPVDVIINATSASLAGELPPIADSL-VEAGRTVCYDMMYGKEPTPFCQWATKLGAKVLDGLGMLAEQAAEAFFIWRGVRPDTAPVLAELRRQLAR 273
22 -65.0003pgj_A mol:protein length:302 Shikimate dehydrogenase  ali model follow..  31  7LGTENLYFQSNAMASQIDQYAVFGNPINHSKSPFIHTLFARQTQQSMIYTAQCVPVDGFTEAAKHFFAQGGRGCNVTVPFKEEAYRFADRLTERARLAGAVNTLKLDDGEILGDNTDGEGLVQDLLAQ-QVLLKGATILLIGAGGAARGVLKPLLDQQPASITVTNRTFAKAEQLAELVAAYGE--VKAQAFEQLKQSYDVIINSTSASLDG--ELPAIDPVIFSSRSVCYDMMYGKGYTVFNQWARQHGCQAIDGLGMLVGQAAESFMLWRGLRPGTKQILRELRKNLE. 293
23 -64.1001nyt_A mol:protein length:271 Shikimate 5-dehydrogenase  ali model follow..  35  4...................YAVFGNPIAHSKSPFIHQQFAQQLNIEHPYGRVLAPINDFINTLNAFFSAGGKGANVTVPFKEEAFARADELTERAALAGAVNTLMLEDGRLLGDNTDGVGLLSDLER-LSFIRPGLRILLIGAGGASRGVLLPLLSLDC-AVTITNRTVSRAEELAKLFAHTSIQALSMDELEG--HEFDLIINATSSGISG--DIPAIPSSLIHPGIYCYDMFYQKGKTPFLAWCEQRGSRNADGLGMLVAQAAHAFLLWHGVLPDVEPVIKQLQEELS. 271
24 -62.4001p74_A mol:protein length:272 Shikimate 5-dehydrogenase  ali model follow..  29  4...................YAVWGNPIAQSKSPLIQNKLAAQTHQTMEYIAKLGDLDAFEQQLLAFFEEGAKGCNITSPFKERAYQLADEYSQRAKLAEACNTLKLDDGKLYADNTDGIGLVTDL-QRLNWLRPNQHVLILGAGGATKGVLLPLLQAQQ-NIVLANRTFSKTKELAERFQPYNIQAVSMDSIPL--QTYDLVINATSAGLSG--GTASVDAEILKLGSAFYDMQYAKTDTPFIALCKSLGLNVSDGFGMLVAQAAHSFHLWRGVMPDFVSVYEQLKKAM.. 271
25 -15.6003oj0_A mol:protein length:144 Glutamyl-tRNA reductase  ali model follow..  18  8.........................................................................................................................IPSIVYDIVRKNGGNKILLVGNGMLASEIAPYFSYPQY-KVTVAGRNIDHVRAFAEKYE---YEYVLINDIDSLIKNNDVIITATS------SKTPIVEERSLMPGKLFIDL.......................................................... 109
26 -15.0004q39_A mol:protein length:260 PYLD, pyrrolysine synthase  ali model follow..  15  12......NINMQLQKADSAVQEVTGLDIK--------GICKALYGTFSSSEKVGIVPGNFSASLHAI--TQYFGFDSFVTDMPDVSGYYEAVQNGAEIILMADDAHNLKNGKMANNQPCTGIIYAEIASRYLKADSKDVLVVGLGKVGFPGAEHLVQKDF-RVYGYDADETLLERATSNLGIIPF-------DPANPKKFSIIFEATPCA-------NTIPEAVLSENCVLSQLIAEPLGI---------------GTASMLYS............................ 258
27 -14.6003ic5_A mol:protein length:118 putative saccharopine dehydrogenase  ali model follow..  16  6.......................................................................................................................................WNICVVGAGKIGQMIAALLKTSSNYSVTVADHDLAALAVLNRGVATKQVDAKDEAGLAKALGGFDAVISAAPFFLTPI-----IAKAAKAAGAHYFDLTEDVAATNAVRALVEDS......................................... 116
28 -14.2001gpj_A mol:protein length:404 GLUTAMYL-TRNA REDUCTASE  ali model follow..  19  47............TSNRVEVYASGARDRAEELGDLIHDDAWVKRGSEAVRHLFRVA----------------SGLESMMVGEQEILRQVKKAYDRAARLGTLDEALKREETRISEGAVSIGSAAELAERELGSLHDKTVLVVGAGEMGKTVAKSLVDRGVRAVLVANRTYERAVELARDLGGE---AVRFDELVDHLARSDVVVSATAA-IHVDDVREALRKRDRRSPILIIDIVRTIDDLRIARENLERRRKEIPKVEKLIEEELSTVEEELEKLKERRLVADV....... 334
29 -13.7004n7r_A mol:protein length:472 Glutamyl-tRNA reductase 1, chloroplastic  ali model follow..  17  117...........................................................KDATQHIFEVS-AGLDSLVLGEGQILAQVKQVVKVGQGVNGFGRNISRTETNIASGAVSVSSAAALMKLPQSSNVSARMCVIGAGKMGKLVIKHLMAKGCTKVVVVNRSEERVSAIREEMPGIEIIYRPLDEMLACASEADVVFTSTALFLKEHVENLPQASPEVGGLRHFVDIVYNVDDLKVVAANKEDRMRKAMEAQTIITEESTQFEAWRDSLETVPTIKKL....... 378
30 -12.5003d4o_A mol:protein length:293 Dipicolinate synthase subunit A  ali model follow..  16  114.............................................................................................KKTNRTLVKLMERDDIAIYNSIPTAEGTIMMAIQHTDFTIHGANVAVLGLGRVGMSVARKFAALGA-KVKVGARESDLLARIAEM----GMEPFHISKAAQELRDVDVCINTIPALVVTAN------LAEMPSHTFVIDLASKPGGTDF-RYAEKRGIKALLVPGL------------PGIVAPKRILADVLVKLLAE 291
31 -12.5001lu9_A mol:protein length:287 Methylene Tetrahydromethanopterin Dehydrogena  ali model follow..  14  1.......................SKKLLFQFDTDATPSVFDDGGADHITGYGNVTPDNVGAYVDGTTAIFVGGGDMAA-----GERVFEAVKKRFFGPFRVSCMLDSN----GSNTTAAAGVALVVKAAGGSVKGKKAVVLAGGPVGMRSAALLAGEGA-EVVLCGRKLDKAQAAADSVNKRAAETADDASRAEAVKGAHFVFTAGAIGLELLPQAAWQNESSIE---IVADY.......................................................... 220
32 -11.6002rir_A mol:protein length:300 Dipicolinate synthase, A chain  ali model follow..  17  109........................................................................................AYLENIAAQAKRKLVKLFERDDIAIYNSTVEGTIMLAIQHTDYTIHGSQVAVLGLGRTGMTIARTFAALGA-NVKVGARSSAHLARI----TEMGLVPFHTDELKEHVKDIDICINTIPSMILNQT------LSSMTPKTLILDLASRPGGTDF-KYAEKQGIKALLAPGL---PGIVA-------KTAGQILANVLSKLLAE 293
33 -10.9003abi_A mol:protein length:365 Putative uncharacterized protein PH1688  ali model follow..  15  11.......................................................................................................................................MKVLILGAGNIGRAIAWDLKDE--FDVYIGDVNNENLEKVKEFATPLKVDASNFDKLVEVMKEFELVIGAL-----PGFLGFKSIKAAIKSKVDMVDVSFMPENPLELRDAEKAQVTIVFDAGF................................ 128
34 -9.7404m54_A mol:protein length:339 Putative ornithine cyclodeaminase  ali model follow..  15  77..............................................................ISGIKWIGSKHDNPSMERASGVIILNDPET-------NYPIAVMEASLISSMRT---AAVSVIAAKHLAKKGFKDLTIIGCGLIGDKQLQSMLEDHIERVFVYDQFSEACARFVDRWQQQEINFIATENAKEAVSNGEVVITCTV------TDQPYIEYDWLQKGAFISNISIMDVHKEVFIKADK........................................... 253
35 -9.5803l6e_A mol:protein length:235 Oxidoreductase, short-chain dehydrogenase/red  ali model follow..  13  1....................................................................................................................................MSLGHIIVTGAGGLGRALTIGLVERGH-QVSMMGRRYQRLQQQELDLAHHEDVDVAFAAAVEWGGLPELVLHCAGTGEFGPVGVYTAEQIRRVMESNLVSTIL--VAQQTVRLIGERGGVLANVLSSAAQVGKANESLYCASKWGMRGFLESLRAELKD 168
36 -9.5001cyd_A mol:protein length:244 CARBONYL REDUCTASE  ali model follow..  14  1................................................................................................................................MKLNFSGLRALVTGAGGIGRDTVKALHASGA-KVVAVTRTNSDLVSLAKECPGIEPVCVDLGDWDGGIGPVDLLVNNAALVIMQPFLEVTKEAFDRSFSVNLRSVFQVSQMVARDMINRGVPGSIVNVSSMVAHVTFPNLITYSSTKGAMTMLTKAMAMELGP 169
37 -9.4201pr9_A mol:protein length:244 L-XYLULOSE REDUCTASE  ali model follow..  19  1................................................................................................................................MELFLAGRRVLVTGAGGIGRGTVQALHATGA-RVVAVSRTQADLDSLVRECPGIEPVCVDLGDWEGSVGPVDLLVNNAAVALLQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLIARGVPGAIVNVSSQCSQRAVTNHSVYCSTKGALDMLTKVMALELGP 169
38 -9.3702axq_A mol:protein length:467 Saccharopine dehydrogenase  ali model follow..  19  4.............................................................................................................................SGHIEGRHMGKNVLLLGSGFVAQPVIDTLAANDDINVTVACRTLANAQALAKGSKAISLDVTDDSALDKVLADNDVVISLIPYTFHPNVVKSAIRTKT-----VVTSSYISPALRELEPEIVKAGITVMNEIGL................................ 135

FFAS is supported by the NIH grant R01-GM087218-01
8 2 9 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Jaroszewski L, Ye Y, Godzik A. The interplay of fold recognition and experimental structure determination in structural genomics. Curr Opin Struct Biol. 2004 Jun;14(3):307-12.