current user: public




1zu2A
Query: 1zu2_A mol:protein length:158 Mitochondrial import receptor subunit TOM20-3, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst GPLGSMDTETEFDRILLFEQIRQDAENTYKSNPLDADNLTRWGGVLLELSQFHSISDAKQMIQEAITKFEEALLIDPKKDEAVWCIGNAYTSFAFLTPDETEAKHNFDLATQFFQQAVDEQPDNTHYLKSLEMTAKAPQLHAEAYKQGLGGSLast
1 -73.3001zu2_A mol:protein length:158 Mitochondrial import receptor subunit TOM20-3  ali model  100  1GPLGSMDTETEFDRILLFEQIRQDAENTYKSNPLDADNLTRWGGVLLELSQFHSISDAKQMIQEAITKFEEALLIDPKKDEAVWCIGNAYTSFAFLTPDETEAKHNFDLATQFFQQAVDEQPDNTHYLKSLEMTAKAPQLHAEAYKQGLGGS 152
2 -50.4002fo7_A mol:protein length:136 SYNTHETIC CONSENSUS TPR PROTEIN  ali model follow..  18  1.AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGD----------YDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGD-----------YDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEY-YQKA 129
3 -48.6003asg_A mol:protein length:186 MamA  ali model follow..  13  8.QVYYRDKGISHAKAGRYSQAVMLLEQVYDADAFDVDVALHLGIAYVKTGAVDRGTEQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALKNLGR-----------FDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPH-FKKA 170
4 -48.5002wqh_A mol:protein length:125 CTPR3Y3  ali model follow..  18  9.AEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAWYNLGNAYYKQGD----------YDEAIEYYQKALELYPNNAEAWYNLGNAYYKQGD-----------YDEAIEYYQKALELYPNNAEAKQNLGNAKQKQG............. 125
5 -48.5003as8_A mol:protein length:186 Magnetosome protein MamA  ali model follow..  12  8.QVYYRDKGISHAKAGRYSEAVVMLEQVYDADAFDVEVALHLGIAYVKTGAVDRGTEQVQKYDLAVPLLVKVAEANPVNFNVRFRLGVALDNLGR-----------FDEAIDSFKIALGLRPNEGKVHRAIAYSYEQMGSHEEALPH-FKKA 170
6 -48.1003asd_A mol:protein length:200 MamA  ali model follow..  13  8.QVYYEDKGISHAKAGRYSQAVMLLEQVYDADAFDVDVALHLGIAYVKTGAVDRGTEQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALDNLGR-----------FDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPH-FKKA 170
7 -48.1001na0_A mol:protein length:125 designed protein CTPR3  ali model follow..  19  9.AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGD----------YDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGD-----------YDEAIEYYQKALELDPNNAEAKQNLGNAKQKQG............. 125
8 -47.9003kd7_A mol:protein length:125 CTPR390  ali model follow..  17  9.AEAWKNLGNAYYKQGDYQKAIEYYQKALELDPNNASAWYNLGNAYYKQGD----------YQKAIEYYQKALELDPNNAKAWYRRGNAYYKQGD-----------YQKAIEDYQKALELDPNNAKAKQNLGNAKQKQG............. 125
9 -47.5002pl2_A mol:protein length:217 Hypothetical conserved protein TTC0263  ali model follow..  13  5.EQNPLRLGVQLYALGRYDAALTLFERALKENPQDPEALYWLARTQLKLGL----------VNPALENGKTLVARTPRYLGGYMVLSEAYVALYRQAEDRERGKGYLEQALSVLKDAERVNPRYAPLHLQRGLVYALLGERDKAEAS-LKQA 144
10 -46.4002q7f_A mol:protein length:243 YrrB protein  ali model follow..  11  51.AIPYINFANLLSSVNELERALAFYDKALELDSSAATAYYGAGNVYVVKEMYKEAKDKLEQPKLALPYLQRAVELNENDTEARFQFGMCLANEGM-----------LDEALSQFAAVTEQDPGHADAFYNAGVTYAYKENREKALEM-LDKA 213
11 -45.4002vyi_A mol:protein length:131 SGTA PROTEIN  ali model follow..  20  12.AERLKTEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLGN----------YAGAVQDCERAICIDPAYSKAYGRMGLALSSLNK-----------HVEAVAYYKKALELDPDNETYKSNLKIAELKLREAP.......... 131
12 -44.5003urz_A mol:protein length:208 Uncharacterized protein  ali model follow..  4.VDEMLQKVSAAIEAGQNGQAVSYFRQTIALNIDRTEMYYWTNVDKNSATELALAYKKNRNYDKAYLFYKELLQKAPNNVDCLEACAEMQVCRGQ-----------EKDALRMYEKILQLEADNLAANIFLGNYYYLTAEQEKKKLETDYKK 149
13 -43.4001xnf_A mol:protein length:275 Lipoprotein nlpI  ali model follow..  18  5.WRKSEVLAVPLQPTLQQEVILARMEQILATDDERAQLLYERGVLYDSLGL----------RALARNDFSQALAIRPDMPEVFNYLGIYLTQAGN-----------FDAAYEAFDSVLELDPTYNYAHLNRGIALYYGGRDKLAQDD-LLAF 137
14 -43.1003cvq_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  15  138.DLNVQSEDFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNN----------YDSAAANLRRAVELRPDDAQLWNKLGATLANGNR-----------PQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQ-LVRA 266
15 -43.1003cv0_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  15  138.DLNVQSEDFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNN----------YDSAAANLRRAVELRPDDAQLWNKLGATLANGNR-----------PQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQ-LVRA 266
16 -42.9003sz7_A mol:protein length:164 Hsc70 cochaperone (SGT)  ali model follow..  12  11.SDKLKSEGNAAMARKEYSKAIDLYTQALSIAPANPIYLSNRAAAYSASGQ----------HEKAAEDAELATVVDPKYSKAWSRLGLARFDMAD-----------YKGAKEAYEKGIEAEGNGGSDAMKRGLE-TTKRKIEEANRGA.... 135
17 -42.7003r9a_B mol:protein length:328 Peroxisomal targeting signal 1 receptor  ali model follow..  12  177.PDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQ----------SEEAVAAYRRALELQPGYIRSRYNLGISCINLGA-----------HREAVEHFLEALNMQRKSRGPRGELRLALSMLGQSDAYGAA-DARD 316
18 -42.2001hxi_A mol:protein length:121 PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5  ali model follow..  14  17.HENPMEEGLSMLKLANLAEAALAFEAVCQKEPEREEAWRSLGLTQAENEK----------DGLAIIALNHARMLDPKDIAVHAALAVSHTNEHN-----------ANAALASLRAWLLSQPQYEQL......................... 121
19 -42.1002vq2_A mol:protein length:225 PUTATIVE FIMBRIAL BIOGENESIS AND TWITCHING MO  ali model follow..  16  8.SNIKTQLAMEYMRGQDYRQATASIEDALKSDPKNELAWLVRAEIYQYLKV----------NDKAQESFRQALSIKPDSAEINNNYGWFLGRLNRPAESMAYFDKQFGLAEAYLKRSLAAQPQFPPAFKELARTKMLAGQLGDA-DYYFKKY 173
20 -41.9003fp2_A mol:protein length:537 TPR repeat-containing protein YHR117W  ali model follow..  13  310.PPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEADRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILADPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIEL-FEDS 488
21 -41.3002lni_A mol:protein length:133 Stress-induced-phosphoprotein 1  ali model follow..  17  10.ALMVKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLE----------FQLALKDCEECIQLEPTFIKGYTRKAAALEAMKD-----------YTKAMDVYQKALDLDSSCKEAADGYQRCMMAQY............. 126
22 -41.2001fch_A mol:protein length:368 PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR  ali model follow..  12  217.PDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQ----------SEEAVAAYRRALELQPGYIRSRYNLGISCINLGA-----------HREAVEHFLEALNMQRKSRGPRGELRLALSMLGQSDAYGAA-DARD 356
23 -41.2002ho1_A mol:protein length:252 Type 4 fimbrial biogenesis protein PilF  ali model follow..  31.RDAYIQLGLGYLQRGNTEQAKVPLRKALEIDPSSADAHAALAVVFQTEME----------PKLADEEYRKALASDSRNARVLNNYGGFLYEQKRYEEAYQRLLEKPAQAKEYFEKSLRLNRNQPSVALEMADLLYKEREYVPARQ-YYDLF 195
24 -40.4001w3b_A mol:protein length:388 UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUC  ali model follow..  16  169.AVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMH-YKEA 365
25 -40.2003uq3_A mol:protein length:258 Heat shock protein STI1  ali model follow..  15  139.AEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMS----------FPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKE-----------YASALETLDAARTKDAEVNNGSSAREIDQLYYKASQ.......... 258
26 -40.1002fi7_A mol:protein length:265 type 4 fimbrial biogenesis protein PilF  ali model follow..  44.RDAYIQLGLGYLQRGNTEQAKVPLRKALEIDPSSADAHAALAVVFQTEME----------PKLADEEYRKALASDSRNARVLNNYGGFLYEQKRYEEAYQRLLEKPAQAKEYFEKSLRLNRNQPSVALEMADLLYKEREYVPARQ-YYDLF 208
27 -40.0003hym_B mol:protein length:330 Cell division cycle protein 16 homolog  ali model follow..  15  159.HLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGN-----------FENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGA.... 327
28 -39.7002vgy_A mol:protein length:148 CHAPERONE SYCD  ali model follow..  12  22..EQLYSLAFNQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQ----------YDLAIHSYEEGAVMDIKEPRFPFHAAECLLQKGE-----------LAEAESGLFLAQELKPEFKELSTRVSSMLEAIKLKKEMKHE..... 148
29 -39.7003fwv_A mol:protein length:128 Hsc70/Hsp90-organizing protein  ali model follow..  12  4.ALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYIVNQAAVYFEKGD----------YNKCRELCEKAIEVGRENREDYRMIAYAYARIGNSY----FKEEKYKDAIHFYNKSLAEHRTPKVLKKCQQAEKILKEQ............ 128
30 -39.7002vgx_A mol:protein length:148 CHAPERONE SYCD  ali model follow..  10  21.LEQLYSLAFNQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQ----------YDLAIHSYSYGAVMDIKEPRFPFHAAECLLQKGE-----------LAEAESGLFLAQELKPEFKELSTRVSSMLEAIKLKKEMKHE..... 148
31 -39.6003u4t_A mol:protein length:272 TPR repeat-containing protein  ali model follow..  2NDDVEFRYADFLFKNNNYAEAIEVFNKLEAKKYNSPYIYNRRAVCYYELAKYDLAQKDIETYSLAIQQYQAAVDRDTTRLDMYGQIGSYFYNKGN-----------FPLAIQYMEKQIRPTTTDPKVFYELGQAYYYNKEYVKADSS-FVKV 168
32 -39.5002e2e_A mol:protein length:177 Formate-dependent nitrite reductase complex n  ali model follow..  15  14.....RDPLHQFASQQNPEAQLQALQDKIRANPQNSEQWALLGEYYLWQND----------YSNSLLAYRQALQLRGENAELYAALATVLYYQAS--------QHMTAQTRAMIDKALALDSNEITALMLLASDAFMQANYAQAIELW.... 138
33 -38.9002gw1_A mol:protein length:514 Mitochondrial precursor proteins import recep  ali model follow..  13  304.SSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETDKNDFDKALKQYDLAIELENKLDGIYVGIAPLVGKAT--LLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAITL-FEES 475
34 -38.7001elr_A mol:protein length:131 TPR2A-DOMAIN OF HOP  ali model follow..  13  4.ALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGD----------YNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSY----FKEEKYKDAIHFYNKSLAEHRTPDKKCQQAEKILKEQERL........... 131
35 -38.4001wm5_A mol:protein length:208 Neutrophil cytosol factor 2  ali model follow..  42.SRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEANQLIDYKILGLQFKLFACEVLYNIAFMYAKKEE-----------WKKAEEQLALATSMKSEPRHSKIDVGKLFRPNERQVAQLAKYLGKA 207
36 -38.3001hh8_A mol:protein length:213 NEUTROPHIL CYTOSOL FACTOR 2  ali model follow..  37.SRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEANQLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKKAEEQLALKIDKAMECVWKQKLYEPVVIPVGRLFRPNERQVAQLAK--KDYLGKA 202
37 -38.2002hr2_A mol:protein length:159 Hypothetical protein  ali model follow..  10  11.AYLALSDAQRQLVAGEYDEAAANCRRAMEISHTDAFCHAGLAEALAGLRS----------FDEALHSADKALHYFNRRGEAVYSRALALDGLGR-----------GAEAMPEFKKVVEMIEERKGETPGKERMMEVAIDRIAQLGAS.... 159
38 -38.2002kat_A mol:protein length:115 uncharacterized protein  ali model follow..  14  1.................MQAITERLEAMLAQGTDNMLLRFTLGKTYAEHEQ----------FDAALPHLRAALDFDPTYSVAWKWLGKTLQGQGD-----------RAGARQAWESGLAAAQSDQQVVKELQVFLRRLAREDAL........ 108
39 -37.6002xcb_A mol:protein length:142 REGULATORY PROTEIN PCRH  ali model follow..  11  18.LEQLYALGFNQYQAGKWDDAQKIFQALCMLDHYDARYFLGLGACRQSLGLY----------EQALQSYSYGALMDINEPRFPFHAAECHLQLGD-----------LDGAESGFYSARALQPAHEALAARAGAMLEAVTARKD......... 141
40 -37.4003upv_A mol:protein length:126 Heat shock protein STI1  ali model follow..  15  4.AEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSF----------PEAIADCNKAIEKDPNFVRAYIRKATAQIAVKE-----------YASALETLDAARTKDAEVNNGSSAREIDQLYYKASQQRF....... 126
41 -37.3004abn_A mol:protein length:474 TETRATRICOPEPTIDE REPEAT PROTEIN 5  ali model follow..  11  96.AQALMLKGKALNVTPDYPEAEVLLSKAVKLEPELVEAWNQLGEVYWKKGDVTSAHTHSRHVMDSVRQAKLAVQMDVLDGRSWYILGNAYQNPKISQQALSAYAQSYGEALEGFSQAAALDPAWPEPQQREQQLLEFLSRLTSLLES-KGKT 312
42 -37.2002xpi_A mol:protein length:597 ANAPHASE-PROMOTING COMPLEX SUBUNIT CUT9  ali model follow..  13  407.GPAWIGFAHSFAIEGEHDQAISAYTTAARLFQGTHLPYLFLGMQHMQLGNILLANENKSDMQTAINHFQNALLLEKPWAATWANLGHAYRKLKM-----------YDAAIDALNQGLLLSTNDANVHTAIALVYLHKKIPGLAIT-HLHES 576
43 -35.8002kck_A mol:protein length:112 TPR repeat  ali model follow..  12  1..............................MVDQNPEEYYLEGVLQYDAGN----------YTESIDLFEKAIQLDPEESKYWLMKGKALYNLER-----------YEEAVDCYNYVINVIEDNKDVWAAKADALRYIEGKEVEAEIAEARA 103
44 -35.7003ieg_A mol:protein length:359 DnaJ homolog subfamily C member 3  ali model follow..  3.VEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGK----------SKAALPDLTKVIALKMDFTAARLQRGHLLLKQGKLDEAEDDFKKDYTAAITFLDKILEVCVWDAELRELRAECFIKEGEPRKAISD-LKAA 180
45 -35.7003k9i_A mol:protein length:117 BH0479 protein  ali model follow..  11  2.............VLGLEAQAVPYYEKAIASGKDLAECYLGLGSTFRTLGE----------YRKAEAVLANGVKQFPNHQALRVFYAMVLYNLGR-----------YEQGVELLLKIIAETSDDE----TIQSYKQAILFYADKLDETWKA. 117
46 -35.2001na3_A mol:protein length:91 designed protein CTPR2  ali model follow..  18  9.AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGD----------YDEAIEYYQKALELDPNNAEAKQNLGNAKQKQG.......................................................... 91
47 -35.2003gyz_A mol:protein length:151 Chaperone protein ipgC  ali model follow..  10  1GSLNITENESISTAVIDAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGR----------IEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQ-----------FQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKEC-FELV 130
48 -35.2003ks2_A mol:protein length:151 Chaperone protein ipgC  ali model follow..  1GS----TGSSISTAVIDAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGR----------IEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQ-----------FQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKEC-FELV 126
49 -34.9003q47_B mol:protein length:137 STIP1 homology and U box-containing protein 1  ali model follow..  13  9.AQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQP----------EQALADCRRALELDGQSVKAHFFLGQCQLEMES-----------YDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERR. 137
50 -34.9001a17_A mol:protein length:166 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model follow..  11  13.AEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECY----------GYALGDATRAIELDKKYIKGYYRRAASNMALGK-----------FRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQ............ 130
51 -33.9002l6j_A mol:protein length:111 TPR repeat-containing protein associated with  ali model follow..  11  4.FEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEY----------TQAIQMCQQGLRYTSTAEHVAIRSKLQYR------------LELAQGAVGSVQIPVVEVDELPEGYDR...................... 110
52 -33.8001elw_A mol:protein length:118 TPR1-DOMAIN OF HOP  ali model follow..  4.VNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDY----------QKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNR-----------FEEAKRTYEEGLKHEANNPQLKEGLQNMEAR............... 118
53 -33.7002c2l_A mol:protein length:281 CARBOXY TERMINUS OF HSP70-INTERACTING PROTEIN  ali model follow..  13  4.AQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQP----------EQALADCRRALELDGQSVKAHFFLGQCQLEMES-----------YDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRI 133
54 -33.5002bug_A mol:protein length:140 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model follow..  11  15.AEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECY----------GYALNDATRAIELDKKYIKGYYRRAASNMALGK-----------FRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQ............ 132
55 -32.4003ma5_A mol:protein length:100 Tetratricopeptide repeat domain protein  ali model follow..  16  3...............................DPEDPFTRYALAQEHLKHDN----------ASRALALFEELVETDPDYVGTYYHLGKLYERLDR-----------TDDAIDTYAQGIEVAREEGTQKSELQDAKLKAEGLE.......... 94
56 -32.3002y4t_A mol:protein length:450 DNAJ HOMOLOG SUBFAMILY C MEMBER 3  ali model follow..  20.VEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGK----------SKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKDYTAAIAFLDKILEVCVWDAELRELRAECFIKEGEPRKAISD-LKAA 197
57 -31.3003mkr_A mol:protein length:291 Coatomer subunit epsilon  ali model follow..  12  131..ECMAMTVQILLKLDRLDLARKELKKMQDQDEDATLTQLATAWVSLAAGG--------EKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGR-----------WEAAEGVLQEALDKDSGHPETLINLVVLSQHLGKPPEVTNRYLSQL 261
58 -30.9003v6t_A mol:protein length:499 dHax3  ali model follow..  10  338.VVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNGGGKQALET----------VQRLLPVLCQAHGLTPEQVVAIASHDGGKQALET-----------VQRLLPVLCQAHGLTPQQVVAIASNGGGRPALESIVAQLSR-PDPA 466
59 -30.7002dba_A mol:protein length:148 Smooth muscle cell associated protein-1, isof  ali model follow..  14  28.VEQLRKEGNELFKCGDYGGALAAYTQALGLDATPQDQHRNRAACHLKLEDY----------DKAETEASKAIEKDGGDVKALYRRSQALEKLGR-----------LDQAVLDLQRCVSLEPKNKVFQEALRNISGPSS............. 147
60 -30.6001nzn_A mol:protein length:126 Fission protein Fis1p  ali model follow..  11  1GSH-MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVR-------TRYNDDIRKGIVLLEELLPKGEEQRDYVFYLAVGNYRLKE-----------YEKALKYVRGLLQTEPQNNQAKELERLIDKAMKK............ 123
61 -30.5001iyg_A mol:protein length:133 Hypothetical protein (2010003O14)  ali model follow..  12  4GSSGMEAVLNELVSVEDLKNFERKFQSEQAAGSVSKSTQFEYAWCLVRSKY-------NEDIRRGIVLLEELLPKGEEQRDYVFYLAVGNYRLKE-----------YEKALKYVRGLLQTEPQNNQAKELERLIDKAMKK............ 127
62 -30.4002r5s_A mol:protein length:176 Uncharacterized protein VP0806  ali model follow..  11  6.DEQLLKQVSELLQQGEHAQALNVIQTLSDELQSRGDVKLAKADCLLETKQFELAQELLATISPELKRLEQELAANPDNFELACELAVQYNQVGR-----------DEEALELLWNILKVNLGAQDVKKTFMDILSALGQGNAIASKYRRQ. 170
63 -30.0002kc7_A mol:protein length:99 bfr218_protein  ali model follow..  13  2...DQLKTIKELINQGDIENALQALEEFLQTEPVGDEAYYLMGNAYRKLGD----------WQKALNNYQSAIELNPDSPALQARKMVM------------DILNFYNKDMYNQLE.................................... 93
64 -29.4003ro3_A mol:protein length:164 G-protein-signaling modulator 2  ali model follow..  12  9.GRAFGNLGNTHYLLGNFRDAVIAHEQRLLIKAAERIAYSNLGNAYIFLGEF----------ETASEYYKKTLLLRAVEAQSCYSLGNTYTLLQD-----------YEKAIDYHLKHLAIRIGEGRACWSLGNAYTALGNHDQAMH-FAEKH 155
65 -29.1001pc2_A mol:protein length:152 mitochondria fission protein  ali model follow..  11  3......AVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKY-------NDDIRKGIVLLEELLPKGSKQRDYVFYLAVGNYRLKE-----------YEKALKYVRGLLQTEPQNNQAKELERLIDKAMKK............ 120
66 -29.0002avp_A mol:protein length:70 synthetic consensus TPR protein  ali model follow..  28  1.................................GSAEAWYNLGNAYYKQGD----------YDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGD-----------YDEAIEYYQKALELDPRS............................ 70
67 -28.9003v6p_A mol:protein length:442 dHax3  ali model follow..  10  297.VVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNGGGKQALET----------VQRLLPVLCQAHGLTPEQVVAIASHDGGKQAL-----------ETVQRLLPVLCQAHGLTPQQVVAIASNGGGRPALESIVAQLSR-PDPA 425
68 -28.5002fbn_A mol:protein length:198 70 kDa peptidylprolyl isomerase, putative  ali model follow..  14  32.AFDIKEEGNEFFKKNEINEAIVKYKEALDFFIHTEECNLNLATCYNKNKDY----------PKAIDHASKVLKIDKNNVKALYKLGVANMYFGF-----------LEEAKENLYKAASLNPNNLDIRNSYELCVNKLKEARKKDKLTFGG. 176
69 -28.4001p5q_A mol:protein length:336 FK506-binding protein 4  ali model follow..  15  141.STIVKERGTVYFKEGKYKQALLQYKKIVKAQALRLASHLNLAMCHLKLQAF----------SAAIESCNKALELDSNNEKGLSRRGEAHLAVND-----------FELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANM 285
70 -28.2001zbp_A mol:protein length:273 hypothetical protein VPA1032  ali model follow..  1.....MTQWKNALSEGQLQQALELLIEAIKASPKDASLRSSFIELLCIDGD----------FERADEQLMQSIKLFPEYLPGASQLRHLVKAAQAVSFNLSMVSQDYEQVSELALQIEELRQEKGFLANDTSFS-DRLGGYIELF....... 159
71 -27.6003pe3_A mol:protein length:723 UDP-N-acetylglucosamine--peptide N-acetylgluc  ali model follow..  17  9.ADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGK----------LQEALMHYKEAIRISPTFADAYSNMGNTLKEMQD-----------VQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIAS-YRTA 137
72 -26.9003ro2_A mol:protein length:338 G-protein-signaling modulator 2  ali model follow..  11  5.CLELALEGERLCKSGDCRAGVSFFEAAVQVGTEDSAIYSQLGNAYFYLHDYAKALEVLGNFDEAIVCCQRHLDIKVGEARALYNLGNVYHAKGKSFGCPGDVRNALQAAVDLYEENLSLRAAQGRAFGNLGNTHYLLGNFRDAVI-AHEQR 209
73 -26.6003ly7_A mol:protein length:372 Transcriptional activator cadC  ali model follow..  205.............DDKSLNRASELLGEIVQSSPEFTYARAEKALVDIVRHSQHPLDEKKGKTDESYQAINTGIDLEMSWL-NYVLLGKVYEMKGM-----------NREAADAYLTAFNLRPGANTLYWIENGIFQ--TSVPYVVP-YLDKF 362
74 -26.5002v5f_A mol:protein length:104 PROLYL 4-HYDROXYLASE SUBUNIT ALPHA-1  ali model follow..  12  4..................................TAEDCFELGKVAYTEADYYHTEL----MEQALRQLDEGEISTIDKVSVLDYLSYAVYQQGD-----------LDKALLLTKKLLELDPEHQRANGNLKYFEYIMAKEKDVNKS..... 102
75 -26.2003sf4_A mol:protein length:406 G-protein-signaling modulator 2  ali model follow..  12  87.AKASGNLGNTLKVLGNFDEAIVCCQRHLDIKVGEARALYNLGNVYHAKGKSFGCPEVRDALQAAVDFYEENLSLRAAQGRAFGNLGNTHYLLGN-----------FRDAVIAHEQRLLIKAAERRAYSNLGNAYIFLGEFETASE-YYKKT 253

FFAS is supported by the NIH grant R01-GM087218-01
6 0 5 7 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.