current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 2avp_A mol:protein length:70 synthetic consensus TPR protein, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70
1 -50.0002avp_A mol:protein length:70 synthetic consensus TPR protein  ali model  100  1GSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS 70
2 -42.5001na3_A mol:protein length:91 designed protein CTPR2  ali model follow..  92  7NSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNN 76
4 -40.6003ma5_A mol:protein length:100 Tetratricopeptide repeat domain protein  ali model follow..  23  5EDPFTRYALAQEHLKHDNASRALALFEELVETDPDYVGTYYHLGKLYERLDRTDDAIDTYAQGIEVARE. 73
6 -39.5002kck_A mol:protein length:112 TPR repeat  ali model follow..  30  4QNPEEYYLEGVLQYDAGNYTESIDLFEKAIQLDPEESKYWLMKGKALYNLERYEEAVDCYNYVINVIED. 72
7 -39.5001na0_A mol:protein length:125 designed protein CTPR3  ali model follow..  91  41NNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNN 110
8 -38.8002kat_A mol:protein length:115 uncharacterized protein  ali model follow..  26  17DNMLLRFTLGKTYAEHEQFDAALPHLRAALDFDPTYSVAWKWLGKTLQGQGDRAGARQAWESGLAAAQS. 85
9 -38.1004gcn_A mol:protein length:127 Protein STI-1  ali model follow..  34  6DAAIAEKDLGNAAYKQKDFEKAHVHYDKAIELDPSNITFYNNKAAVYFEEKKFAECVQFCEKAVEVGRET 75
11 -36.6004xi0_A mol:protein length:202 Magnetosome protein MamA  ali model follow..  31  73NHFMASYRKGAVLLKIKQYKLALPVLEAVVAAAPADARAYYLLGLAYDGDEQLEKGIEAMQKAVDLDPEE 142
12 -36.2002q7f_A mol:protein length:243 YrrB protein  ali model follow..  30  151NDTEARFQFGMCLANEGMLDEALSQFAAVTEQDPGHADAFYNAGVTYAYKENREKALEMLDKAIDIQPDH 220
13 -36.1002kc7_A mol:protein length:99 bfr218_protein  ali model follow..  36  2....DQLKTIKELINQGDIENALQALEEFLQTEPGKDEAYYLMGNAYRKLGDWQKALNNYQSAIELNPDS 68
14 -35.8003asd_A mol:protein length:200 MamA  ali model follow..  30  108INFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELDEGA 177
15 -35.3003as8_A mol:protein length:186 Magnetosome protein MamA  ali model follow..  32  108VNFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAYSYEQMGSHEEALPHFKKANELDERS 177
17 -34.9001wm5_A mol:protein length:208 Neutrophil cytosol factor 2  ali model follow..  24  41.HSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGN 109
18 -34.8003vtx_A mol:protein length:184 MamA  ali model follow..  39  71TSAEAYYILGSANFMIDEKQAAIDALQRAIALNTVYADAYYKLGLVYDSMGEHDKAIEAYEKTISIKPG. 139
20 -34.4003uq3_A mol:protein length:258 Heat shock protein STI1  ali model follow..  27  171EDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAE. 239
21 -34.4002pl2_A mol:protein length:217 Hypothetical conserved protein TTC0263  ali model follow..  28  3TAEQNPLRLGVQLYALGRYDAALTLFERALKENPQDPEALYWLARTQLKLGLVNPALENGKTLVARTPRY 72
22 -34.4003asg_A mol:protein length:186 MamA  ali model follow..  30  108INFNVRFRLGVALKNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELDEG. 176
25 -33.9004j8d_A mol:protein length:175 Hsc70-interacting protein  ali model follow..  24  73RLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAARDLALACKLDYDE 142
27 -33.6003urz_A mol:protein length:208 Uncharacterized protein  ali model follow..  24  52ISSKLATELALAYKKNRNYDKAYLFYKELLQKAPNNVDCLEACAEMQVCRGQEKDALRMYEKILQLEADN 121
29 -33.3003ieg_A mol:protein length:359 DnaJ homolog subfamily C member 3  ali model follow..  20  1ADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIALKMDF 70
30 -33.2003hym_B mol:protein length:330 Cell division cycle protein 16 homolog  ali model follow..  28  234KWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDD 303
31 -33.2003r9a_B mol:protein length:328 Peroxisomal targeting signal 1 receptor  ali model follow..  31  209NDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKS 278
34 -33.0001xnf_A mol:protein length:275 Lipoprotein nlpI  ali model follow..  30  41ERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYLGIYLTQAGNFDAAYEAFDSVLELDPTY 110
35 -33.0005dse_A mol:protein length:837 Tetratricopeptide repeat protein 7B  ali model follow..  25  756THVKSMQRLALILHQLGRYSLAEKILRDAVQVNSTAHEVWNGLGEVLQAQGNDAAATECFLTALELEASS 825
37 -32.9003fwv_A mol:protein length:128 Hsc70/Hsp90-organizing protein  ali model follow..  36  4..ALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYIVNQAAVYFEKGDYNKCRELCEKAIEVGREN 71
39 -32.8004r7s_A mol:protein length:257 Tetratricopeptide repeat protein  ali model follow..  25  73KNITILENRASLYTELGETEKALNDYNTLLIENPEHQEALYCRGLLYIQLQNYMWAEQDFDKILEVNEKS 142
40 -32.8003fp2_A mol:protein length:537 TPR repeat-containing protein YHR117W  ali model follow..  37  24.YAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDH 92
43 -32.3004gco_A mol:protein length:126 Protein STI-1  ali model follow..  17  45ENAILYSNRAACLTKLMEFQRALDDCDTCIRLDSKFIKGYIRKAACLVAMREWSKAQRAYEDALQVDPSN 114
45 -31.9003cvq_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  24  204DDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGG 273
46 -31.9003cv0_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  24  204DDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGG 273
48 -31.8003u4t_A mol:protein length:272 TPR repeat-containing protein  ali model follow..  28  106TRLDMYGQIGSYFYNKGNFPLAIQYMEKQIRPTTTDPKVFYELGQAYYYNKEYVKADSSFVKVLELKPNI 175
49 -31.7004nrh_B mol:protein length:178 Chaperone SycD  ali model follow..  21  58EDLEKVYKEGYHAYLDKDYAKSITVFRWLVFFNPFVSKFWFSLGASLHMSEQYSQALHAYGVTAVLRDKD 127
50 -31.7004rg6_A mol:protein length:560 Cell division cycle protein 27 homolog  ali model follow..  32  301NSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRH 370
51 -31.4004hnw_A mol:protein length:863 N-terminal acetyltransferase A complex subuni  ali model follow..  20  89ASPICCHVLGIYMRNTKEYKESIKWFTAALNNGSTNKQIYRDLATLQSQIGDFKNALVSRKKYWEAFLGY 158
52 -31.4004i17_A mol:protein length:228 hypothetical protein  ali model follow..  21  41.DSVTAYNCGVCADNIKKYKEAADYFDIAIKKNYNLANAYIGKSAAYRDMKNNQEYIATLTEGIKAVPGN 109
55 -31.3004eqf_A mol:protein length:365 PEX5-related protein  ali model follow..  32  245EDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREAVSNFLTALSLQRKS 314
57 -31.1002hr2_A mol:protein length:159 Hypothetical protein  ali model follow..  27  55FDAFCHAGLAEALAGLRSFDEALHSADKALELNQDEGKLWYSRALALDGLGRGAEAMPEFKKVVEMIEE. 134
58 -31.0002gw1_A mol:protein length:514 Mitochondrial precursor proteins import recep  ali model follow..  37  4KYALALKDKGNQFFRNKKYDDAIKYYNWALELKED-PVFYSNLSACYVSVGDLKKVVEMSTKALELKPDY 72
59 -30.7004kvm_A mol:protein length:734 N-terminal acetyltransferase A complex subuni  ali model follow..  21  42EHGESLAIKGILLHSLGNTKEGYDNVRLGLRNDVGSGVCWHIFGLISRADKDYVQAAKCYINAHKLEKNN 111
63 -30.5002lni_A mol:protein length:133 Stress-induced-phosphoprotein 1  ali model follow..  25  42KDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSC 111
64 -30.4003gyz_A mol:protein length:151 Chaperone protein ipgC  ali model follow..  17  34DMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKND 103
65 -30.4001zu2_A mol:protein length:158 Mitochondrial import receptor subunit TOM20-3  ali model follow..  28  34LDADNLTRWGGVLLELSQIQEAITKFEEALLIDPKKDEAVWCIGNAYTSFAFFDLATQFFQQAVDEQPDN 124
66 -30.3004ga0_A mol:protein length:150 E3 SUMO-protein ligase RanBP2  ali model follow..  25  29QKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTDKAVECYRRSVELNPTQ 98
67 -30.1002ho1_A mol:protein length:252 Type 4 fimbrial biogenesis protein PilF  ali model follow..  34  29EARDAYIQLGLGYLQRGNTEQAKVPLRKALEIDPSSADAHAALAVVFQTEMEPKLADEEYRKALASDSRN 98
71 -29.5003upv_A mol:protein length:126 Heat shock protein STI1  ali model follow..  27  36EDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEV 105
72 -29.4003ks2_A mol:protein length:151 Chaperone protein ipgC  ali model follow..  17  30DMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKND 99

FFAS is supported by the NIH grant R01-GM087218-01
1 0 5 5 5 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.