current user: public




Query: 2avp_A mol:protein length:70 synthetic consensus TPR protein, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70
# Score Template Links and tools%idFirst GSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSLast
1 -50.0002avp_A mol:protein length:70 synthetic consensus TPR protein  ali model  100  1GSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS 70
2 -42.5001na3_A mol:protein length:91 designed protein CTPR2  ali model follow..  92  7NSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNN 76
3 -41.0002fo7_A mol:protein length:136 SYNTHETIC CONSENSUS TPR PROTEIN  ali model follow..  98  67RSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS 136
4 -40.6003ma5_A mol:protein length:100 Tetratricopeptide repeat domain protein  ali model follow..  23  5EDPFTRYALAQEHLKHDNASRALALFEELVETDPDYVGTYYHLGKLYERLDRTDDAIDTYAQGIEVARE. 73
5 -39.8003kd7_A mol:protein length:125 CTPR390  ali model follow..  78  41NNASAWYNLGNAYYKQGDYQKAIEYYQKALELDPNNAKAWYRRGNAYYKQGDYQKAIEDYQKALELDPNN 110
6 -39.5002kck_A mol:protein length:112 TPR repeat  ali model follow..  30  4QNPEEYYLEGVLQYDAGNYTESIDLFEKAIQLDPEESKYWLMKGKALYNLERYEEAVDCYNYVINVIED. 72
7 -39.5001na0_A mol:protein length:125 designed protein CTPR3  ali model follow..  91  41NNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNN 110
8 -38.8002kat_A mol:protein length:115 uncharacterized protein  ali model follow..  26  17DNMLLRFTLGKTYAEHEQFDAALPHLRAALDFDPTYSVAWKWLGKTLQGQGDRAGARQAWESGLAAAQS. 85
9 -38.1004gcn_A mol:protein length:127 Protein STI-1  ali model follow..  34  6DAAIAEKDLGNAAYKQKDFEKAHVHYDKAIELDPSNITFYNNKAAVYFEEKKFAECVQFCEKAVEVGRET 75
10 -38.0002wqh_A mol:protein length:125 CTPR3Y3  ali model follow..  88  41NNAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNN 110
11 -36.6004xi0_A mol:protein length:202 Magnetosome protein MamA  ali model follow..  31  73NHFMASYRKGAVLLKIKQYKLALPVLEAVVAAAPADARAYYLLGLAYDGDEQLEKGIEAMQKAVDLDPEE 142
12 -36.2002q7f_A mol:protein length:243 YrrB protein  ali model follow..  30  151NDTEARFQFGMCLANEGMLDEALSQFAAVTEQDPGHADAFYNAGVTYAYKENREKALEMLDKAIDIQPDH 220
13 -36.1002kc7_A mol:protein length:99 bfr218_protein  ali model follow..  36  2....DQLKTIKELINQGDIENALQALEEFLQTEPGKDEAYYLMGNAYRKLGDWQKALNNYQSAIELNPDS 68
14 -35.8003asd_A mol:protein length:200 MamA  ali model follow..  30  108INFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELDEGA 177
15 -35.3003as8_A mol:protein length:186 Magnetosome protein MamA  ali model follow..  32  108VNFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAYSYEQMGSHEEALPHFKKANELDERS 177
16 -35.2001w3b_A mol:protein length:388 UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUC  ali model follow..  40  65LLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDL 134
17 -34.9001wm5_A mol:protein length:208 Neutrophil cytosol factor 2  ali model follow..  24  41.HSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGN 109
18 -34.8003vtx_A mol:protein length:184 MamA  ali model follow..  39  71TSAEAYYILGSANFMIDEKQAAIDALQRAIALNTVYADAYYKLGLVYDSMGEHDKAIEAYEKTISIKPG. 139
19 -34.6001hxi_A mol:protein length:121 PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5  ali model follow..  21  49EREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLLSQPQ. 117
20 -34.4003uq3_A mol:protein length:258 Heat shock protein STI1  ali model follow..  27  171EDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAE. 239
21 -34.4002pl2_A mol:protein length:217 Hypothetical conserved protein TTC0263  ali model follow..  28  3TAEQNPLRLGVQLYALGRYDAALTLFERALKENPQDPEALYWLARTQLKLGLVNPALENGKTLVARTPRY 72
22 -34.4003asg_A mol:protein length:186 MamA  ali model follow..  30  108INFNVRFRLGVALKNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELDEG. 176
23 -34.3002vgy_A mol:protein length:148 CHAPERONE SYCD  ali model follow..  27  19DTLEQLYSLAFNQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYEEGAVMDIKE 88
24 -34.3002vgx_A mol:protein length:148 CHAPERONE SYCD  ali model follow..  27  19DTLEQLYSLAFNQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYSYGAVMDIKE 88
25 -33.9004j8d_A mol:protein length:175 Hsc70-interacting protein  ali model follow..  24  73RLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAARDLALACKLDYDE 142
26 -33.6004uzy_A mol:protein length:651 FLAGELLAR ASSOCIATED PROTEIN  ali model follow..  14  417AYIPGLMAMASIYWDMELYSNVEKIFRQSAEFCSEHEVWKLNVAHTFFQDNHYKEAIRYYEPVVKKNADN 487
27 -33.6003urz_A mol:protein length:208 Uncharacterized protein  ali model follow..  24  52ISSKLATELALAYKKNRNYDKAYLFYKELLQKAPNNVDCLEACAEMQVCRGQEKDALRMYEKILQLEADN 121
28 -33.6003wxx_A mol:protein length:151 AcrH  ali model follow..  28  24DTLEQLYTLGFNQYHAGKHDEAHKIFQALCVLDHYEARFFLGLGACRQALGQFRLAIDSYSYGAMMDLQE 93
29 -33.3003ieg_A mol:protein length:359 DnaJ homolog subfamily C member 3  ali model follow..  20  1ADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIALKMDF 70
30 -33.2003hym_B mol:protein length:330 Cell division cycle protein 16 homolog  ali model follow..  28  234KWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDD 303
31 -33.2003r9a_B mol:protein length:328 Peroxisomal targeting signal 1 receptor  ali model follow..  31  209NDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKS 278
32 -33.1004cgu_A mol:protein length:112 TPR REPEAT-CONTAINING PROTEIN ASSOCIATED WITH  ali model follow..  28  3SQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTA 72
33 -33.0002xcb_A mol:protein length:142 REGULATORY PROTEIN PCRH  ali model follow..  27  16DTLEQLYALGFNQYQAGKWDDAQKIFQALCMLDHYDARYFLGLGACRQSLGLYEQALQSYSYGALMDINE 85
34 -33.0001xnf_A mol:protein length:275 Lipoprotein nlpI  ali model follow..  30  41ERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYLGIYLTQAGNFDAAYEAFDSVLELDPTY 110
35 -33.0005dse_A mol:protein length:837 Tetratricopeptide repeat protein 7B  ali model follow..  25  756THVKSMQRLALILHQLGRYSLAEKILRDAVQVNSTAHEVWNGLGEVLQAQGNDAAATECFLTALELEASS 825
36 -32.9004XNH Entity 1(prereleased)  ali follow..  20  89ASPICCHVLGIYMRNTKEYKESIKWFTAALNNGSTNKQIYRDLATLQSQIGDFKNALVSRKKYWEAFLGY 158
37 -32.9003fwv_A mol:protein length:128 Hsc70/Hsp90-organizing protein  ali model follow..  36  4..ALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYIVNQAAVYFEKGDYNKCRELCEKAIEVGREN 71
38 -32.8004ui9_J mol:protein length:620 CELL DIVISION CYCLE PROTEIN 16 HOMOLOG  ali model follow..  28  443KWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDD 512
39 -32.8004r7s_A mol:protein length:257 Tetratricopeptide repeat protein  ali model follow..  25  73KNITILENRASLYTELGETEKALNDYNTLLIENPEHQEALYCRGLLYIQLQNYMWAEQDFDKILEVNEKS 142
40 -32.8003fp2_A mol:protein length:537 TPR repeat-containing protein YHR117W  ali model follow..  37  24.YAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDH 92
41 -32.7001hh8_A mol:protein length:213 NEUTROPHIL CYTOSOL FACTOR 2  ali model follow..  24  35PHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGN 104
42 -32.6002xpi_A mol:protein length:597 ANAPHASE-PROMOTING COMPLEX SUBUNIT CUT9  ali model follow..  28  514PWAATWANLGHAYRKLKMYDAAIDALNQGLLLSTNDANVHTAIALVYLHKKIPGLAITHLHESLAISPNE 583
43 -32.3004gco_A mol:protein length:126 Protein STI-1  ali model follow..  17  45ENAILYSNRAACLTKLMEFQRALDDCDTCIRLDSKFIKGYIRKAACLVAMREWSKAQRAYEDALQVDPSN 114
44 -31.9002vyi_A mol:protein length:131 SGTA PROTEIN  ali model follow..  35  44ANAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPAYSKAYGRMGLALSSLNKHVEAVAYYKKALELDPDN 113
45 -31.9003cvq_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  24  204DDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGG 273
46 -31.9003cv0_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  24  204DDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGG 273
47 -31.8001fch_A mol:protein length:368 PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR  ali model follow..  31  249NDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKS 318
48 -31.8003u4t_A mol:protein length:272 TPR repeat-containing protein  ali model follow..  28  106TRLDMYGQIGSYFYNKGNFPLAIQYMEKQIRPTTTDPKVFYELGQAYYYNKEYVKADSSFVKVLELKPNI 175
49 -31.7004nrh_B mol:protein length:178 Chaperone SycD  ali model follow..  21  58EDLEKVYKEGYHAYLDKDYAKSITVFRWLVFFNPFVSKFWFSLGASLHMSEQYSQALHAYGVTAVLRDKD 127
50 -31.7004rg6_A mol:protein length:560 Cell division cycle protein 27 homolog  ali model follow..  32  301NSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRH 370
51 -31.4004hnw_A mol:protein length:863 N-terminal acetyltransferase A complex subuni  ali model follow..  20  89ASPICCHVLGIYMRNTKEYKESIKWFTAALNNGSTNKQIYRDLATLQSQIGDFKNALVSRKKYWEAFLGY 158
52 -31.4004i17_A mol:protein length:228 hypothetical protein  ali model follow..  21  41.DSVTAYNCGVCADNIKKYKEAADYFDIAIKKNYNLANAYIGKSAAYRDMKNNQEYIATLTEGIKAVPGN 109
53 -31.4004cgw_A mol:protein length:117 RNA POLYMERASE II-ASSOCIATED PROTEIN 3  ali model follow..  29  50ANALLPANRAMAYLKIQKYEEAEKDCTQAILLDGSYSKAFARRGTARTFLGKLNEAKQDFETVLLLEP.. 117
54 -31.3001elw_A mol:protein length:118 TPR1-DOMAIN OF HOP  ali model follow..  24  36HNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANN 105
55 -31.3004eqf_A mol:protein length:365 PEX5-related protein  ali model follow..  32  245EDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREAVSNFLTALSLQRKS 314
56 -31.2002vq2_A mol:protein length:225 PUTATIVE FIMBRIAL BIOGENESIS AND TWITCHING MO  ali model follow..  27  6QVSNIKTQLAMEYMRGQDYRQATASIEDALKSDPKNELAWLVRAEIYQYLKVNDKAQESFRQALSIKPDS 75
57 -31.1002hr2_A mol:protein length:159 Hypothetical protein  ali model follow..  27  55FDAFCHAGLAEALAGLRSFDEALHSADKALELNQDEGKLWYSRALALDGLGRGAEAMPEFKKVVEMIEE. 134
58 -31.0002gw1_A mol:protein length:514 Mitochondrial precursor proteins import recep  ali model follow..  37  4KYALALKDKGNQFFRNKKYDDAIKYYNWALELKED-PVFYSNLSACYVSVGDLKKVVEMSTKALELKPDY 72
59 -30.7004kvm_A mol:protein length:734 N-terminal acetyltransferase A complex subuni  ali model follow..  21  42EHGESLAIKGILLHSLGNTKEGYDNVRLGLRNDVGSGVCWHIFGLISRADKDYVQAAKCYINAHKLEKNN 111
60 -30.7005a31_X mol:protein length:599 ANAPHASE-PROMOTING COMPLEX SUBUNIT 7  ali model follow..  28  337QHAEPWVVSGCHSFYSKRYSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAIRLAPCR 406
61 -30.6004cgv_A mol:protein length:136 RNA POLYMERASE II-ASSOCIATED PROTEIN 3  ali model follow..  22  46YNPVLPTNRASAYFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVLELEPNN 115
62 -30.6001elr_A mol:protein length:131 TPR2A-DOMAIN OF HOP  ali model follow..  36  2KQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRE. 70
63 -30.5002lni_A mol:protein length:133 Stress-induced-phosphoprotein 1  ali model follow..  25  42KDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSC 111
64 -30.4003gyz_A mol:protein length:151 Chaperone protein ipgC  ali model follow..  17  34DMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKND 103
65 -30.4001zu2_A mol:protein length:158 Mitochondrial import receptor subunit TOM20-3  ali model follow..  28  34LDADNLTRWGGVLLELSQIQEAITKFEEALLIDPKKDEAVWCIGNAYTSFAFFDLATQFFQQAVDEQPDN 124
66 -30.3004ga0_A mol:protein length:150 E3 SUMO-protein ligase RanBP2  ali model follow..  25  29QKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTDKAVECYRRSVELNPTQ 98
67 -30.1002ho1_A mol:protein length:252 Type 4 fimbrial biogenesis protein PilF  ali model follow..  34  29EARDAYIQLGLGYLQRGNTEQAKVPLRKALEIDPSSADAHAALAVVFQTEMEPKLADEEYRKALASDSRN 98
68 -30.0004ga1_A mol:protein length:150 E3 SUMO-PROTEIN LIGASE RANBP2  ali model follow..  24  29QKSMKGFYFAKLYMEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTDKAVECYRRSVELNPMQ 98
69 -30.0004ga2_A mol:protein length:150 E3 SUMO-PROTEIN LIGASE RANBP2  ali model follow..  25  29QKSIKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTDKAVECYRRSVELNPTQ 98
70 -29.9002bug_A mol:protein length:140 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model follow..  21  47SNAIYYGNRSLAYLRTECYGYALNDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHD 116
71 -29.5003upv_A mol:protein length:126 Heat shock protein STI1  ali model follow..  27  36EDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEV 105
72 -29.4003ks2_A mol:protein length:151 Chaperone protein ipgC  ali model follow..  17  30DMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKND 99
73 -29.2005a31_C mol:protein length:597 CELL DIVISION CYCLE PROTEIN 23 HOMOLOG  ali model follow..  30  363RYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRPND 432
74 -29.0001a17_A mol:protein length:166 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model follow..  21  45SNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHD 114
75 -29.0004buj_B mol:protein length:1436 SUPERKILLER PROTEIN 3  ali model follow..  27  6SDIKQLLKEAKQELTNRDYEETIEISEKVLKLDPDNYFAHIFLGKALSSLPNLERATNHYVSAAKLVPDN 84

FFAS is supported by the NIH grant R01-GM087218-01
8 5 8 4 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zmasek CM, Zhang Q, Ye Y, Godzik A. Surprising complexity of the ancestral apoptosis network. Genome Biol. 2007 Oct 24;8(10):R226 [Epub ahead of print]