current user: public




Query: 1zu2_A mol:protein length:158 Mitochondrial import receptor subunit TOM20-3, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst GPLGSMDTETEFDRILLFEQIRQDAENTYKSNPLDADNLTRWGGVLLELSQFHSISDAKQMIQEAITKFEEALLIDPKKDEAVWCIGNAYTSFAFLTPDETEAKHNFDLATQFFQQAVDEQPDNTHYLKSLEMTAKAPQLHAEAYKQGLGGSLast
1 -79.2001zu2_A mol:protein length:158 Mitochondrial import receptor subunit TOM20-3  ali model  100  1GPLGSMDTETEFDRILLFEQIRQDAENTYKSNPLDADNLTRWGGVLLELSQFHSISDAKQMIQEAITKFEEALLIDPKKDEAVWCIGNAYTSFAFLTPDETEAKHNFDLATQFFQQAVDEQPDNTHYLKSLEMTAKAPQLHAEAYKQGLGGS 152
2 -53.4002fo7_A mol:protein length:136 SYNTHETIC CONSENSUS TPR PROTEIN  ali model follow..  19  2..EAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGD----------YDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGD-----------YDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAYQKALELD 133
3 -50.0002pl2_A mol:protein length:217 Hypothetical conserved protein TTC0263  ali model follow..  14  5.EQNPLRLGVQLYALGRYDAALTLFERALKENPQDPEALYWLARTQLKLGL----------VNPALENGKTLVARTPRYLGGYMVLSEAYVALYRQAEDRERGKGYLEQALSVLKDAERVNPRYAPLHLQRGLVYALLGERDKALKQALALE 148
4 -49.7002wqh_A mol:protein length:125 CTPR3Y3  ali model follow..  18  9.AEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAWYNLGNAYYKQGD----------YDEAIEYYQKALELYPNNAEAWYNLGNAYYKQGD-----------YDEAIEYYQKALELYPNNAEAKQNLGNAKQKQG............. 125
5 -49.4001na0_A mol:protein length:125 designed protein CTPR3  ali model follow..  19  9.AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGD----------YDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGD-----------YDEAIEYYQKALELDPNNAEAKQNLGNAKQKQG............. 125
6 -49.1003kd7_A mol:protein length:125 CTPR390  ali model follow..  18  10..EAWKNLGNAYYKQGDYQKAIEYYQKALELDPNNASAWYNLGNAYYKQGD----------YQKAIEYYQKALELDPNNAKAWYRRGNAYYKQGD-----------YQKAIEDYQKALELDPNNAKAKQNLGNAKQKQG............. 125
7 -49.1003vtx_A mol:protein length:184 MamA  ali model follow..  16  6..TIYMDIGDKKRTKGDFDGAIRAYKKVLKADPNNVETLLKLGKTYMDIGLPNDAIESIDEKQAAIDALQRAIALNTVYADAYYKLGLVYDSMGE-----------HDKAIEAYEKTISIKPGFIRAYQSIGLAYEGKGLRDEAFKKALEKE 171
8 -49.0003asd_A mol:protein length:200 MamA  ali model follow..  14  9..VYYEDKGISHAKAGRYSQAVMLLEQVYDADAFDVDVALHLGIAYVKTGAVDRGTEQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALDNLGR-----------FDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEAFKKANELD 174
9 -48.7003asg_A mol:protein length:186 MamA  ali model follow..  14  9..VYYRDKGISHAKAGRYSQAVMLLEQVYDADAFDVDVALHLGIAYVKTGAVDRGTEQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALKNLGR-----------FDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEAFKKANELD 174
10 -48.7003as8_A mol:protein length:186 Magnetosome protein MamA  ali model follow..  13  9..VYYRDKGISHAKAGRYSEAVVMLEQVYDADAFDVEVALHLGIAYVKTGAVDRGTEQVQKYDLAVPLLVKVAEANPVNFNVRFRLGVALDNLGR-----------FDEAIDSFKIALGLRPNEGKVHRAIAYSYEQMGSHEEAFKKANELD 174
11 -48.6004xi0_A mol:protein length:202 Magnetosome protein MamA  ali model follow..  18  41.PEPLYQMGIALANLGDYQRAVTVFDKVLKLRPNHFMASYRKGAVLLKIKQ----------YKLALPVLEAVVAAAPADARAYYLLGLAYDGDEQ-----------LEKGIEAMQKAVDLDPEEIKYHQHLGFMNVRKDDHKTAFTKVMELE 173
12 -47.2002q7f_A mol:protein length:243 YrrB protein  ali model follow..  10  51.AIPYINFANLLSSVNELERALAFYDKALELDSSAATAYYGAGNVYVVKEMYKEAKDKLEQPKLALPYLQRAVELNENDTEARFQFGMCLANEGM-----------LDEALSQFAAVTEQDPGHADAFYNAGVTYAYKENREKALDKAIDIQ 217
13 -44.5003urz_A mol:protein length:208 Uncharacterized protein  ali model follow..  54.SKLATELALAYKKNRNYDKAYLFYKELLQKAPNNVDCLEACAEMQVCRGQ----------EKDALRMYEKILQLEADNLAANIFLGNYYYLTA----------EQEKKKLETDYKKLSSPTKMQYARYRDGLSKLFTTRYEKALQKVILRF 187
14 -41.9002hr2_A mol:protein length:159 Hypothetical protein  ali model follow..  15.....LSDAQRQLVAGEYDEAAANCRRAMEISHTDAFCHAGLAEALAGLRSFDEALHS---ADKALHYFNRRGELNQDEGKLWYSRALALDGLGR-----------GAEAMPEFKKVVEMIEERKGETPGKERMMEVAIDRIAQLGAS.... 159
15 -41.8001xnf_A mol:protein length:275 Lipoprotein nlpI  ali model follow..  17  6..RKSEVLAVPLQPTLQQEVILARMEQILATDDERAQLLYERGVLYDSLGL----------RALARNDFSQALAIRPDMPEVFNYLGIYLTQAGN-----------FDAAYEAFDSVLELDPTYNYAHLNRGIALYYGGRDKLALLAFYQDD 141
16 -41.5001w3b_A mol:protein length:388 UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUC  ali model follow..  14  67.AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGE-----------IWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAYLRALSLS 233
17 -41.1004j8d_A mol:protein length:175 Hsc70-interacting protein  ali model follow..  16  42..NEKKGAAIDALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQK----------PNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGH-----------WEEAARDLALACKLDYDEDASAMLREVQAQKIAEHRRKYE...... 166
18 -40.9001hxi_A mol:protein length:121 PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5  ali model follow..  14  18..ENPMEEGLSMLKLANLAEAALAFEAVCQKEPEREEAWRSLGLTQAENEK----------DGLAIIALNHARMLDPKDIAVHAALAVSHTNEHN-----------ANAALASLRAWLLSQPQYEQL......................... 121
19 -40.9003cv0_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  12  139..LNVQSEDFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNN----------YDSAAANLRRAVELRPDDAQLWNKLGATLANGNR-----------PQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLALVRAIYMQ 270
20 -40.9003cvq_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  13  139..LNVQSEDFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNN----------YDSAAANLRRAVELRPDDAQLWNKLGATLANGNR-----------PQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKRAIYMQ 270
21 -40.6004ga2_A mol:protein length:150 E3 SUMO-PROTEIN LIGASE RANBP2  ali model follow..  2......PLGSMRRSKADVERYIASVQGSTPSPRQKSIKGFYFAKLYYEAKE----------YDLAKKYICTYINVQERDPKAHRFLGLLYELEEN-----------TDKAVECYRRSVELNPTQKDLVLKIAELLCKNDVTDGRVERAAKLF 130
22 -40.6003r9a_B mol:protein length:328 Peroxisomal targeting signal 1 receptor  ali model follow..  12  59..EAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACETSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQ-----------SEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAFLEALNMQ 275
23 -40.5003fp2_A mol:protein length:537 TPR repeat-containing protein YHR117W  ali model follow..  12  310.PPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEADRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAFEDSAILA 492
24 -40.4003uq3_A mol:protein length:258 Heat shock protein STI1  ali model follow..  15  106..LTEHRTADILTKLRNAEKELKKAEAEAYVNPEKAEEARLEGKEYFTKSD----------WPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMS-----------FPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALDAARTKD 237
25 -40.4004ga0_A mol:protein length:150 E3 SUMO-protein ligase RanBP2  ali model follow..  2......PLGSMRRSKADVERYIASVQGSTPSPRQKSMKGFYFAKLYYEAKE----------YDLAKKYICTYINVQERDPKAHRFLGLLYELEEN-----------TDKAVECYRRSVELNPTQKDLVLKIAELLCKNDVTDGRLERAAKLF 130
26 -39.8004r7s_A mol:protein length:257 Tetratricopeptide repeat protein  ali model follow..  13  43...LLTNLGTIQRRQGKLQEALISYTSALSGHTKNITILENRASLYTELGE----------TEKALNDYNTLLIENPEHQEALYCRGLLYIQLQN-----------YMWAEQDFDKILEVNEKSVRARLGHAILEKMRGNYDESFNYLISEM 173
27 -39.8001fch_A mol:protein length:368 PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR  ali model follow..  12  99..EAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACEISGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQ-----------SEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEEALNMQ 315
28 -39.7004ga1_A mol:protein length:150 E3 SUMO-PROTEIN LIGASE RANBP2  ali model follow..  2......PLGSMRRSKADVERYIASVQGSTPSPRQKSMKGFYFAKLYMEAKE----------YDLAKKYICTYINVQERDPKAHRFLGLLYELEEN-----------TDKAVECYRRSVELNPMQKDLVLKIAELLCKNDVTDGRVERAAKLF 130
29 -39.5005dse_A mol:protein length:837 Tetratricopeptide repeat protein 7B  ali model follow..  15  691..QIWLHAAEVYIGIGKPAEATACTQEAANLFPMSHNVLYMRGQIAELRGS----------MDEARRWYEEALAISPTHVKSMQRLALILHQLGR-----------YSLAEKILRDAVQVNSTAHEVWNGLGEVLQAQGNDAAAFLTALELE 822
30 -39.4004eqf_A mol:protein length:365 PEX5-related protein  ali model follow..  12  100..EAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTSHQQDACEASGEFNRAIDAFNAALTVRPEDYSLWNRLGATLANGDR-----------SEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREAVSTALSLQ 311
31 -39.3004i17_A mol:protein length:228 hypothetical protein  ali model follow..  11  7.PNQLKNEGNDALNAKNYAVAFEKYSEYLKLTNNQDSVAYNCGVCADNIKK----------YKEAADYFDIAIKKNYNLANAYIGKSAAYRDMKN-----------NQEYIATLTEGIKAVPGNAIYYLKEGQKFQQAGNIEKAYKHATDVT 147
32 -39.1004hou_A mol:protein length:273 Interferon-induced protein with tetratricopep  ali model follow..  137...CEEGWALLKCGGKNYERAKACFEKVLEVDPENPESSAGYAISAYRLDGFKL--ATKNHKPFSLLPLRQAVRLNPDNGYIKVLLALKLQDEGQ-----------EAEGEKYIEEALANMSSQTYVFRYAAKFYRRKGSVDKALKKALQ.. 273
33 -39.0002gw1_A mol:protein length:514 Mitochondrial precursor proteins import recep  ali model follow..  13  304.SSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETDKNDFDKALKQYDLAIELENKLDGIYVGIAPLVGKATLLT--RNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAFEESADLA 479
34 -38.8002kat_A mol:protein length:115 uncharacterized protein  ali model follow..  14  1.................MQAITERLEAMLAQGTDNMLLRFTLGKTYAEHEQ----------FDAALPHLRAALDFDPTYSVAWKWLGKTLQGQGD-----------RAGARQAWESGLAAAQSDQQVVKELQVFLRRLAREDAL........ 108
35 -38.6004gcn_A mol:protein length:127 Protein STI-1  ali model follow..  16  9..IAEKDLGNAAYKQKDFEKAHVHYDKAIELDPSNITFYNNKAAVYFEEKK----------FAECVQFCEKAVEVGRETRADYKLIAKAMSRAG----NAFQKQNDLSLAVQWFHRSLSEFRDPELVKKVKELE.................. 126
36 -38.5002vq2_A mol:protein length:225 PUTATIVE FIMBRIAL BIOGENESIS AND TWITCHING MO  ali model follow..  16  9..NIKTQLAMEYMRGQDYRQATASIEDALKSDPKNELAWLVRAEIYQYLKV----------NDKAQESFRQALSIKPDSAEINNNYGWFLCG----------RLNRPAESMAYFDKALATYPTPYIANLNKGICSAKQGQFGLALKRSLAAQ 143
37 -38.5002ho1_A mol:protein length:252 Type 4 fimbrial biogenesis protein PilF  ali model follow..  14  32..DAYIQLGLGYLQRGNTEQAKVPLRKALEIDPSSADAHAALAVVFQTEME----------PKLADEEYRKALASDSRNARVLNNYGGFLYEQKR-----------YEEAYQRLLEASQLYPERSRVFENLGLVSLQMKKPAQAFEKSLRLN 165
38 -38.0002vgy_A mol:protein length:148 CHAPERONE SYCD  ali model follow..  12  22..EQLYSLAFNQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQ----------YDLAIHSYEEGAVMDIKEPRFPFHAAECLLQKGE-----------LAEAESGLFLAQELKPEFKELSTRVSSMLEAIKLKKEMKHE..... 148
39 -37.9004abn_A mol:protein length:474 TETRATRICOPEPTIDE REPEAT PROTEIN 5  ali model follow..  13  131.VEAWNQLGEVYWKKGDVTSAHTCFSGALTHCKN-KVSLQNLSMVLRQLQT-DSGDEHSRHVMDSVRQAKLAVQMDVLDGRSWYILGNAYLSLYF---NTGQNPKISQQALSAYAQAEKVDRSNPDLHLNRATLHKYEESYGEAFSQAAALD 282
40 -37.7001hh8_A mol:protein length:213 NEUTROPHIL CYTOSOL FACTOR 2  ali model follow..  7..ISLWNEGVLAADKKDWKGALDAFSAVQ---DPHSRICFNIGCMYTILKN----------MTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALNQLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKKALALATSMK 151
41 -37.6002vgx_A mol:protein length:148 CHAPERONE SYCD  ali model follow..  11  22..EQLYSLAFNQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQ----------YDLAIHSYSYGAVMDIKEPRFPFHAAECLLQKGE-----------LAEAESGLFLAQELKPEFKELSTRVSSMLEAIKLKKEMKHE..... 148
42 -37.6005a31_C mol:protein length:597 CELL DIVISION CYCLE PROTEIN 23 HOMOLOG  ali model follow..  15  331.VETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEMKN----------TSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKM-----------PFYCLYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAYWRAYAVG 463
43 -37.5002fi7_A mol:protein length:265 type 4 fimbrial biogenesis protein PilF  ali model follow..  14  44.RDAYIQLGLGYLQRGNTEQAKVPLRKALEIDPSSADAHAALAVVFQTEME----------PKLADEEYRKALASDSRNARVLNNYGGFLYEQKR-----------YEEAYQRLLEASQLYPERSRVFENLGLVSLQMKKPAQAFEKSLRLN 178
44 -37.5003u4t_A mol:protein length:272 TPR repeat-containing protein  ali model follow..  11  2NDDVEFRYADFLFKNNNYAEAIEVFNKLEAKKYNSPYIYNRRAVCYYELAKYDLAQKDKGQDSLAIQQYQAAVDRDTTRLDMYGQIGSYFYNKG-----------NFPLAIQYMEKQIRPTTTDPKVFYELGQAYYYNKEYVKAFVKVLELK 172
45 -37.4004ui9_F mol:protein length:824 CELL DIVISION CYCLE PROTEIN 27 HOMOLOG  ali model follow..  18  567.PEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEE----------LDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEK-----------FSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALNKAIVID 699
46 -37.3003hym_B mol:protein length:330 Cell division cycle protein 16 homolog  ali model follow..  15  160..LPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGN-----------FENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIG..... 326
47 -37.3004uzy_A mol:protein length:651 FLAGELLAR ASSOCIATED PROTEIN  ali model follow..  12  19...QYTQTIYTLIKEQKFAEAIQHLQYQLQNVPESRAALSLLGYCYYYTGQ----------YDMASQMYEQLVTLYPSNEDYKLYYAQSLYKGGMYPEASKAKEGKFEAARQKFNDAVQALGYQPELLYNIALCYYKTKQFGPAIEKAVREH 215
48 -37.3004nrh_B mol:protein length:178 Chaperone SycD  ali model follow..  36...........EGYVPDKNIALDTYQKIFKISSEDLEKVYKEGYHAYLDKD----------YAKSITVFRWLVFFNPFVSKFWFSLGASLHMSEQ-----------YSQALHAYGVTAVLRDKDPYPHYYAYICYTLTNEHEEALEMAWVRA 158
49 -37.2004rg6_A mol:protein length:560 Cell division cycle protein 27 homolog  ali model follow..  12  339...AYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEK-----------YKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLAFSWAMDLD 503
50 -37.0001na3_A mol:protein length:91 designed protein CTPR2  ali model follow..  25  2.............................AMDPNSAEAWYNLGNAYYKQGD----------YDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGD-----------YDEAIEYYQKALELDPNNAEAKQNLGNAKQKQG............. 91
51 -36.7003wxx_A mol:protein length:151 AcrH  ali model follow..  27..EQLYTLGFNQYHAGKHDEAHKIFQALCVLDHYEARFFLGLGACRQALGQ----------FRLAIDSYSYGAMMDLQEPRFPFHAAECLLQLGE-----------LEGAESGFHSAQLLKPELAELAARAGIMLEVVKTKKDM........ 150
52 -36.6002xpi_A mol:protein length:597 ANAPHASE-PROMOTING COMPLEX SUBUNIT CUT9  ali model follow..  373.AVTWLAVGIYYLCVNKISEARRYFSKSSTMDPQFGPAWIGFAHSFAIEGEHDQAISALGNILLANEYLQSSYALFQYDPLLLNELGVVAFNKSDMQTAINRKLKMYDAAIDALNQGLLLSTNDANVHTAIALVYLHKKIPGLALHESLAIS 580
53 -36.3001wm5_A mol:protein length:208 Neutrophil cytosol factor 2  ali model follow..  12..ISLWNEGVLAADKKDWKGALDAFSAVQ---DPHSRICFNIGCMYTILKN----------MTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALNQLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKKALALATSMK 156
54 -36.1004kvm_A mol:protein length:734 N-terminal acetyltransferase A complex subuni  ali model follow..  11  11..ITLFRTALKCYETKQYKKGLKAIEPLLERHPEHGESLAIKGILLHSLGNTKEGYDADKDYVQAAKCYINAHKLEKNNSSLLRDLALLQSQLRQ-----------YKALADTRNALLQDNPGVRANWSALAVAQFLRGEYASAYK...... 167
55 -36.0002xcb_A mol:protein length:142 REGULATORY PROTEIN PCRH  ali model follow..  19..EQLYALGFNQYQAGKWDDAQKIFQALCMLDHYDARYFLGLGACRQSLGL----------YEQALQSYSYGALMDINEPRFPFHAAECHLQLGD-----------LDGAESGFYSARALAAAQPAHEALAARAGAMLEAVTARKDR..... 142
56 -36.0002kck_A mol:protein length:112 TPR repeat  ali model follow..  11  6.PEEYYLEGVLQYDAGNYTESIDLFEKAIQLDPEESKYWLMKGKALYNLER----------YEEAVDCYNYVINVIEDNKDVWAAKADALRYI----------EGKEVEAEIAEARAK.................................. 104
57 -35.9005a31_X mol:protein length:599 ANAPHASE-PROMOTING COMPLEX SUBUNIT 7  ali model follow..  12  374..QALLLKGAALRNMGRVQEAIIHFREAIRLAPCRLDCYEGLIECYLASNSIREAMEDPVTQEKAKTLLNKALTQEPDYIKAVVKKAELLSREQKYEDGIAVAVNEYQEAMDQYSIALSLDPNDQKSLEGMQKMEKEESPTDATQEDDMEGS 573
58 -35.8004ui9_J mol:protein length:620 CELL DIVISION CYCLE PROTEIN 16 HOMOLOG  ali model follow..  12  335..PAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNN----------SKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAFHTALGLR 509
59 -35.6002vyi_A mol:protein length:131 SGTA PROTEIN  ali model follow..  21  1GPLGLKTEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLGN----------YAGAVQDCERAICIDPAYSKAYGRMGLALSSLNK-----------HVEAVAYYKKALELDPDNETYKSNLKIAELKLRE............ 129
60 -35.5003zgq_A mol:protein length:482 INTERFERON-INDUCED PROTEIN WITH TETRATRICOPEP  ali model follow..  11  183...TVYRLDDSDREGSVKSFSLGPLRKAVTLNPDNSYIKVFLALKLQDVHAEAEGEKRKNSWNKALELLKKALEVTPTSSFLHHQMGLCYRAQMIQIKKATHVDELISSAIFHFKAAMERDSMFAFAYTDLANMYAEGGQYSNAFRKALRLE 368
61 -35.4005aio_A mol:protein length:448 TRANSCRIPTION FACTOR TAU 131 KDA SUBUNIT  ali model follow..  11  1GAAQLLSQANEAFVRNDLQVAERLFNEVIKKDARNFAAYETLGDIYQLQGRLNDCCNDLDHVRQAIYCFSRVISLNPMEWESIYRRSMLYKKTGQ-----------LARALDGFQRLYMYNPYDANILRELAILYVDYDRIEDSYMKVFNAN 176
62 -34.7004hnw_A mol:protein length:863 N-terminal acetyltransferase A complex subuni  ali model follow..  10  21..NDQFLEALKLYEGKQYKKSLKLLDAILKKDGSHVDSLALKGLDLYSVGEKDDAASNTKEYKESIKWFTAALNNGSTNKQIYRDLATLQSQIG-----------DFKNALVSRKKYWEAFLGYRANWTSLAVAQDVNGERQQAFEKLAEGK 192
63 -34.6004XNH Entity 1(prereleased)  ali follow..  10  21..NDQFLEALKLYEGKQYKKSLKLLDAILKKDGSHVDSLALKGLDLYSVGEKDDAASNTKEYKESIKWFTAALNNGSTNKQIYRDLATLQSQIG-----------DFKNALVSRKKYWEAFLGYRANWTSLAVAQDVNGERQQAFEKLAEGK 192
64 -34.6004cgv_A mol:protein length:136 RNA POLYMERASE II-ASSOCIATED PROTEIN 3  ali model follow..  12  15..LVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRLKK----------FAVAESDCNLAVALNRSYTKAYSRRGAARFALQK-----------LEEAKKDYERVLELEPNNFEATNELRKISQALASKENSY....... 136
65 -34.3004g1t_A mol:protein length:472 Interferon-induced protein with tetratricopep  ali model follow..  13  140...CEEGWTRLKCGGNQNERAKVCFEKALEKKPKNPEFTSGLAIASYRLDNWPP-------SQNAIDPLRQAIRLNPDNQYLKVLLALKLHKMR-------EEGEEEGEGEKLVEEALEKAPGVTDVLRSAAKFYRRKDEPDKALKKALEYI 277
66 -33.9003gyz_A mol:protein length:151 Chaperone protein ipgC  ali model follow..  11  1GSLNITENESISTAVIDAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGR----------IEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQ-----------FQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAFELVIQHS 134
67 -33.5004gco_A mol:protein length:126 Protein STI-1  ali model follow..  12  14..QEEKNKGNEYFKKGDYPTAMRHYNEAVKRDPENAILYSNRAACLTKLME----------FQRALDDCDTCIRLDSKFIKGYIRKAACLVAMRE-----------WSKAQRAYEDALQVDPSNEEAREGVRNCLR................ 126
68 -33.2002lni_A mol:protein length:133 Stress-induced-phosphoprotein 1  ali model follow..  17  11..LMVKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLE----------FQLALKDCEECIQLEPTFIKGYTRKAAALEAMKD-----------YTKAMDVYQKALDLDSSCKEAADGYQRCMMAQY............. 126
69 -33.1001a17_A mol:protein length:166 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model follow..  12  14..EELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTEC----------YGYALGDATRAIELDKKYIKGYYRRAASNMALGK-----------FRAALRDYETVVKVKPHDKDAKMKYQECNKIVK--QKAFERAIAGD 140
70 -33.0003upv_A mol:protein length:126 Heat shock protein STI1  ali model follow..  14  5..EEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMS----------FPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKE-----------YASALETLDAARTKDAEVNNGSSAREIDQLYYKASQQRF....... 126
71 -33.0003ieg_A mol:protein length:359 DnaJ homolog subfamily C member 3  ali model follow..  3.VEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGK----------SKAALPDLTKVIALKMDFTAARLQRGHLLLKQGKLDEAEDDDGADYTAAITFLDKILEVCVWDAELRELRAECFIKEGEPRKAIKAASKLK 184
72 -32.7003ma5_A mol:protein length:100 Tetratricopeptide repeat domain protein  ali model follow..  17  3...............................DPEDPFTRYALAQEHLKHDN----------ASRALALFEELVETDPDYVGTYYHLGKLYERLDR-----------TDDAIDTYAQGIEVAREEQKDLSELQDAKLKAEGLE.......... 94
73 -32.7003ks2_A mol:protein length:151 Chaperone protein ipgC  ali model follow..  10  1G----STGSSISTAVIDAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGR----------IEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQ-----------FQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAFELVIQHS 130
74 -32.6004buj_B mol:protein length:1436 SUPERKILLER PROTEIN 3  ali model follow..  13  633...GFSTLGDIYCHYKDHLRAFKCYFKAFDLDAGDYTAAKYITETYASKPNWQAASSEKQEESDSIEWFQSALRVDPNDVESWVGLGQAYHACGR-----------IEASIKVFDKAIQLRPSHTFAQYFKAISLCDVGEYLESLEKVCQEA 804
75 -32.6003fwv_A mol:protein length:128 Hsc70/Hsp90-organizing protein  ali model follow..  12  5..LKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYIVNQAAVYFEKGD----------YNKCRELCEKAIEVGRENREDYRMIAYAYARIG----NSYFKEEKYKDAIHFYNKSLAEHRTPKVLKKCQQAEKILKEQ............ 128

FFAS is supported by the NIH grant R01-GM087218-01
8 5 8 8 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.