current user: public

Query: 1y00_A mol:protein length:61 Carbon storage regulator, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60
1 -45.1001y00_A mol:protein length:61 Carbon storage regulator  ali model  100  1MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKSQQSSY 61
3 -43.8002jpp_A mol:protein length:70 Translational repressor  ali model follow..  66  1MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPDK. 60
4 -43.6001vpz_A mol:protein length:73 Carbon storage regulator homolog  ali model follow..  86  7MLILTRRVGETLMVGDDVTVTVLGVKGNQVRIGVNAPKEVAVHREEIYQRIQKEKDQEPN. 66
5 -41.2001t3o_A mol:protein length:95 Carbon storage regulator  ali model follow..  41  12MLVLSRKINEAIQIGADIEVKVIAVEGDQVKLGIDAPKHIDIHRKEIYLTIQEENNRAAA. 71
6 -35.3004k59_A mol:protein length:74 RNA BINDING PROTEIN RsmF  ali model follow..  33  6FLILSRREGEGITLSGGIRILVTDIIGNQARVGIEAPRGVLIVRDELKTAPKG........ 74
7 -35.1004kji_A mol:protein length:79 RsmN, a RNA-binding protein of Regulator of S  ali model follow..  33  5FLILSRREGEGITLSGGIRILVTDIIGNQARVGIEAPRGVLIVRDELKTAPKG........ 73
8 -5.9902k52_A mol:protein length:80 Uncharacterized protein MJ1198  ali model follow..  30  44.........ENLNVGDEIIVQAIDVRPEKREIDFK.......................... 69
9 -5.6305ie8_A mol:protein length:89 30S ribosomal protein S1  ali model follow..  20  53.....EVPDQVVAVGDDAMVKVIDIDLERRRISLS.......................... 82
10 -5.2202eqs_A mol:protein length:103 ATP-dependent RNA helicase DHX8  ali model follow..  22  55.....ANVADVVSKGQRVKVKVLSFTGTKTSLSMKD......................... 85

FFAS is supported by the NIH grant R01-GM087218-01
8 8 5 1 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Pio F, Pawlowski K, Godzik A. Saturated BLAST: an automated multiple intermediate sequence search used to detect distant homology. Bioinformatics. 2000 Dec;16(12):1105-10.