current user: public

Query: 2avp_A mol:protein length:70 synthetic consensus TPR protein, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70
1 -47.4002avp_A mol:protein length:70 synthetic consensus TPR protein  ali model  100  1GSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS 70
2 -41.3003ma5_A mol:protein length:100 Tetratricopeptide repeat domain protein  ali model follow..  22  5EDPFTRYALAQEHLKHDNASRALALFEELVETDPDYVGTYYHLGKLYERLDRTDDAIDTYAQGIEVAREE 74
3 -41.2001na3_A mol:protein length:91 designed protein CTPR2  ali model follow..  92  7NSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNN 76
5 -39.7002kat_A mol:protein length:115 uncharacterized protein  ali model follow..  26  17DNMLLRFTLGKTYAEHEQFDAALPHLRAALDFDPTYSVAWKWLGKTLQGQGDRAGARQAWESGLAAAQS. 85
6 -39.2002kck_A mol:protein length:112 TPR repeat  ali model follow..  30  4QNPEEYYLEGVLQYDAGNYTESIDLFEKAIQLDPEESKYWLMKGKALYNLERYEEAVDCYNYVINVIEDE 73
7 -38.1001na0_A mol:protein length:125 designed protein CTPR3  ali model follow..  92  7NSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNN 76
11 -36.9003fwv_A mol:protein length:128 Hsc70/Hsp90-organizing protein  ali model follow..  35  2KQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYIVNQAAVYFEKGDYNKCRELCEKAIEVGREN 71
12 -36.6002lni_A mol:protein length:133 Stress-induced-phosphoprotein 1  ali model follow..  25  42KDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSC 111
15 -36.3002kc7_A mol:protein length:99 bfr218_protein  ali model follow..  36  2....DQLKTIKELINQGDIENALQALEEFLQTEPGKDEAYYLMGNAYRKLGDWQKALNNYQSAIELNPDS 68
16 -36.0002l6j_A mol:protein length:111 TPR repeat-containing protein associated with  ali model follow..  28  2SQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTA 71
18 -35.6003as8_A mol:protein length:186 Magnetosome protein MamA  ali model follow..  32  108VNFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAYSYEQMGSHEEALPHFKKANELDERS 177
19 -35.6003asg_A mol:protein length:186 MamA  ali model follow..  30  108INFNVRFRLGVALKNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELDEGA 177
20 -35.3002q7f_A mol:protein length:243 YrrB protein  ali model follow..  30  151NDTEARFQFGMCLANEGMLDEALSQFAAVTEQDPGHADAFYNAGVTYAYKENREKALEMLDKAIDIQPDH 220
21 -35.2003asd_A mol:protein length:200 MamA  ali model follow..  30  108INFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELDEGA 177
22 -34.9003ieg_A mol:protein length:359 DnaJ homolog subfamily C member 3  ali model follow..  20  1ADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIALKMDF 70
23 -34.9003uq3_A mol:protein length:258 Heat shock protein STI1  ali model follow..  28  137EKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNF 206
24 -34.5003r9a_B mol:protein length:328 Peroxisomal targeting signal 1 receptor  ali model follow..  31  209NDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKS 278
25 -34.5003hym_B mol:protein length:330 Cell division cycle protein 16 homolog  ali model follow..  28  234KWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDD 303
26 -34.2003k9i_A mol:protein length:117 BH0479 protein  ali model follow..  18  25DLAECYLGLGSTFRTLGEYRKAEAVLANGVKQFPNHQALRVFYAMVLYNLGRYEQGVELLLKIIAETSDD 94
27 -34.0001xnf_A mol:protein length:275 Lipoprotein nlpI  ali model follow..  30  41ERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYLGIYLTQAGNFDAAYEAFDSVLELDPTY 110
28 -33.9001wm5_A mol:protein length:208 Neutrophil cytosol factor 2  ali model follow..  24  40PHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGN 109
30 -33.8003fp2_A mol:protein length:537 TPR repeat-containing protein YHR117W  ali model follow..  37  23AYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDH 92
34 -33.5002hr2_A mol:protein length:159 Hypothetical protein  ali model follow..  27  55FDAFCHAGLAEALAGLRSFDEALHSADKALHYFNRRGEAVYSRALALDGLGRGAEAMPEFKKVVEMIEER 135
36 -33.5001tjc_A mol:protein length:108 Prolyl 4-hydroxylase alpha-1 subunit  ali model follow..  33  4.TAEDSFELGKVAYTEADYYHTELWMEQALRQLDDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEH 79
37 -33.5003u4t_A mol:protein length:272 TPR repeat-containing protein  ali model follow..  28  106TRLDMYGQIGSYFYNKGNFPLAIQYMEKQIRPTTTDPKVFYELGQAYYYNKEYVKADSSFVKVLELKPNI 175
39 -33.3003sz7_A mol:protein length:164 Hsc70 cochaperone (SGT)  ali model follow..  30  43ANPIYLSNRAAAYSASGQHEKAAEDAELATVVDPKYSKAWSRLGLARFDMADYKGAKEAYEKGIEAEGNG 112
40 -33.2003urz_A mol:protein length:208 Uncharacterized protein  ali model follow..  24  52ISSKLATELALAYKKNRNYDKAYLFYKELLQKAPNNVDCLEACAEMQVCRGQEKDALRMYEKILQLEADN 121
41 -33.1003cvq_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  30  170NDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPG. 238
42 -33.0003upv_A mol:protein length:126 Heat shock protein STI1  ali model follow..  29  4..AEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNF 71
43 -32.9003cv0_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  30  170NDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPG. 238
44 -32.5002pl2_A mol:protein length:217 Hypothetical conserved protein TTC0263  ali model follow..  28  3TAEQNPLRLGVQLYALGRYDAALTLFERALKENPQDPEALYWLARTQLKLGLVNPALENGKTLVARTPRY 72
46 -32.1002gw1_A mol:protein length:514 Mitochondrial precursor proteins import recep  ali model follow..  38  4KYALALKDKGNQFFRNKKYDDAIKYYNWALELKED-PVFYSNLSACYVSVGDLKKVVEMSTKALELKPD. 71
49 -31.0002ho1_A mol:protein length:252 Type 4 fimbrial biogenesis protein PilF  ali model follow..  34  29EARDAYIQLGLGYLQRGNTEQAKVPLRKALEIDPSSADAHAALAVVFQTEMEPKLADEEYRKALASDSRN 98
50 -31.0003ks2_A mol:protein length:151 Chaperone protein ipgC  ali model follow..  17  30DMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKND 99
51 -30.9003gyz_A mol:protein length:151 Chaperone protein ipgC  ali model follow..  17  34DMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKND 103
52 -30.8003v6p_A mol:protein length:442 dHax3  ali model follow..  11  363EQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNGGGRPALESIVAQLSRPDPALAALTND 432
54 -30.1003q47_B mol:protein length:137 STIP1 homology and U box-containing protein 1  ali model follow..  29  9..AQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQS 76
55 -29.7002fi7_A mol:protein length:265 type 4 fimbrial biogenesis protein PilF  ali model follow..  34  42EARDAYIQLGLGYLQRGNTEQAKVPLRKALEIDPSSADAHAALAVVFQTEMEPKLADEEYRKALASDSRN 111
58 -29.0001zu2_A mol:protein length:158 Mitochondrial import receptor subunit TOM20-3  ali model follow..  28  34LDADNLTRWGGVLLELSQIQEAITKFEEALLIDPKKDEAVWCIGNAYTSFAFFDLATQFFQQAVDEQPDN 124
59 -28.8003v6t_A mol:protein length:499 dHax3  ali model follow..  11  404EQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNGGGRPALESIVAQLSRPDPALAALTND 473
60 -27.8003bee_A mol:protein length:93 Putative YfrE protein  ali model follow..  20  4VTATQLAAKATTLYYLHKTDEVSLLLEQALQLEPYNEAALSLIANDHFISFRFQEAIDTWVLLLDSNDPN 76
61 -27.6003rkv_A mol:protein length:162 putative peptidylprolyl isomerase  ali model follow..  23  63..IPLYANMSQCYLNIGDLHEAEETSSEVLKREETNEKALFRRAKARIAAWKLDEAEEDLKLLLRNHPAA 130
62 -27.5002dba_A mol:protein length:148 Smooth muscle cell associated protein-1, isof  ali model follow..  30  63DQAVLHRNRAACHLKLEDYDKAETEASKAIEKDGGDVKALYRRSQALEKLGRLDQAVLDLQRCVSLEPKN 132
64 -26.8003ffl_A mol:protein length:167 Anaphase-promoting complex subunit 7  ali model follow..  17  55QKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKPSEIEVKYKLAECYTVLKQDKDAIAILDGIPSRQRT. 148
65 -26.7003ro3_A mol:protein length:164 G-protein-signaling modulator 2  ali model follow..  36  87VEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIRIGEGRACWSLGNAYTALGNHDQAMHFAEKHLEISRE. 161
66 -26.7003ro2_A mol:protein length:338 G-protein-signaling modulator 2  ali model follow..  26  3ASCLELALEGERLCKSGDCRAGVSFFEAAVQVGTEDSAIYSQLGNAYFYLHDYAKALEYHHHDLTLART. 75
67 -26.7003ly7_A mol:protein length:372 Transcriptional activator cadC  ali model follow..  20  269NLSIIYQIKAVSALVKGKTDESYQAINTGIDLEMSWL-NYVLLGKVYEMKGMNREAADAYLTAFNLRPGA 337
68 -26.5002fbn_A mol:protein length:198 70 kDa peptidylprolyl isomerase, putative  ali model follow..  35  82..ISCNLNLATCYNKNKDYPKAIDHASKVLKIDKNNVKALYKLGVANMYFGFLEEAKENLYKAASLNPNN 149
69 -26.5002e2e_A mol:protein length:177 Formate-dependent nitrite reductase complex n  ali model follow..  31  42QNSEQWALLGEYYLWQNDYSNSLLAYRQALQLRGENAELYAALATVLYYQASTAQTRAMIDKALALDSNE 114
70 -26.1001nzn_A mol:protein length:126 Fission protein Fis1p  ali model follow..  15  33VSKSTQFEYAWCLRYNDDIRKGIVLLEELLPKGEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQN 107
71 -26.0003mkr_A mol:protein length:291 Coatomer subunit epsilon  ali model follow..  20  198PTLLLLNGQAACHMAQGRWEAAEGVLQEALDKDSGHPETLINLVVLSQHLGKPPEVTNRYLSQLDAHRSH 268
72 -25.8001zbp_A mol:protein length:273 hypothetical protein VPA1032  ali model follow..  19  2.......TQWKNALSEGQLQQALELLIEAIKASPKDASLRSSFIELLCIDGDFERADEQLMQSIKLFPEY 64
73 -25.3003sf4_A mol:protein length:406 G-protein-signaling modulator 2  ali model follow..  26  7ASCLELALEGERLCKSGDCRAGVSFFEAAVQVLKTLSAIYSQLGNAYFYLHDYAKALEYHHHDLTLART. 79
75 -25.1001pc2_A mol:protein length:152 mitochondria fission protein  ali model follow..  15  30VSKSTQFEYAWCLKYNDDIRKGIVLLEELLPKGSKQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQN 104

FFAS is supported by the NIH grant R01-GM087218-01
6 5 7 5 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Grynberg M, Godzik A. NERD: a DNA processing-related domain present in the anthrax virulence plasmid, pXO1. Trends Biochem Sci. 2004 Mar;29(3):106-10.