current user: public




Query: 1xwa_A mol:protein length:111 thioredoxin, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst AAAAAMVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKANILast
1 -73.0001xwa_A mol:protein length:111 thioredoxin  ali model  100  1AAAAAMVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKANI 111
2 -69.3004puf_C mol:protein length:117 Thioredoxin  ali model follow..  47  2RGSGSMVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSN-VIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV 111
3 -69.1004pok_A mol:protein length:109 Thioredoxin  ali model follow..  49  1.GAGTMVKQIESKTAFQKALKAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSN-VIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKKKLEATINKLV 109
4 -68.8003qfa_C mol:protein length:116 Thioredoxin  ali model follow..  46  2.RGSGSVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPSKMIKPFFHSLSEKYSN-VIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV 110
5 -67.4001ep7_A mol:protein length:112 THIOREDOXIN CH1, H-TYPE  ali model follow..  41  1...GGSVIVIDSKAAWDAQLAKGKHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKVDVDAVAAVAEAAGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHA 110
6 -67.3002ypm_A mol:protein length:106 LAFCA THIOREDOXIN  ali model follow..  60  1.....MVIQVTNKDEFESILSEA-DKLVVVDFTATWCGPCKMIAPKFEELSEEYPDNVVFLKVDVDEVEDVAAEYGISAMPTFQFFKNGKKVDELTGANQEKLKAMIKKH. 104
7 -67.2003m9j_A mol:protein length:105 Thioredoxin  ali model follow..  50  1.....MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSN-VIFLEVDVDDCQDVASESEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
8 -67.2003kd0_A mol:protein length:105 Thioredoxin  ali model follow..  48  1.....MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPSKMIKPFFHSLSEKYSN-VIFLEVDVDDSQDVASESEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
9 -67.2003e3e_A mol:protein length:105 Thioredoxin  ali model follow..  48  1.....MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPSKMIKPFFHSLSEKYSN-VIFLEVDVDDCQDVASECEVKRMPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
10 -67.2001erw_A mol:protein length:105 THIOREDOXIN  ali model follow..  47  1.....MVKQIESKTAFQEALDAAGDKLVVVDFSATWSGPSKMIKPFFHSLSEKYSN-VIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
11 -67.2001cqg_A mol:protein length:105 THIOREDOXIN  ali model follow..  46  1.....MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPAKMIKPFFHSLSEKYSN-VIFLEVDVDDAQDVASEAEVKATPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
12 -66.8002xbi_A mol:protein length:108 THIOREDOXIN  ali model follow..  47  1.GSMSKLIELKQDGDLESLLEQHKNKLVVVDFFATWCGPCKTIAPLFKELSEKY--DAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIAKVEDMIKKFI 108
13 -66.7003zzx_A mol:protein length:105 THIOREDOXIN  ali model follow..  60  1.....MVYQVKDQEDFTKQLNEAGNKLVVIDFYATWCGPCKMIAPKLEELSQSMSD-VVFLKVDVDECEDIAQDNQIACMPTFLFMKNGQKLDSLSGANYDKLLELVEKN. 104
14 -66.7001gh2_A mol:protein length:107 THIOREDOXIN-LIKE PROTEIN  ali model follow..  35  1....VGVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQ-AVFLEVDVHQCQGTAATNNISATPTFQFFRNKVRIDQYQGADAVGLEEKIKQHL 106
15 -66.2002vim_A mol:protein length:104 THIOREDOXIN  ali model follow..  41  1......MRVLATAADLEKLINENKGRLIVVDFFAQWCGPCRNIAPKVEALAKEIPE-VEFAKVDVDQNEEAAAKYSVTAMPTFVFIKDGKEVDRFSGANETKLRETITRH. 103
16 -65.8002vm1_A mol:protein length:118 THIOREDOXIN H ISOFORM 1.  ali model follow..  38  2AAEEGAVIACHTKQEFDTHMANGKDKLVIIDFTASWCGPCRVIAPVFAEYAKKFPG-AIFLKVDVDELKDVAEAYNVEAMPTFLFIKDGEKVDSVVGGRKDDIHTKIVALM 113
17 -65.6002xbq_A mol:protein length:117 THIOREDOXIN  ali model follow..  46  9LVIMSELIELKQDGDLESLLEQHKNKLVVVDFFATWCGPCKTIAPLFKELSEKY--DAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIAKVEDMIKKFI 117
18 -65.1004i8b_A mol:protein length:105 Thioredoxin  ali model follow..  42  1....SNVLHIETDDDFDSFLKENKDKLIVVDFFATWCGPCKKIAPAFEALSADRS--ALYVKVDVDKLEETARKYDVSAMPTFIVIKNGEKVDTVVGASIENVEAAIRKH. 104
19 -65.1001xfl_A mol:protein length:124 Thioredoxin h1  ali model follow..  37  6ASEEGQVIACHTVETWNEQLQKASKTLVVVDFTASWCGPCRFIAPFFADLAKKLPN-VLFLKVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAKHL 117
20 -64.9001ti3_A mol:protein length:113 thioredoxin H  ali model follow..  40  1.AEEGQVIACHTVDTWKEHFEKGSQKLIVVDFTASWCPPCKMIAPIFAELAKKFPN-VTFLKVDVDELKAVAEEWNVEAMPTFIFLKDGKLVDKTVGADKDGLPTLVAKH. 110
21 -64.4001r26_A mol:protein length:125 Thioredoxin  ali model follow..  27  9RARYPSVVDVYSVEQFRNIMS--EDILTVAWFTAVWCGPCKTIERPMEKIAYEFPT-VKFAKVDADNNSEIVSKCRVLQLPTFIIARSGKMLGHVIGANPGMLRQKLRDII 116
22 -64.0004dss_B mol:protein length:112 Thioredoxin-2  ali model follow..  43  2....GMVTQLKSASEYDSALAS-GDKLVVVDFFATWCGPSKMIAPMIEKFAEQYSD-AAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAIASNV 106
23 -64.0002iwt_A mol:protein length:125 THIOREDOXIN H ISOFORM 2  ali model follow..  37  11AAVAAEVISVHSLEQWTMQIEEAAKKLVVIDFTASWCGPSRIMAPVFADLAKKFPN-AVFLKVDVDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTAKVGLHA 122
24 -63.9004j56_E mol:protein length:114 Thioredoxin  ali model follow..  40  2..GSGSVKIVTSQAEFDSII--SQNELVIVDFFAEWCGPSKRIAPFYEECSKTYTK-MVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGANDSALKQLIEKY. 106
25 -63.4002yoi_A mol:protein length:106 LECA THIOREDOXIN  ali model follow..  55  1.....MVIQVTNKEEFEAILSEA-DKLVVVDFFATWCGPCKMIAPFFEELSEEYPDKVVFIKVDVDEVPDVAAKYGITSMPTFKFFKNGKKVDELVGANQEKLKQMILKHA 105
26 -63.3001syr_A mol:protein length:112 thioredoxin  ali model follow..  43  2....AMVKIVTSQAEFDSII--SQNELVIVDFFAEWCGPCKRIAPFYEECSKTYTK-MVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGANDSALKQLIEKY. 104
27 -63.3002oe0_A mol:protein length:114 Thioredoxin-3  ali model follow..  37  2GSSYTSITKLTNLTEFRNLIK--QNDKLVIDFYATWCGPCKMMQPHLTKLIQAYPD-VRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPTALEKGIKD.. 107
28 -63.3002fa4_A mol:protein length:111 Thioredoxin II  ali model follow..  44  1....MMVTQLKSASEYDSALAS-GDKLVVVDFFATWCGPCKMIAPMIEKFAEQYSD-AAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAIASNV 105
29 -62.7002mmn_A mol:protein length:104 Thioredoxin  ali model follow..  41  2......VKIVTSQSEFDSII--SQNELVIVDFFAEWCGPCKRIAPFYEECSKTYTK-MVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGANDSALKQLIEKY. 102
30 -62.5001wmj_A mol:protein length:130 Thioredoxin H-type  ali model follow..  41  10AAEEGVVIACHNKDEFDAQMTKAAGKVVIIDFTASWCGPCRFIAPVFAEYAKKFPG-AVFLKVDVDELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTIVKHV 121
31 -61.9003f3q_A mol:protein length:109 Thioredoxin-1  ali model follow..  44  1.....MVTQFKTASEFDSAIA--QDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQ-ADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAIAAN. 102
32 -61.9003cxg_A mol:protein length:133 Putative thioredoxin  ali model follow..  23  10FQGQSIYIELKNTGSLNQVFSSTQNSSIVIKFGAVWCKPCNKIKEYFKNQLNYY--YVTLVDIDVDIHPKLNDQHNIKALPTFEFYFNLNNVHTVEGANQNDIEKAFQKYC 122
33 -61.3002diy_A mol:protein length:130 Thioredoxin-like protein 2  ali model follow..  28  14EAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELP-QVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHA 123
34 -61.3003d22_A mol:protein length:139 Thioredoxin H-type  ali model follow..  36  20ELAGGNVHLITTKERWDQKLSEASGKIVLANFSARWCGPSRQIAPYYIELSENYPS-LMFLVIDVDELSDFSASWEIKATPTFFFLRDGQQVDKLVGANKPELHKKITAIL 131
35 -61.3003d21_A mol:protein length:139 Thioredoxin H-type  ali model follow..  38  20ELAGGNVHLITTKERWDQKLSEASGKIVLANFSARWCGPCKQIAPYYIELSENYPS-LMFLVIDVDELSDFSASWEIKATPTFFFLRDGQQVDKLVGANKPELHKKITAIL 131
36 -61.1004cw9_A mol:protein length:109 THIOREDOXIN  ali model follow..  39  1....MAVLHINALDQLTALLS--TEKVIVIDFFATWCGPSRSISPYFEELAGQYNN-IKFVKVDVDQAEEICVNYKVRSMPTFVLVKDGIEQKRFSGADRNALKQMVET.. 102
37 -60.0002j23_A mol:protein length:121 THIOREDOXIN  ali model follow..  40  5LVPRGSVQVISSYDQFKQVTG--GDKVVVIDFWATWCGPCKMIGPVFEKISDTPADKVGFYKVDVDEQSQIAQEVGIRAMPTFVFFKNGQKIDTVVGADPSKLQAAITQHS 114
38 -59.3001faa_A mol:protein length:124 THIOREDOXIN F  ali model follow..  38  24...........NKDTFWPIVKAAGDKPVVLDMFTQWCGPCKAMAPKYEKLAEEYLD-VIFLKLDCNENKTLAKELGIRVVPTFKILKENSVVGEVTGAKYDKLLEAIQAA. 122
39 -59.3003d6i_A mol:protein length:112 Monothiol glutaredoxin-3  ali model follow..  28  2......VIEINDQEQFTYLTTTAGDKLIVLYFHTSWAEPCKALKQVFEAISNEPSSNVSFLSIDADENSEISELFEISAVPYFIIIHKGTILKELSGADPKEYVSLLEDC. 107
40 -59.2002wz9_A mol:protein length:153 GLUTAREDOXIN-3  ali model follow..  28  8EAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELP-QVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHA 117
41 -56.2001m7t_A mol:protein length:107 Chimera of Human and E. coli thioredoxin  ali model follow..  42  1.....MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSN-VIFLEVDVDDAQDVAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDANL 106
42 -52.5002f51_A mol:protein length:118 thioredoxin  ali model follow..  32  2..SDPIVHFNGTHEALLNRIKEA-PGLVLVDFFATWCGPCQRLGQILPSIAEANKD-VTFIKVDVDKNGNAADAYGVSSIPALFFVKKEKTLDQFVGADVSRIKADIEKF. 111
43 -49.5001uvz_A mol:protein length:119 THIOREDOXIN  ali model follow..  34  2RGSGSTTFNIQDGPDFQDRVVNS-ETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIDEDQLEAFLKKLI 112
44 -49.4002mcs_A mol:protein length:128 Thioredoxin  ali model follow..  31  14...GSMIEQIGDSEFDNKVTSCNDNILILVDFWAPWCGPCRSLEPQLEKLAQQYTENVKIYKINIEDNQDVATQYGVSAIPTILMFKNGKKLSQVIGADISKIISEINNNI 121
45 -48.8004knd_A mol:protein length:112 Thioredoxin  ali model follow..  35  13...........QDSTFEQEVLKS-DTPVLVDFWAVWCGPCKAIAPVVDDLAARYKGKLKVAKMDVDQHQGVPQQYGIRSIPTLLVFKGGRVVDTVIGADKTRLEDSVKKAI 111
46 -48.1004xhm_A mol:protein length:137 Thioredoxin (Trx-3)  ali model follow..  38  39...........NSSNFDETLK--NNENVVVDFWAEWCHPCKMIAPVIEELAKEYAGKVVFGKLNTDENPTIAARYGISAIPTLIFFKKGKPVDQLVGAPKSELKRWVQRNL 137
47 -47.9003tco_A mol:protein length:109 Thioredoxin (TrxA-1)  ali model follow..  27  10...........TEENFDEVIR--NNKLVLVDCWAEWCAPCHLYEPIYKKVAEKYKGKAVFGRLNVDENQKIADKYSVLNIPTTLIFVNGQLVDSLVGADEDTLESTVNKYL 108
48 -47.9002l5l_A mol:protein length:136 Thioredoxin  ali model follow..  28  15.TKAEFLAKVYNFEKNPEEWKYEGDKPAIVDFYADWCGPCKMVAPILDELAKEYDGQIVIYKVDTEKEQELAGAFGIRSIPSILFIPMEGKPEMAQGAPKASFKKAIDEFL 125
49 -47.7002cvk_A mol:protein length:110 Thioredoxin  ali model follow..  35  8...........TDQNFDETLG--QHPLVLVDFWAEWCAPCRMIAPILEEIAKEYEGKLLVAKLDVDENPKTAMRYRVMSIPTVILFKDGQPVEVLVGAPKRNYQAKIEKHL 106
50 -47.7002ynx_A mol:protein length:106 LACA THIOREDOXIN  ali model follow..  42  7...........NDENFDEVIKKN-NKVVVVDFWAEWCGPCRMIAPIIEELAKEYAGKVVFGKLNVDENPEIAAKYGIMSIPTLLFFKNGKVVDQLVGAPKEALKERIKKYL 106
51 -47.5003ziv_A mol:protein length:106 AECA THIOREDOXIN  ali model follow..  43  7...........NDENFDEVIKKS-DKVVVVDFWAEWCGPCRMIAPIIEELAEEYAGKVVFGKVNVDENPEIAAKYGIMSIPTLLFFKNGKVVDQLVGAPKEALKERIKKYL 106
52 -47.4003hz4_A mol:protein length:140 Thioredoxin  ali model follow..  22  12...........EDMTWSQQVEDS-KKPVVVMFYSPACPYCKAMEPYFEEYAKEYGSSAVFGRINIATNPWTAEKYGVQGTPTFKFFCHGRPVWEQVGQYPSILKNAVRDML 111
53 -47.3004wxt_A mol:protein length:125 Thioredoxin  ali model follow..  31  5DAEKAIATIEVSDASFSTDVLAS-NKPVLVDFWATWCGPCKMVAPVLEEIASERGDHLTVAKLDVDANPETAQNFQVVSIPTLILFKDGQPVKRIVGAGKAALLRELSDAV 115
54 -47.2002o89_A mol:protein length:107 Thioredoxin  ali model follow..  34  10...........TDADFDSKVESG---VQLVDFWATWCGTSKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFPKENLAEVLDKHL 107
55 -47.2002o7k_A mol:protein length:107 Thioredoxin  ali model follow..  36  10...........TDADFDSKVESG---VQLVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFPKENLAEVLDKHL 107
56 -47.2002voc_A mol:protein length:112 THIOREDOXIN  ali model follow..  37  13....................AETSEGVVLADFWAPWCGPSKMIAPVLEELDQEMGDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKDGEVVETSVGFPKEALQELVNKHL 104
57 -47.1003gnj_A mol:protein length:111 Thioredoxin domain protein  ali model follow..  21  1..SNAMSLEKLDTNTFEQLIYDE-GKACLVMFSRKNCHVCQKVTPVLEELRLNYEESFGFYYVDVEEEKTLFQRFSLKGVPQILYFKDGEYKGKMAGDEDDEVEQMIADVL 109
58 -47.0002i1u_A mol:protein length:121 Thioredoxin  ali model follow..  34  18...........TDASFATDVLSS-NKPVLVDFWATWCGPCKMVAPVLEEIATERATDLTVAKLDVDTNPETARNFQVVSIPTLILFKDGQPVKRIVGAGKAALLRELSDVV 117
59 -46.8001nsw_A mol:protein length:105 THIOREDOXIN  ali model follow..  32  6...........TDANFQQAIQ--GDGPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGRPVKQLIGYPKEQLEAQLADVL 104
60 -46.6001nw2_A mol:protein length:105 THIOREDOXIN  ali model follow..  33  6...........TDANFQQAIQ--GDKPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGEPVKQLIGYPKEQLEAQLADVL 104
61 -46.5004o32_A mol:protein length:138 Thioredoxin  ali model follow..  27  36...........NGSNIINGVNMK-NTVIVLYFFAKWCQACTMQSTEMDKLQKYYGKRIYLLKVDLDKNESLARKFSVKSLPTIILLKNKTMLARKDHFSSNDLIALIKKHL 135
62 -46.5003hxs_A mol:protein length:141 Thioredoxin  ali model follow..  30  28.TRAEFLKKIADYENHSKEWKYLGDKPAIVDFYADWCGPCKMVAPILEELSKEYAGKIYIYKVNVDKEPELARDFGIQSIPTIWFVPMKGEPQVNMGASKEQLKGYIDKVL 138
63 -46.5004ba7_A mol:protein length:106 LBCA THIOREDOXIN  ali model follow..  36  7...........NDENFEEEVLKS-DKPVLVDFWAPWCGPCRMIAPIIEELAEEYEGKVKFAKVNVDENPETAAKYGIMSIPTLLLFKNGEVVDKLVGAPKEALKERIEKHL 106
64 -46.5004cdo_A mol:protein length:185 THIOREDOXIN-LIKE PROTEIN 4A, POLYGLUTAMINE-BI  ali model follow..  17  2....AMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAME.. 106
65 -46.4002puk_C mol:protein length:106 Thioredoxin M-type, chloroplast (TRX-M)  ali model follow..  35  6...........NDSSWKEFVLES-EVPVMVDFWAPWCGPSKLIAPVIDELAKEYSGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAPKSTLTDSIEKYL 105
66 -46.3002yj7_A mol:protein length:106 LPBCA THIOREDOXIN  ali model follow..  37  7...........TDENFEQEVLKS-DKPVLVDFWAPWCGPCRMIAPIIEELAKEYEGKVKVVKVNVDENPNTAAQYGIRSIPTLLLFKNGQVVDRLVGAPKEALKERIDKHL 106
67 -46.3001dby_A mol:protein length:107 CHLOROPLAST THIOREDOXIN M CH2  ali model follow..  28  7...........NDDTFKNVVLES-SVPVLVDFWAPWCGPCRIIAPVVDEIAGEYKDKLKCVKLNTDESPNVASEYGIRSIPTIMVFKGGKKCETIIGAPKATIVQTVEKYL 106
68 -46.3003hhv_A mol:protein length:110 Thioredoxin (TrxA-2)  ali model follow..  36  12...........NSKNFDEFIT--KNKIVVVDFWAEWCAPCLILAPVIEELANDY-PQVAFGKLNTEESQDIAMRYGIMSLPTIMFFKNGELVDQILGAPREEIEVRLKSLL 109
69 -46.1004pob_A mol:protein length:117 Thioredoxin  ali model follow..  28  12...........TDDSFQEDVVSS-NKPVLVDFWATWCGPCKMVAPVLEEIAKDHGEALTIAKLDVDANPETARAFQVTSIPTLILFQNGEATKRIVGASKSALLRELDGVV 111
70 -46.0003vfi_A mol:protein length:104 thioredoxin  ali model follow..  25  5...........SDSDFQLEVRQH-PDPIIIMFTGSWCQPCKKMKPTFEEMASQMEGDIRFAYMDAEDAEKTMAELNIRTLPSLALFVDGMIREVFSGTNKSDLRYWINNNI 104
71 -45.9001t00_A mol:protein length:112 Thioredoxin  ali model follow..  27  11...........TDDSFEQDVLKN-DKPVLVDFWAAWCGPCRQIAPSLEAIAAEYGDKIEIVKLNIDENPGTAAKYGVMSIPTLNVYQGGEVAKTIVGAPKAAIVRDLEDFI 110
72 -45.8002o8v_B mol:protein length:128 Thioredoxin 1  ali model follow..  32  22...........TDDSFDTDVLKA-DGAILVDFWAEWCGPAKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDANL 121
73 -45.7001thx_A mol:protein length:115 THIOREDOXIN  ali model follow..  22  13...........TDAEFESEVLKA-EQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVSKDKLLSFLDTHL 112
74 -45.4002e0q_A mol:protein length:104 thioredoxin  ali model follow..  36  5...........DSKNFDSFLA--SHEIAVVDFWAEWCAPCLILAPIIEELAEDY-PQVGFGKLNSDENPDIAARYGVMSLPTVIFFKDGEPVDEIIGAPREEIEIRIKNLL 102
75 -45.1001srx_A mol:protein length:108 THIOREDOXIN  ali model follow..  33  8...........TDDSFDTDLVKA-DGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYIERGIPTLLLFKNGEVAATKVGASKGQLKEFLDANL 107

FFAS is supported by the NIH grant R01-GM087218-01
8 2 7 8 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Godzik A. Fragnostic: walking through protein structure space. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W249-51.