current user: public

Query: 1y00_A mol:protein length:61 Carbon storage regulator, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60
1 -41.6001y00_A mol:protein length:61 Carbon storage regulator  ali model  100  1MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKSQQSSY 61
3 -40.2002jpp_A mol:protein length:70 Translational repressor  ali model follow..  66  1MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPDK. 60
4 -39.7001vpz_A mol:protein length:73 Carbon storage regulator homolog  ali model follow..  85  7MLILTRRVGETLMVGDDVTVTVLGVKGNQVRIGVNAPKEVAVHREEIYQRIQKEKDQEPNH 67
5 -37.5001t3o_A mol:protein length:95 Carbon storage regulator  ali model follow..  41  12MLVLSRKINEAIQIGADIEVKVIAVEGDQVKLGIDAPKHIDIHRKEIYLTIQEENNRAAA. 71
6 -6.3902eqs_A mol:protein length:103 ATP-dependent RNA helicase DHX8  ali model follow..  22  55.....ANVADVVSKGQRVKVKVLSFTGTKTSLSMKD......................... 85
7 -6.2102k52_A mol:protein length:80 Uncharacterized protein MJ1198  ali model follow..  25  38...MISLRLENLNVGDEIIVQAIDVRPEKREIDFK.......................... 69
8 -5.2802khj_A mol:protein length:109 30S ribosomal protein S1  ali model follow..  26  64.....EDATLVLSVGDEVEAKFTGVDRKNRAISLS.......................... 93
9 -5.2801p1a_A mol:protein length:85 UV excision repair protein RAD23 homolog B  ali model follow..  19  1..............GSHMQVTLKTLQQQTFKIDIDPEETVKALKEKIESE........... 36
10 -5.2101luz_A mol:protein length:88 Protein K3  ali model follow..  27  55.........RDKLVGKTVKVKVIRVDYTKGYIDVNYKR....................... 83

FFAS is supported by the NIH grant R01-GM087218-01
6 4 5 8 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Rychlewski L, Godzik A. Secondary structure prediction using segment similarity. Protein Eng. 1997 Oct;10(10):1143-53.