current user: public




1xwaA
Query: 1xwa_A mol:protein length:111 thioredoxin, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst AAAAAMVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKANILast
1 -75.7001xwa_A mol:protein length:111 thioredoxin  ali model  100  1AAAAAMVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKANI 111
2 -69.5001ep7_A mol:protein length:112 THIOREDOXIN CH1, H-TYPE  ali model follow..  41  1...GGSVIVIDSKAAWDAQLAKGEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKVDVDAVAAVAEAAGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHA 110
3 -68.4002xbi_A mol:protein length:108 THIOREDOXIN  ali model follow..  47  1.GSMSKLIELKQDGDLESLLEQHKNKLVVVDFFATWCGPCKTIAPLFKELSEKY--DAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIAKVEDMIKKFI 108
4 -67.7003kd0_A mol:protein length:105 Thioredoxin  ali model follow..  49  1.....MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPSKMIKPFFHSLSEKY-SNVIFLEVDVDDSQDVASESEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
5 -67.6001aiu_A mol:protein length:105 THIOREDOXIN  ali model follow..  49  1.....MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKY-SNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
6 -67.6003ZZX Entity 1(prereleased)  ali follow..  59  1.....MVYQVKDQEDFTKQLNEAGNKLVVIDFYATWCGPCKMIAPKLEELSQSM-SDVVFLKVDVDECEDIAQDNQIACMPTFLFMKNGQKLDSLSGANYDKLLELVEKN. 104
7 -67.6003qfa_C mol:protein length:116 Thioredoxin  ali model follow..  47  2.RGSGSVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPSKMIKPFFHSLSEKY-SNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV 110
8 -67.5003e3e_A mol:protein length:105 Thioredoxin  ali model follow..  49  1.....MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPSKMIKPFFHSLSEKY-SNVIFLEVDVDDCQDVASECEVKRMPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
9 -67.5001erv_A mol:protein length:105 THIOREDOXIN  ali model follow..  51  1.....MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKY-SNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
10 -67.4002xbq_A mol:protein length:117 THIOREDOXIN  ali model follow..  48  13....SELIELKQDGDLESLLEQHKNKLVVVDFFATWCGPCKTIAPLFKELSEKY--DAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIAKVEDMIKKFI 117
11 -67.4001cqg_A mol:protein length:105 THIOREDOXIN  ali model follow..  47  1.....MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPAKMIKPFFHSLSEKY-SNVIFLEVDVDDAQDVASEAEVKATPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
12 -67.3003trx_A mol:protein length:105 THIOREDOXIN  ali model follow..  49  1.....MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKY-SNVIFLEVDVDDCQDVASECEVKCTPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
13 -67.3001erw_A mol:protein length:105 THIOREDOXIN  ali model follow..  48  1.....MVKQIESKTAFQEALDAAGDKLVVVDFSATWSGPSKMIKPFFHSLSEKY-SNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
14 -67.1001gh2_A mol:protein length:107 THIOREDOXIN-LIKE PROTEIN  ali model follow..  35  1....VGVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYP-QAVFLEVDVHQCQGTAATNNISATPTFQFFRNKVRIDQYQGADAVGLEEKIKQHL 106
15 -66.9002vim_A mol:protein length:104 THIOREDOXIN  ali model follow..  41  1......MRVLATAADLEKLINENKGRLIVVDFFAQWCGPCRNIAPKVEALAKEI-PEVEFAKVDVDQNEEAAAKYSVTAMPTFVFIKDGKEVDRFSGANETKLRETITRH. 103
16 -64.9002vm1_A mol:protein length:118 THIOREDOXIN H ISOFORM 1.  ali model follow..  39  2AAEEGAVIACHTKQEFDTHMANGTGKLVIIDFTASWCGPCRVIAPVFAEYAKKFPG-AIFLKVDVDELKDVAEAYNVEAMPTFLFIKDGEKVDSVVGGRKDDIHTKIVALM 113
17 -64.8003f3q_A mol:protein length:109 Thioredoxin-1  ali model follow..  45  1.....MVTQFKTASEFDSAI--AQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYP-QADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAIAAN. 102
18 -64.5002j23_A mol:protein length:121 THIOREDOXIN  ali model follow..  43  4SLVPRGSVQVISSYDQFKQVTG-GDKVVVIDFWATWCGPCKMIGPVFEKISDTPAGKVGFYKVDVDEQSQIAQEVGIRAMPTFVFFKNGQKIDTVVGADPSKLQAAITQHS 114
19 -64.0002fa4_A mol:protein length:111 Thioredoxin II  ali model follow..  43  1....MMVTQLKSASEYDSALAS-GDKLVVVDFFATWCGPCKMIAPMIEKFAEQY-SDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAIASNV 105
20 -63.7002i1u_A mol:protein length:121 Thioredoxin  ali model follow..  32  7TDSEKSATIKVTDASFATDVLS-SNKPVLVDFWATWCGPCKMVAPVLEEIATERATDLTVAKLDVDTNPETARNFQVVSIPTLILFKDGQPVKRIVGAKGKALLRELSDVV 117
21 -63.7001dby_A mol:protein length:107 CHLOROPLAST THIOREDOXIN M CH2  ali model follow..  30  1.....MEAGAVNDDTFKNVVLE-SSVPVLVDFWAPWCGPCRIIAPVVDEIAGEYKDKLKCVKLNTDESPNVASEYGIRSIPTIMVFKGGKKCETIIGAVPKAIVQTVEKYL 106
22 -63.6003dyr_A mol:protein length:111 Thioredoxin-1  ali model follow..  30  1...GSDKIIHLTDDSFDTDVLK-ADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGTPTLLLFKNGEVAATKVGALSKQLKEFLDANL 108
23 -63.6001faa_A mol:protein length:124 THIOREDOXIN F  ali model follow..  35  13MEAIVGKVTEVNKDTFWPIVKAAGDKPVVLDMFTQWCGPCKAMAPKYEKLAEEYLD-VIFLKLDCNENKTLAKELGIRVVPTFKILKENSVVGEVTGAKYDKLLEAIQAAR 123
24 -63.4002diy_A mol:protein length:130 Thioredoxin-like protein 2  ali model follow..  28  14EAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELP-QVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHA 123
25 -63.4002o7k_A mol:protein length:107 Thioredoxin  ali model follow..  35  1..GSHMAIVKVTDADFDSKVESG---VQLVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKNLAEVLDKHL 107
26 -63.3002o89_A mol:protein length:107 Thioredoxin  ali model follow..  33  1..GSHMAIVKVTDADFDSKVESG---VQLVDFWATWCGTSKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKNLAEVLDKHL 107
27 -63.3002eir_A mol:protein length:108 Thioredoxin 1  ali model follow..  29  1....SDKIIHLTDDSFDTDVLK-ADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKQLKCFLDCNL 107
28 -63.3001srx_A mol:protein length:108 THIOREDOXIN  ali model follow..  30  1....SDKIIHLTDDSFDTDLVK-ADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYIERGIPTLLLFKNGEVAATKVGALSKQLKEFLDANL 107
29 -63.2001m7t_A mol:protein length:107 Chimera of Human and E. coli thioredoxin  ali model follow..  43  1.....MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSN-VIFLEVDVDDAQDVAPKYGIRGIPTLLLFKNGEVAATKVGALSKQLKEFLDANL 106
30 -63.2001thx_A mol:protein length:115 THIOREDOXIN  ali model follow..  20  6....SKGVITITDAEFESEVLK-AEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKKLLSFLDTHL 112
31 -63.1001keb_A mol:protein length:108 Thioredoxin 1  ali model follow..  28  1....SDKIIHLTDDSFDTDVLK-ADGAILVDFWAEWCGPCKLIASILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKQLKEFLDANL 107
32 -63.0001t00_A mol:protein length:112 Thioredoxin  ali model follow..  27  10..........VTDDSFEQDVLK-NDKPVLVDFWAAWCGPCRQIAPSLEAIAAEYGDKIEIVKLNIDENPGTAAKYGVMSIPTLNVYQGGEVAKTIVGAKPKAIVRDLEDFI 110
33 -63.0002o8v_B mol:protein length:128 Thioredoxin 1  ali model follow..  28  11RGSHSDKIIHLTDDSFDTDVLK-ADGAILVDFWAEWCGPAKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKQLKEFLDANL 121
34 -62.9002voc_A mol:protein length:112 THIOREDOXIN  ali model follow..  34  1.....MAIVKATDQSFSAET---SEGVVLADFWAPWCGPSKMIAPVLEELDQEMGDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKDGEVVETSVGFKPKALQELVNKHL 104
35 -62.8002puk_C mol:protein length:106 Thioredoxin M-type, chloroplast (TRX-M)  ali model follow..  36  5..........VNDSSWKEFVLE-SEVPVMVDFWAPWCGPSKLIAPVIDELAKEYSGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAVPKSLTDSIEKYL 105
36 -62.7001zcp_A mol:protein length:108 Thioredoxin 1  ali model follow..  29  7..........LTDDSFDTDVLK-ADGAILVDFWAEWCACAKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKQLKEFLDANL 107
37 -62.7001txx_A mol:protein length:108 PROTEIN (THIOREDOXIN)  ali model follow..  30  7..........LTDDSFDTDVLK-ADGAILVDFWAEWCVWCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKQLKEFLDANL 107
38 -62.7002oe0_A mol:protein length:114 Thioredoxin-3  ali model follow..  36  2GSSYTSITKLTNLTEFRNLI--KQNDKLVIDFYATWCGPCKMMQPHLTKLIQAY-PDVRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPTALEKGIKD.. 107
39 -62.5002i4a_A mol:protein length:107 thioredoxin  ali model follow..  34  7..........VSDSSFDQDVLK-ASGLVLVDFWAEWCGPCKMIGPALGEIGKEFAGKVTVAKVNIDDNPETPNAYQVRSIPTLMLVRDGKVIDKKVGALPKQLKAWVESA. 106
40 -62.5001xfl_A mol:protein length:124 Thioredoxin h1  ali model follow..  38  6ASEEGQVIACHTVETWNEQLQKASKTLVVVDFTASWCGPCRFIAPFFADLAKKLP-NVLFLKVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAKHL 117
41 -62.4001uvz_A mol:protein length:119 THIOREDOXIN  ali model follow..  35  2RGSGSTTFNIQDGPDFQDRVVN-SETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEQLEAFLKKLI 112
42 -62.4001ti3_A mol:protein length:113 thioredoxin H  ali model follow..  40  1.AEEGQVIACHTVDTWKEHFEKGSQKLIVVDFTASWCPPCKMIAPIFAELAKKFP-NVTFLKVDVDELKAVAEEWNVEAMPTFIFLKDGKLVDKTVGADKDGLPTLVAKHA 111
43 -62.4002cvk_A mol:protein length:110 Thioredoxin  ali model follow..  36  7..........VTDQNFDETL--GQHPLVLVDFWAEWCAPCRMIAPILEEIAKEYEGKLLVAKLDVDENPKTAMRYRVMSIPTVILFKDGQPVEVLVGAQPKNYQAKIEKHL 106
44 -62.4003tco_A mol:protein length:109 Thioredoxin (TrxA-1)  ali model follow..  27  3....EDVTLVLTEENFDEVI--RNNKLVLVDCWAEWCAPCHLYEPIYKKVAEKYKGKAVFGRLNVDENQKIADKYSVLNIPTTLIFVNGQLVDSLVGAVDETLESTVNKYL 108
45 -62.4001syr_A mol:protein length:112 thioredoxin  ali model follow..  43  2....AMVKIVTSQAEFDSII--SQNELVIVDFFAEWCGPCKRIAPFYEECSKTY-TKMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGANDSALKQLIEKYA 105
46 -62.2003gnj_A mol:protein length:111 Thioredoxin domain protein  ali model follow..  21  1..SNAMSLEKLDTNTFEQLIYD-EGKACLVMFSRKNCHVCQKVTPVLEELRLNYEESFGFYYVDVEEEKTLFQRFSLKGVPQILYFKDGEYKGKMAGDVEDEVEQMIADVL 109
47 -62.1003VFI Entity 1(prereleased)  ali follow..  24  1.......LRSLSDSDFQLEVRQ-HPDPIIIMFTGSWCQPCKKMKPTFEEMASQMEGDIRFAYMDAEDAEKTMAELNIRTLPSLALFVDGMIREVFSGTMNKDLRYWINNNI 104
48 -62.1001wmj_A mol:protein length:130 Thioredoxin H-type  ali model follow..  41  10AAEEGVVIACHNKDEFDAQMTKAAGKVVIIDFTASWCGPCRFIAPVFAEYAKKFPG-AVFLKVDVDELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTIVKHV 121
49 -62.1001nsw_A mol:protein length:105 THIOREDOXIN  ali model follow..  31  1......ATMTLTDANFQQAI--QGDGPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGRPVKQLIGYQPKQLEAQLADVL 104
50 -62.0002wz9_A mol:protein length:153 GLUTAREDOXIN-3  ali model follow..  28  8EAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELP-QVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHA 117
51 -62.0001nw2_A mol:protein length:105 THIOREDOXIN  ali model follow..  32  1......ATMTLTDANFQQAI--QGDKPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGEPVKQLIGYQPKQLEAQLADVL 104
52 -61.6003d6i_A mol:protein length:112 Monothiol glutaredoxin-3  ali model follow..  28  2......VIEINDQEQFTYLTTTAGDKLIVLYFHTSWAEPCKALKQVFEAISNEPSSNVSFLSIDADENSEISELFEISAVPYFIIIHKGTILKELSGADPKEYVSLLEDCK 108
53 -61.6002l5l_A mol:protein length:136 Thioredoxin  ali model follow..  27  15TKAEFLAKVYNFEKNPEEWKYE-GDKPAIVDFYADWCGPCKMVAPILDELAKEYDGQIVIYKVDTEKEQELAGAFGIRSIPSILFIPMEGKPEMAQGAMPKSFKKAIDEFL 125
54 -61.5002iwt_A mol:protein length:125 THIOREDOXIN H ISOFORM 2  ali model follow..  37  11AAVAAEVISVHSLEQWTMQIEEAAKKLVVIDFTASWCGPSRIMAPVFADLAKKFPN-AVFLKVDVDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTAKVGLHA 122
55 -61.4001r26_A mol:protein length:125 Thioredoxin  ali model follow..  27  9RARYPSVVDVYSVEQFRNIM--SEDILTVAWFTAVWCGPCKTIERPMEKIAYEFP-TVKFAKVDADNNSEIVSKCRVLQLPTFIIARSGKMLGHVIGANPGMLRQKLRDII 116
56 -61.4003hz4_A mol:protein length:140 Thioredoxin  ali model follow..  20  2.SLNGSSIIEFEDMTWSQQVED-SKKPVVVMFYSPACPYCKAMEPYFEEYAKEYGSSAVFGRINIATNPWTAEKYGVQGTPTFKFFCHGRPVWEQVGQIYPSLKNAVRDML 111
57 -61.3003hxs_A mol:protein length:141 Thioredoxin  ali model follow..  30  17AEKPQSGTIHLTRAEFLKKIADLGDKPAIVDFYADWCGPCKMVAPILEELSKEYAGKIYIYKVNVDKEPELARDFGIQSIPTIWFVPMKGEPQVNMGALSKQLKGYIDKVL 138
58 -60.8003cxg_A mol:protein length:133 Putative thioredoxin  ali model follow..  23  10FQGQSIYIELKNTGSLNQVFSSTQNSSIVIKFGAVWCKPCNKIKEYFKNQLNYY--YVTLVDIDVDIHPKLNDQHNIKALPTFEFYFNLNNVHTVEGANQNDIEKAFQKYC 122
59 -60.6003ul3_B mol:protein length:128 Thioredoxin  ali model follow..  25  22...KKVPRLQQNGSNIINGVNM-KNTVIVLYFFAKWCQACTMQSTEMDKLQKYYGKRIYLLKVDLDKNESLARKFSVKSLPTIILLKNKTMLARKDHFVSSDLIALIKKH. 128
60 -59.6003d22_A mol:protein length:139 Thioredoxin H-type  ali model follow..  36  20ELAGGNVHLITTKERWDQKLSEADGKIVLANFSARWCGPSRQIAPYYIELSENYPS-LMFLVIDVDELSDFSASWEIKATPTFFFLRDGQQVDKLVGANKPELHKKITAIL 131
61 -59.6003hhv_A mol:protein length:110 Thioredoxin (TrxA-2)  ali model follow..  33  5....KEPVKHLNSKNFDEFI--TKNKIVVVDFWAEWCAPCLILAPVIEELANDY-PQVAFGKLNTEESQDIAMRYGIMSLPTIMFFKNGELVDQILGAVPREIEVRLKSLL 109
62 -59.6003d21_A mol:protein length:139 Thioredoxin H-type  ali model follow..  37  20ELAGGNVHLITTKERWDQKLSEADGKIVLANFSARWCGPCKQIAPYYIELSENYPS-LMFLVIDVDELSDFSASWEIKATPTFFFLRDGQQVDKLVGANKPELHKKITAIL 131
63 -59.3003emx_A mol:protein length:135 Thioredoxin  ali model follow..  16  21..........ITPEEFRQLL----QGDAILAVYSKTCPHCHRDWPQLIQASKEVDVPIVIGERELSAARLEMNKAGVEGTPTLVFYKEGRIVDKLVGATPWSKVEKAREIY 125
64 -58.6002e0q_A mol:protein length:104 thioredoxin  ali model follow..  37  4..........LDSKNFDSFL--ASHEIAVVDFWAEWCAPCLILAPIIEELAEDY-PQVGFGKLNSDENPDIAARYGVMSLPTVIFFKDGEPVDEIIGAVPREIEIRIKNLL 102
65 -58.1001oaz_A mol:protein length:123 THIOREDOXIN 1  ali model follow..  32  8..........LTDDSFDTDVLK-ADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKQLKEFLDANL 122
66 -57.1002f51_A mol:protein length:118 thioredoxin  ali model follow..  30  2..SDPIVHFNGTHEALLNRIKE-APGLVLVDFFATWCGPCQRLGQILPSIAEAN-KDVTFIKVDVDKNGNAADAYGVSSIPALFFVKKEKTLDQFVGADVSRIKADIEKF. 111
67 -56.6002dj0_A mol:protein length:137 Thioredoxin-related transmembrane protein 2  ali model follow..  19  2SSGSSGYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNTGLNFGKVDVGRYTDVSTRYKVKQLPTLILFQGGKEAMRRPQIDKKG......... 110
68 -55.0001v98_A mol:protein length:140 thioredoxin  ali model follow..  36  38..........ADEKGFAQEVAGAP--LTLVDFFAPWCGPCRLVSPILEELARDHAGRLKVVKVNVDEHPGLAARYGVRSVPTLVLFRRGAPVATWVGASPRVLEERLRPYL 137
69 -54.9003p2a_A mol:protein length:148 Putative thioredoxin-like protein  ali model follow..  27  43..........ATAETLDKLL--QDDLPMVIDFWAPWCGPCRSFAPIFAETAAERAGKVRFVKVNTEAEPALSTRFRIRSIPTIMLYRNGKMIDMLNGAVPKPFDNWLDEQL 142
70 -54.1002av4_A mol:protein length:160 Thioredoxin-like protein 4A (DIM1)  ali model follow..  13  11RGSSFMLQHLNSGWAVDQAIVNEDERLVCIRFGHDYDPDCMKMDELLYKVADDIKNFCVIYLVDITEVPDFNTMYELYDPVSVMFFYRNKHMMIDLGTGNNKINWPMNNK. 121
71 -53.8002ppt_A mol:protein length:155 thioredoxin-2  ali model follow..  21  51..........GIDPAILARAER-DDLPLLVDFWAPWCGPCRQMAPQFQAAAATLAGQVRLAKIDTQAHPAVAGRHRIQGIPAFILFHKGRELARAAGARPAELVGFVRGKL 151
72 -53.6002l6c_A mol:protein length:110 Thioredoxin  ali model follow..  16  1....MSAIRDITTEAGMAHF--EGLSDAIVFFHKNLCPHCKNMEKVLDKFGARA-PQVAISSVDSEARPELMKELGFERVPTLVFIRDGKVAKVFSGIMNPELQALYAS.. 103
73 -53.5003aps_A mol:protein length:122 DnaJ homolog subfamily C member 10  ali model follow..  17  2....PQASIDLTPQTFNEKVLQ-GKTHWVVDFYAPWCGPCQNFAPEFELLARMIKGKVRAGKVDCQAYPQTCQKAGIKAYPSVKLYQYERAKKSIWEEQIKTIAALIYGKL 112
74 -53.4001qgv_A mol:protein length:142 SPLICEOSOMAL PROTEIN U5-15KD  ali model follow..  15  2...SYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNKINWAMEDK. 109
75 -51.6002l57_A mol:protein length:126 Uncharacterized protein  ali model follow..  18  2SLEGIKQINFQSINVVENLEEAKEGIPTIIMFKTDTCPYCVEMQKELSYVSKEREGKFNIYYARLEKNIDLAYKYDANIVPTTVFLKEGNKFYVHQGLMRKNIETILNSLG 116

FFAS is supported by the NIH grant R01-GM087218-01
6 0 8 7 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Rychlewski L, Jaroszewski L, Li W, Godzik A. Comparison of sequence profiles. Strategies for structural predictions using sequence information. Protein Sci. 2000 Feb;9(2):232-41.