current user: public




2eggA
Query: 2egg_A mol:protein length:297 Shikimate 5-dehydrogenase, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290
# Score Template Links and tools%idFirst MGSSSSGENLYFQGHMEKVYGLIGFPVEHSLSPLMHNDAFARLGIPARYHLFSVEPGQVGAAIAGVRALGIAGVNVTIPHKLAVIPFLDEVDEHARRIGAVNTIINNDGRLVGYNTDGLGYVQALEEEMNITLDGKRILVIGAGGGARGIYFSLLSTAAERIDMANRTVEKAERLVREGDERRSAYFSLAEAETRLAEYDIIINTTSVGMHPRVEVQPLSLERLRPGVIVSDIIYNPLETKWLKEAKARGARVQNGVGMLVYQGALAFEKWTGQWPDVNRMKQLVIEALRRLast
1 -105.0002egg_A mol:protein length:297 Shikimate 5-dehydrogenase  ali model  100  1MGSSSSGENLYFQGHMEKVYGLIGFPVEHSLSPLMHNDAFARLGIPARYHLFSVEPGQVGAAIAGVRALGIAGVNVTIPHKLAVIPFLDEVDEHARRIGAVNTIINNDGRLVGYNTDGLGYVQALEEEMNITLDGKRILVIGAGGGARGIYFSLLSTAAERIDMANRTVEKAERLVREGDERRSAYFSLAEAETRLAEYDIIINTTSVGMHPRVEVQPLSLERLRPGVIVSDIIYNPLETKWLKEAKARGARVQNGVGMLVYQGALAFEKWTGQWPDVNRMKQLVIEALRR 291
2 -97.5003pwz_A mol:protein length:272 Shikimate dehydrogenase 3  ali model follow..  31  1...............MSDRYAVIGRPINHTKSPLIHGLFAQASNQQLEYGAIEGSLDDFEAQVLQFRSEGGKGMNITAPFKLRAFELADRRSERAQLARAANALKFEDGRIVAENFDGIGLLRDIEENLGEPLRNRRVLLLGAGGAVRGALLPFLQAGPSELVIANRDMAKALALRNELDHSRLRISRYEALE--GQSFDIVVNATSASLTA--DLPPLPADVLGEAALAYELAYGKGLTPFLRLAREQGARLADGVGMLVEQAAEAFAWWRGVRPDTRAVINQLTIPLE. 272
3 -96.0003don_A mol:protein length:277 Shikimate dehydrogenase  ali model follow..  40  2..................KFAVIGNPISHSLSPLMHHANFQSLNLENTYEAINVPVNQFQDIKKIISEKSIDGFNVTIPHKERIIPYLDDINEQAKSVGAVNTVLVKDGKWIGYNTDGIGYVNGLKQ-IYEGIEDAYILILGAGGASKGIANELYKIVRPTLTVANRTMSRFNNWSLNINK-----INLSHAESHLDEFDIIINTTPAGMNGNTD-SVISLNRLASHTLVSDIVYNPYKTPILIEAEQRGNPIYNGLDMFVHQGAESFKIWTNLEPDIKAMKNIVIQKLKG 267
4 -95.4001nvt_A mol:protein length:287 Shikimate 5`-dehydrogenase  ali model follow..  47  5..........SMINAKTKVIGLIGHPVEHSFSPIMHNAAFKDKGLNYVYVAFDVLPENLKYVIDGAKALGIVGFNVTIPHKIEIMKYLDEIDKDAQLIGAVNTIKIEDGKAIGYNTDGIGARMALEEE-IGRVKDKNIVIYGAGGAARAVAFELA--KDNNIIIANRTVEKAEALAKEIAEKFGEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVAFKIWTGVEPNIEVMKNAIIDKITK 287
5 -94.5003fbt_A mol:protein length:282 chorismate mutase and shikimate 5-dehydrogena  ali model follow..  31  1............MSLNTSIYGLIGEKLGHSHSSYIHKLIFEKVGIKGIYNLFEVPKEKLKESVDTFKIIKCGGLNVTIPYKVEVMKELYEISEKARKIGAVNTLKFSREGISGFNTDYIGFGKMLSK-FRVEIKNNICVVLGSGGAARAVLQYLKDNFAKDIYVVTRNPEKTSEIYGEFKVISYDELS--------LKGDVIINCTPKGMYPKEGESPVDKEVVAKFSSAVDLIYNPVETLFLKYARESGVKAVNGLYMLVSQAAASEEIWNDISIDEIIVDEIFEVLEEK 271
6 -93.5002hk9_A mol:protein length:275 Shikimate dehydrogenase  ali model follow..  36  1...........MINAQTQLYGVIGFPVKHSLSPVFQNALIRYAGLNAVYLAFEINPEELKKAFEGFKALKVKGINVTVPFKEEIIPLLDYVEDTAKEIGAVNTVKFENGKAYGYNTDWIGFLKSLKS-LIPEVKEKSILVLGAGGASRAVIYALVKEGA-KVFLWNRTKEKAIKLAQKFP-----LEVVNSPEEVIDKVQVIVNTTSVGLKDEDP-EIFNYDLIKKDHVVVDIIYKE--TKLLKKAKEKGAKLLDGLPMLLWQGIEAFKIWNGCEVPYSVAERSVRDLR.. 268
7 -93.3003tnl_A mol:protein length:315 Shikimate dehydrogenase  ali model follow..  34  14FQSNAMTNKIERITGHTELIGLIATPIRHSLSPTMHNEAFAKLGLDYVYLAFEVGDKELKDVVQGFRAMNLRGWNVSMPNKTNIHKYLDKLSPAAELVGAVNTVVNDDGVLTGHITDGTGYMRALKEA-GHDIIGKKMTICGAGGAATAICIQAALDGVKEISIFNRKDDFYANAEKTVEKINFDIEDHEQLRKEIAESVIFTNATGVGMKPFEGETLPSADMLRPELIVSDVVYKPTKTRLLEIAEEQGCQTLNGLGMMLWQGAKAFEIWTHKEMPVDYIKEILF..... 309
8 -92.8001vi2_A mol:protein length:300 Shikimate 5-dehydrogenase 2  ali model follow..  33  3..........LDVTAKYELIGLMAYPIRHSLSPEMQNKALEKAGLPFTYMAFEVDNDSFPGAIEGLKALKMRGTGVSMPNKQLACEYVDELTPAAKLVGAINTIVNDDGYLRGYNTDGTGHIRAIKES-GFDIKGKTMVLLGAGGASTAIGAQGAIEGLKEIKLFNRRFDKALAFAQRVNENTTDLADQQAFAEALASADILTNGTKVGMKPLENESLNDISLLHPGLLVTECVYNPHMTKLLQQAQQAGCKTIDGYGMLLWQGAEQFTLWTGKDFPLEYVKQVMGFGAE. 291
9 -92.6003pgj_A mol:protein length:302 Shikimate dehydrogenase  ali model follow..  31  7LGTENLYFQSNAMASQIDQYAVFGNPINHSKSPFIHTLFARQTQQSMIYTAQCVPVDGFTEAAKHFFAQGGRGCNVTVPFKEEAYRFADRLTERARLAGAVNTLKKDDGEILGDNTDGEGLVQDLLAQ-QVLLKGATILLIGAGGAARGVLKPLLDQQPASITVTNRTFAKAEQLAELVAAYG--EVKAQAFEQLKQSYDVIINSTSASLDG--ELPAIDPVIFSSRSVCYDMMYGKGYTVFNQWARQHGCQAIDGLGMLVGQAAESFMLWRGLRPGTKQILRELRKNLE. 293
10 -92.1001nyt_A mol:protein length:271 Shikimate 5-dehydrogenase  ali model follow..  34  1................METYAVFGNPIAHSKSPFIHQQFAQQLNIEHPYGRVLAPINDFINTLNAFFSAGGKGANVTVPFKEEAFARADELTERAALAGAVNTLMREDGRLLGDNTDGVGLLSDLER-LSFIRPGLRILLIGAGGASRGVLLPLLSLDC-AVTITNRTVSRAEELAKLFAHTG-SIQALSMDELEGHEFDLIINATSSGISG--DIPAIPSSLIHPGIYCYDMFYQKGKTPFLAWCEQRGSKNADGLGMLVAQAAHAFLLWHGVLPDVEPVIKQLQEELS. 271
11 -91.8003t4e_A mol:protein length:312 Quinate/shikimate dehydrogenase  ali model follow..  34  10.ENLYFQSNAMDVTAKYELIGLMAYPIRHSLSPEMQNKALEKAGLPYTYMAFEVDNTTFASAIEGLKALKMRGTGVSMPNKQLACEYVDELTPAAKLVGAINTIVNDDGYLRGYNTDGTGHIRAIKES-GFDMRGKTMVLLGAGGAATAIGAQAAIEGIKEIKLFNRKFEKAVAFAKRVNENTTDLADQHAFTEALASADILTNGTKVGMKPLENESLGDVSLLRPELLVTECVYNPHMTKLLQQAQQAGCKTIDGYGMLLWQGAEQFELWTGKAFPLDYVKQVMGFT... 305
12 -90.7001wxd_A mol:protein length:263 shikimate 5-dehydrogenase  ali model follow..  37  1................MLRFAVLGHPVAHSLSPAMHAFALESLGLEGSYEAWDTPLEALPGRLKEVRR-AFRGVNLTLPLKEAALAHLDWVSPEAQRIGAVNTVLQVEGRLFGFNTDAPGFLEALKAGG-----KGPALVLGAGGAGRAVAFALREAGL-EVWVWNRTPQRALALAEEFGLRAVPL-------EKAREARLLVNATRVGLEDP-SASPLPAELFPEEGAAVDLVYRPLWTRFLREAKAKGLKVQTGLPMLAWQGALAFRLWTGLLPDPSGMEEAARRAL.. 261
13 -89.7001p74_A mol:protein length:272 Shikimate 5-dehydrogenase  ali model follow..  28  1................MDLYAVWGNPIAQSKSPLIQNKLAAQTHQTMEYIAKLGDLDAFEQQLLAFFEEGAKGCNITSPFKERAYQLADEYSQRAKLAEACNTLKKDDGKLYADNTDGIGLVTDLQR-LNWLRPNQHVLILGAGGATKGVLLPLLQAQ-QNIVLANRTFSKTKELAERFQPYG-NIQAVSMDSIPLQTYDLVINATSAGLSG--GTASVDAEILKLGSAFYDMQYKGTDTPFIALCKSLGLTNVDGFGMLVAQAAHSFHLWRGVMPDFVSVYEQLKKAM.. 271
14 -89.3002nlo_A mol:protein length:302 Shikimate dehydrogenase  ali model follow..  27  1MSGGSEQLYFQGAMNDSILLGLIGQGLDLSRTPAMHEAEGLAQGRATVYRRIDASGQDLKTLLDAALYLGFNGLNITHPYKQAVLPLLDEVSEQATQLGAVNTVVIATGHTTGHNTDVSGFGRGMEEG-LPNAKLDSVVQVGAGGVGNAVAYALVTHGVQKLQVADLDTSRAQALADVINNAAVVGVDARGIEDVIAAADGVVNATPMGMPAHPG-TAFDVSCLTKDHWVGDVVYMPIETELLKAARALGCETLDGTRMAIHQAVDAFRLFTGLEPDVSRMRETFLS.... 295
15 -88.4001npy_A mol:protein length:271 Hypothetical shikimate 5-dehydrogenase-like p  ali model follow..  28  1...........MINKDTQLMSLSGRP--SNFGTTFHNYLYDKLGLNFIYKAFTT--QDIEHAIKGVRALGIRGCAVSMPFKETCMPFLDEIHPSAQAIESVNTIVNDNGFLRAYNTDYIAIVKLIEKYH--LNKNAKVIVHGSGGMAKAVVAAFKNSGFEKLKIYARNVKTGQYLAALYGYAYIN-------SLENQQADILVNVTSIGMKGGKEEMDLPKAFIDNASVAFDVVAMPVETPFIRYAQARGKQTISGAAVIVLQAVEQFELYTHQRPSDELIAEAAAFARTK 270
16 -86.1003phg_A mol:protein length:269 Shikimate dehydrogenase  ali model follow..  28  2...............KLKSFGVFGNPIKHSKSPLIHNACFLTFQKELRFLGHYHPLPLESHIKSEFLHLGLSGANVTLPFKERAFQVCDKIKGIALECGAVNTLVLENDELVGYNTDALGFYLSLKQK-----NYQNALILGAGGSAKALACELKKQGL-QVSVLNRSSRGLDFFQR--------LGCDCFMEPPKSAFDLIINATSASLHNELPLNKVLKGYFKEGKLAYDLAYGF-LTPFLSLAKELKTPFQDGKDMLIYQAALSFEKFSASQIPYSKAFEVMRSVF.. 263
17 -83.7003u62_A mol:protein length:253 Shikimate dehydrogenase  ali model follow..  33  2..................KFCIIGYPVRHSISPRLYNEYFKRAGMNHSYGMEEIPPESFDTEIRRILE-EYDGFNATIPHKERVMRYVE-PSEDAQRIKAVNCVF----RGKGYNTDWVGVVKSLEGVE----VKEPVVVVGAGGAARAVIYALLQMGVKDIWVVNRTIERAKALDFPVK-----IFSLDQLDEVVKKAKSLFNTTSVGMKG--EELPVSDDSLKNLSLVYDVIYFD--TPLVVKARKLGVKIIKGNLMFYYQAMENLKIWGIYDEEVF---KEVFGEVLK 253
18 -78.3002gpt_A mol:protein length:523 3-dehydroquinate dehydratase/ shikimate 5-deh  ali model follow..  34  218IKDLLDLYNFRRIGPDTKVYGIIGKPVSHSKSPIVHNQAFKSVDFNGVYVHLLV--DNLVSFLQAYSSSDFAGFSCTIPHKEAALQCCDEVDPLAKSIGAVNTILRSDGKLLGYNTDCIGSISAIEDGLSSPLASKTVVVIGAGGAGKALAYGAKEKGA-KVVIANRTYERALELAEAIGGKALSLTDLDN--YHPEDGMVLANTTSMGMQPNVEETPISKDALKHYALVFDAVYTPRITRLLREAEESGAITVSGSEMFVRQAYEQFEIFTGLPAPKELYWQIMSKYGSR 517
19 -17.0003oj0_A mol:protein length:144 Glutamyl-tRNA reductase  ali model follow..  18  8.........................................................................................................................IPSIVYDIVRKNGGNKILLVGNGMLASEIAPYFSYPQY-KVTVAGRNIDHVRAFAEKYE---YEYVLINDIDSLIKNNDVIITATS------SKTPIVEERSLMPGKLFIDL.......................................................... 109
20 -15.6003ic5_A mol:protein length:118 putative saccharopine dehydrogenase  ali model follow..  15  6.......................................................................................................................................WNICVVGAGKIGQMIAALLKTSSNYSVTVADHDLAALAVLNRMVATKQVDAKDEAGLAKALGGFDAVISAAPFFLT-----PIIAKAAKAAGAHYFDLTEDVAATNAVRALVEDS......................................... 116
21 -14.5001gpj_A mol:protein length:404 GLUTAMYL-TRNA REDUCTASE  ali model follow..  18  44.........LLQTSNRVEVYASGARDRAEELGDLIHDDAWVKRGSEAVRHLFRVA----------------SGLESMMVGEQEILRQVKKAYDRAARLGTLDEAAREETRISEGAVSIGSAAVELAERELGSLHDKTVLVVGAGEMGKTVAKSLVDRGVRAVLVANRTYERAVELARDLG---GEAVRFDELVDHLARSDVVVSATAA-IHVDDVREALRKRDRRSPILIIDIANPRDVEEGVENIEDVEVRTIDDLRVIARENLER------RRKEIPKVEKLIEEELST 317
22 -13.8003abi_A mol:protein length:365 Putative uncharacterized protein PH1688  ali model follow..  14  9.....................................................................................................................................RHMKVLILGAGNIGRAIAWDLKDE---DVYIGDVNNENLEKVKEFATPLKVDASNFDKLVEVMKEFELVIGALPGFLG-----FKSIKAAIKSKVDMVDVSFMPENPELRDEAEKAQVTIVFDAGF................................ 128
23 -13.7001e5l_A mol:protein length:450 SACCHAROPINE REDUCTASE  ali model follow..  20  1....................................................................................................................................MATKSVLMLGSGFVTRPTLDVLTDSGI-KVTVACRTLESAKKLSAGVQHSTPISLDVNDLDAEVAKHDLVISLIPYTFH-----ATVIKSAIRQKKHVVTTSYSPAMMELDQAAKDAGITVMNEIGL................................ 125
24 -13.5002axq_A mol:protein length:467 Saccharopine dehydrogenase  ali model follow..  18  4.............................................................................................................................SGHIEGRHMGKNVLLLGSGFVAQPVIDTLAANDDINVTVACRTLANAQALAKPSGSKALDVTDDSALDKVLADNDVVISLIPYTFH-----PNVVKSAIRTKTDVVTSSYISPALELEPEIVKAGITVMNEIGL................................ 135
25 -12.0003d4o_A mol:protein length:293 Dipicolinate synthase subunit A  ali model follow..  15  114.............................................................................................KKTNRTLVKLMERDDIAIYNSIPTAEGTIMMAIQHTDFTIHGANVAVLGLGRVGMSVARKFAALGA-KVKVGARESDLLARIAEM----GMEPFHISKAAQELRDVDVCINTIPALVVTANVL-----AEMPSHTFVIDLASKPGGTDF-RYAEKRGIKALLVPGLPGIVAPKT---------AGRILADVLVKLLAE 291
26 -12.0001lu9_A mol:protein length:287 Methylene Tetrahydromethanopterin Dehydrogena  ali model follow..  14  1.......................SKKLLFQFDTDATPSVFDDGGADHITGYGNVTPDNVGAYVDGTTAIFVGGGDMAA-----GERVFEAVKKRFFGPFRVSCMLDSN----GSNTTAAAGVALVVKAAGGSVKGKKAVVLAGGPVGMRSAALLAGEGA-EVVLCGRKLDKAQAAADSVNKRAAETADDASRAEAVKGAHFVFTAGAIGL................................................................................. 200
27 -11.2002rir_A mol:protein length:300 Dipicolinate synthase, A chain  ali model follow..  17  110.........................................................................................YLENIAAQAKRKLVKLFERDDIAIYNSTVEGTIMLAIQHTDYTIHGSQVAVLGLGRTGMTIARTFAALGA-NVKVGARSSAHLARITEM----GLVPFHTDELKEHVKDIDICINTIPSMILNQTVL-----SSMTPKTLILDLASRPGGTDF-KYAEKQGIKALLAPGL................................ 270
28 -9.3803l6e_A mol:protein length:235 Oxidoreductase, short-chain dehydrogenase/red  ali model follow..  13  1....................................................................................................................................MSLGHIIVTGAGGLGRALTIGLVERGH-QVSMMGRRYQRLQQQELLLGNAVIGIVAFAAAVEWGGLPELVLHCAGTGEFGPVGVYTAEQIRRVMESNLVSTIL--VAQQTVRLIGERGGVLANVLSSAAQVGKANESLYCASKWGMRGFLESLRAELKD 168
29 -9.2602i99_A mol:protein length:312 Mu-crystallin homolog  ali model follow..  16  88.............................................................................VPSHQATVLLFEPSN------GTLLAVM-DGNVITAKRT---AAVSAIATKFLKPPSSEVLCILGAGVQAYSHYEIFTEFSFKEVRIWNRTKENAEKFADTVQ---GEVRVCSSVQEAVAGADVIITVTL------ATEPILFGEWVKPGAHINAVASRPDWRELDDELMKEAVLYVDSQEAALKESGD......................... 259
30 -9.0702ehd_A mol:protein length:234 Oxidoreductase, short-chain dehydrogenase/red  ali model follow..  14  1..................................................................................................................................MEGMKGAVLITGASGIGEATARLLHAKGY-RVGLMARDEKRLQALAAELEGALPLPGDVREMEEAFGELSALVNNAGVGVMKPVHELTLEEWRLVLDTNLTGAFLGIRHAVPALLRRGGG-TIVNVGSLAGKNPFKGGAAYNASKFGLLGLAGAAMLDLRE 170

FFAS is supported by the NIH grant R01-GM087218-01
6 1 0 7 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.