current user: public




Query: 1w1w_A mol:protein length:430 STRUCTURAL MAINTENANCE OF CHROMOSOME 1, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430
# Score Template Links and tools%idFirst MGRLVGLELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLIYRGVLNDENSDDYDNEGAASSNPQSAYVKAFYQKGNKLVELMRIISRNGDTSYKIDGKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPVELSRMFEEVSGSIQYKKEYEELKEKIEKLSKSATESIKNRRRIHGELKTYKSPGLEVLFQGPRGSRYDEAEGRFEVINNETEQLKAEEKKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIITLDLSNYAELast
1 -144.0001w1w_A mol:protein length:430 STRUCTURAL MAINTENANCE OF CHROMOSOME 1  ali model  100  1MGRLVGLELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLIYRGVLNDENSDDYDNEGAASSNPQSAYVKAFYQKGNKLVELMRIISRNGDTSYKIDGKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPVELSRMFEEVSGSIQYKKEYEELKEKIEKLSKSATESIKNRRRIHGELKTYKSPGLEVLFQGPRGSRYDEAEGRFEVINNETEQLKAEEKKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIITLDLSNYAE 430
2 -99.9003zgx_A mol:protein length:426 CHROMOSOME PARTITION PROTEIN SMC  ali model follow..  27  2..FLKRLDVIGFKSFAERISVD-FVKGVTAVVGPNGSGKSNITDAIRWVLGEQSARLRGGKMEDIIFAGSDSRKRLN------LAEVTLTLDNDDHFLPIDFHEVSVTRRVYRSGESEFLINNQPCRLKDIIDLFMDSGL--KEAFSIISQGKVEEILSSKAEDRRSIFEEAAGVLKYKTRKKKAENKLFETQDNLNRVEDILHELEGQVEPLKIQASIAKDYLESIDEFERVNERYKFLSEQKEDLTEAKNTLFQVIEEMDEEMTKRFNDTFVQIRSHFDQVFRSL---------FGGGRAELRLTDPNDLLHSGVEIIAQPPGKKLQNLNLLSGGERALTAIALLFSILKVRPVPFCVLDEVEAALDEANVFRFAQYLKKY-SSDTQFIVITHRKGTMEEADVLYGVTM-QESGVSKVISVKLEETKE 423
3 -83.7004ux3_A mol:protein length:543 STRUCTURAL MAINTENANCE OF CHROMOSOMES PROTEIN  ali model follow..  20  1MAYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREERQGLIHQGSGG--------SVMSASVEIVFHDPDHSMILPGDDEVTIRRTVGLKKDDYQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERLQLLEDVVGAKSFEVKLKASLKKMEETEQKKIQINKEMGELNSKLSEMEQERKELEKYNELERNFKKFNERRKDLAERASELDESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGTAKLIIHRKSNESQNGKDSEIMYTGVSISVSFNSKQNEQVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELS-KNAQFICTTFRTDMLQVADKFFRVKY--ENKISTVIEVNREEAIG 524
4 -79.4001e69_A mol:protein length:322 CHROMOSOME SEGREGATION SMC PROTEIN  ali model follow..  32  2..RLKKLYLKGFKSFGRPSLIG-FSDRVTAIVGPNGSGKSNIIDAIKWVFGEQSKKLRASEKFDMIFAGSENLPPAG-------------SAYVELVFEENGEEITVARELKRTGENTYYLNGSPVRLKDIRDRFAGTGL--VDFYSIVGQGQIDRIVNASPEELRLESSKHPTSLV-------------------------------------------------------------------------------------------PRGSYQRVNESFNRFISLL---------FFGGEGRLNVSEAKSILDAGFEISIRKPGRRDQKLSLLSGGEKALVGLALLFALMEIKPSPFYVLDEVDSPLDDYNAERFKRLLKENS-KHTQFIVITHNKIVMEAADLLHGVTM--VNGVSAIVPVEVEKILE 313
5 -72.7004i99_A mol:protein length:354 Chromosome partition protein Smc  ali model follow..  33  1MPYIEKLELKGFKSYGNKKVVIPFSKGFTAIVGANGSGKSNIGDAILFVLGGLSAKMRASRISDLIFAGSKNEPPAK------YAEVAIYFNNEDRGFPIDEDEVVIRRRVYPDGRSSYWLNGRRATRSEILDILTAAMI-SPDGYNIVLQGDITKFIKMSPLERRLLIDDISGIAEYDSKKEKALEEE-------------------------------------------------------------------------KEKKNVFMRTFEAISRNFSEIFAKLSP---------GGSARLILENPEDPFSGGLEIEAKPAGKDVKRIEAMSGGEKALTALAFVFAIQKFKPAPFYLFDEIDAHLDDANVKRVADLIKESS-KESQFIVITLRDVMMANADKIIGVSM--RDGVSKVVSLSLEKAMK 339
6 -42.2003qku_A mol:protein length:359 DNA double-strand break repair rad50 ATPase  ali model follow..  16  2..KLERVTVKNFRSHSDTVV---FKEGINLIIGQNGSGKSSLLDAILVGL---PLRIKDIKKDEFTKVGAR------------DTYIDLIFEKDGTKYRITRRFLKGYSSGEIHAMKRLVGNEWKHVTEPSSKAISAFMEKLIPYNIFLNAIYIRQGQIDAILESDEAREKVVREVLNLDKFETAYKKLSELKKTINNRIKEYGGSGGI--------------------------------KDLEKAKDFTEELIEKVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKE-----------------RPLTFLSGGERIALGLAFRLAMSLYGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRISLENGSSKVEVVS........ 359
7 -41.3003qkr_B mol:protein length:179 DNA double-strand break repair rad50 ATPase  ali model follow..  19  1.......................................................................................................................................................................................................................................AEKENRERVKKEIKDLEKAKDFTEELIEKVKKYKALAREAALSKIGELASEIFAEFTE---------GKYSEVVVRAEEN----KVRLFVVWEGKE-RPLTFLSGGERIALGLAFRLAMSLYGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRISL--ENGSSKVEVVS...... 179
8 -40.3003qkt_A mol:protein length:339 DNA double-strand break repair rad50 ATPase  ali model follow..  18  2..KLERVTVKNFRSHSDTVV---FKEGINLIIGQNGSGKSSLLDAILVGLYWPLRIKDIKK-------------------------------------------DEFTKVGARDTYIDLIFEKDGTKYRITRRFLKGYSSGEIHAMKRLVGNEWKHVTEPSSKAISAFMEKLIPYNIFLNAIYIRQGQIDAILESDEAREKVVREVLN-------------------------LDKFETAYKKLSELKGGSGGTEELIEKVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWE--------------GKERPLTFLSGGERIALGLAFRLAMSLYGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRISLENGSSKVEVVS........ 339
9 -31.8005f3w_B mol:protein length:372 DNA double-strand break repair Rad50 ATPase,D  ali model follow..  17  4..ILKEIRMNNFKSHVNSRI---FEKGIVAIIGENGSGKSSIFEAVFFALFGAGSNFNYDTI----------------TKGKKSVYVELDFEVNGNNYKIIREYDS-GRGGAKLYKNGKPYATTISAVNKAVNEILGVDRNMFLNSIYIKQGEIAKFLSLKPSEKLETVAKLLGIDEFEKCYQKMGEIVKEYEKRLERIEGELNYKEESLKARLKEMSNLEKEKEKLTKFVEYLDKVRRIFGRNGFQAYLREKYVPLIQKYLNEAFSEFDLPYSFVELTKDFEVRVHAPNGV------------------------------------LTIDNLSGGEQIAVALSLRLAIANANRVECIILDEPTVYLDENRRAKLAEIFRKVKSIP-QMIIITHHRELEDVADVIINVKKDGNVSKVKI.......... 370
10 -27.8003euj_A mol:protein length:483 Chromosome partition protein mukB, Linker  ali model follow..  11  8..KFRSLTLINWNGFFARTF---FDELVTTLSGGNGAGKSTTMAGFVTALIPDLTLLNFRNTTEAGSTSSSRDKGLYGKLKAGVCYAVLETVNSRA-VPMTDSVISLFTEQVANKARVLSLNDLKEKFEETAVTFKPYHSITDYHSFMFDLGILPKRLRSSSDRNK-LLPENSGVRQAFQDMEAALRENSGGSGGSISAESVANILRKTIQREQNRILQLNQGLQNIKGVRLVVNIRDTHSILLNALSDQHEQHKDLFESQKLSFSEALAMLYKRINPHIELGQRMPQTIGE------------ELLDYRNYLDLEVETLRGAYGWM-SALSTGEAIGTGMSILLMVVQ-KDILPCRLLFLDQA-ARLDAMSINTLFELCERL---DMQLLIAA--PERGTTYKLVRKILANQEY............... 473
11 -27.8003tho_A mol:protein length:382 Probable DNA double-strand break repair Rad50  ali model follow..  16  16.....RLTVRNFLGLKNVDI---FQSGITVVEGPNGAGKSSLFEAISFALGNGIRYPNSYDY--------NRNAVDGTARLVFQFERGGKRYEIIREINALQRKHNAKLSEILENGKKAAIAAKPTSVKQEVEKILGIEHRTFIRTVFLPQGEIDKLLISPPSEITEIISDVFQSKETLEKLEKLLKEKMKKLENEISSGGAGGAGGSLEKKLKEMSDE---------------------YNNLDLLRKYLFDKSNFSRYFTGRVLEAVLKRTKAYLDILTNGRFDIDFDDEKGGFIIKDWGI-------------------------RPARGLSGGERALISISLAMSLAEVASGRLFFIDEGFSSLCTENKEKIASVLKELERLNKVIVFITCDREFSEAFDRKLRITGGVVVN.............. 375
12 -23.6004ad8_A mol:protein length:517 DNA REPAIR PROTEIN RECN  ali model follow..  15  40...LSRLEIRNL-ATITQLELE-LGGGFCAFTGETGAGKSIIVDALGLLLGGRANHDLIRSGEKELLVTGFWGDGDESEADSASRRLSSAGRGAARLSGEVVSVRELQEEAQAYAAAHAAWREAVSRLERLQASQRERARQIDLLAFQVQEISEVSPDPGEEEGLNTELSRLSNLHESSKHPTSLVPRGSGSAADPEALDRVEARLSALSKLKNKYGPTLEDVVEFGAQAAEELAGLEEDERDAGSLQADVDALHAELLKVGQALDAAREREAEPLVDSLLAVIRELG--------MPHARMEFALSALAEPAAYGLSRFSANPGEELGPLSDVSGGE--LSRVMLAVSTVLGADTPSVVFDEVDAGIGGAAAIAVAEQLSRLA-DTRQVLVVTHLAQIAARAHHHYKVEKQVEDGRTVSHVRLLTG... 488
13 -22.9005da9_A mol:protein length:449 Putative uncharacterized protein,Putative unc  ali model follow..  14  1MSKIEKLSILGVRSFGHPETIA-FNTPLTLIVGYNGSGKTTVIECLKYATGELPPNSTRNGADPDLVGEKEVRAQVKLSFRSTIGESYVVTRNIQLLVQRNNKRTQKTLEGSRNNGERTVISTRVAELDKLVSEKLGVPPAILDAVIFCHQDDSLWPMSE-PAALKKRFDEIFEAQKYTKVIENIRLLKKKKGDELKILKEREVQDKANKERAEKVDGGAGGA-GGELDLKDAKAKYKETHIKVETTKAAIEDLGRGMAAVDHAIMQYHSKMMEQINRTIAELWQSYQGTDIDTIQIRSDVESTTSSDSGTRRNYNYRVSMVKGDTEMDMRGRCSAGQKVLASIIIRLALAE-ANCGLIALDEPTTNLDSDNIRSLAESLHGIAQGNLQLIVITHDEEFLKYCDDFYRVKRDEKQ--SVIVRESITRITE 449
14 -18.6001qhl_A mol:protein length:227 PROTEIN (CELL DIVISION PROTEIN MUKB)  ali model follow..  25  6..KFRSLTLINWNGFFARTF---LDELVTTLSGGNGAGKSTTMAAFVTALIPDLTLLHFRNTTE.............................................................................................................................................................................................................................................................................................................................................................................. 65
15 -17.0004aby_A mol:protein length:415 DNA REPAIR PROTEIN RECN  ali model follow..  17  40...LSRLEIRNLATITQLEL---LGGGFCAFTGETGAGKSIIVDALGLLLGGRANH------------------------DLIRSGEKELLVTGFWGDGDESEADSASRRLSSAGRGAARLSGEVVSVQEWAQGRLTIHWQHSAVSLLSPANQRGLLDRRVTKEAQAYAAAHAAWREAV------------------------------------------------SRLERLQASESSKHPTSLVPRGSVDALHAELLKVGQALDAAREREAEPLVDSLLAVIRELG--------MPHARMEFALSALAEPAAYGLSRFSANPGEELGPLSDVSGGERVMLAVSTVLG----ADTPSVVFDEVDAGIGGAAAIAVAEQLSRLA-DTRQVLVVTHLAQIAARAHHHYKVEKQVEDGRTVSHVRLLTGDER 389
16 -15.8003qkr_A mol:protein length:203 DNA double-strand break repair rad50 ATPase  ali model follow..  13  2..KLERVTVKNFRSHSDTVV---FKEGINLIIGQNGSGKSSLLDAILVGL-YWPLRIKDIKKDEFTKVGARDTRRFLKGYSSGEIHAMKRLVGNEWKHVTEPSSKAISAFMEKLIPYNIFLNAIYIRQGQIDAILESDEAREKVVREVLNLDKFETAYKKLSELKKTINNRIKEYRDILARTEG...................................................................................................................................................................................................................................................... 196
17 -14.6002o5v_A mol:protein length:359 DNA replication and repair protein recF  ali model follow..  14  5..RLSALSTLNYRNLAPGTL---FPEGVTGIYGENGAGKTNLLEAAYLALTGQTDAPRIEQL----------------------------------IQAGETEAYVRADLQQGGSLSIQEVGLGRGRRQLKVDGVRARTGDLPRGGAVWIRPEDSELVFGPPSGRRAYLDSLLSRLS-------------------------------------------ARYGEQLSRYERTVSQRNAALRGGEE--WAMHVWDDVLLKLGTEIMLFRRRALTRLDELAREANAQLGSRKTLALTLTESTSPETYAADRGRRAEELARGSTVTGPHRDDLLLTSRGEGRTVALALRRA-EKFGEDPVLLLDDFTAELDPHRRQYLLDLAAS----VPQAIVTG.................................... 327
18 -12.1003ozx_A mol:protein length:538 RNase L inhibitor  ali model follow..  12  27...........................ILGVLGKNGVGKTTVLKILAGEIDEVLKRFRGKEIYNYFKELYSNELKIVHKIQYVEYASKFLKGTVNEILTKIDERGKKDEVKELLNMTNLWNKDANILSGGGLQRLLVAASLLREADVYIFDQPSSYLDVRERMNMAKAIRELLKNKYVIVVDHDLVGINNFLKGYLPAENMKIRPDEIKFMLKEVSDLDLSKDLKTKMKWTKIIKKLGDFQLVVDNGEAKEGEIIGILGP-KTTFARILVGEITADEGSVTPEKQILSYKPQRIFPNYDGTVQQYLENASKDALSTSSWFFEEVTKRLSNVNDLSGGELQKLYIAATLA----KEADLYVLDQPSSYLDVEERYIVAKAIKRVTRERKAVTFIIDHDLSIYIADRII....................... 457
19 -11.4005dgx_A mol:protein length:256 Lipid A export ATP-binding/permease protein M  ali model follow..  19  155............................................................................................................................................................................................................................................................................................................................................KLSGGQRQRISIARAL----LKNAPVLIFDEATSALDNESERVVQQALESLTKSCTT-IVIAHRLSTVENADKIVVMDGGRESGKHQEL......... 240
20 -11.3005eum_A mol:protein length:258 Lipid A export ATP-binding/permease protein M  ali model follow..  23  156............................................................................................................................................................................................................................................................................................................................................SLSGGQRQRLAIARAL----LRNSPVLILDEATSALDTESERAIQSALEELKKDRTV-VVIAHRLSTIENADEILVIDHGEERGNHKTL......... 241
21 -11.2005idv_A mol:protein length:279 Lipid A export ATP-binding/permease protein M  ali model follow..  25  170............................................................................................................................................................................................................................................................................................................................................NLSGGQRQRIAIARAI----LKNAPILILDEATSALDNESEHFIQQAFDEAMQDRTT-IVIAHRLSTIENADRIVVMDRGQEQGTHQEL......... 255
22 -11.2001yqt_A mol:protein length:538 RNase l inhibitor  ali model follow..  12  6...SGLVPRSHMEQLEEDCVHRYGVNAFVGIVGPNGTGKSTAVKILAGQLDGVIRAFRGNELQNYFEKLKNGEIRPVVKPQYVDLIPKAVKGKVIELLKKADETGKLEEVVKALEREIQHLSGGELQRVAIAAAFDEPSSYLDIRQRLNAARAIRRLSEEGKEHDLAVLDYLSDIIHVVYGEPGVYGIFSQPKGTRNGINEFLRRFRPYEIKFTKTGERVEIERETLVTYPRLVKDYGSFRLEVEPGEIKKGEVIGIVGP-KTTFVKMLAGVEEPTEGKIEWDLTVAYKPQYIKADYEGTVYELLSKIDASKLNSNFYKTELLKPLGIREVNELSGGELQRVAIAATLL----RDADIYLLDEPSAYLDVEQRLAVSRAIRHLMEKNEKTALVVEHDVLMYVSDRLM....................... 467
23 -10.9002ff7_A mol:protein length:247 Alpha-hemolysin translocation ATP-binding pro  ali model follow..  18  139............................................................................................................................................................................................................................................................................................................................................GLSGGQRQRIAIARAL----VNNPKILIFDEATSALDYESEHVIMRNMHKICKGRT-VIIIAHRLSTVKNADRIIVMEKGKEQGKHKEL......... 224
24 -10.7003j16_B mol:protein length:608 Rli1p  ali model follow..  11  104..........................QVLGLVGTNGIGKSTALKILAGKQGSELQNYFTKMLEDDIKAIIKPQYVPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIEKLSGGELQRFAIGMSCKQRLNAAQIIRSLLAPTKYVICVEHDLSVLDYLSDFVCIIYGVPSVYGVVTLPASVREGINIFLDGHIPAENLRFRTEALQFRIADATEDLQNDSASRAFSYPSLKKTQGDFVLNVEEGEFSDSEIKTTLIKLLAGALKPDEGQDIPKLNVSMKPQKIAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVKPLRIQEVQHLSGGELQRVAIVLALG----IPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMYLADKVI....................... 539
25 -10.6001mv5_A mol:protein length:243 Multidrug resistance ABC transporter ATP-bind  ali model follow..  20  139............................................................................................................................................................................................................................................................................................................................................KISGGQRQRLAIARAF----LRNPKILMLDEATASLDSESESMVQKALDSLMKGRTT-LVIAHRLSTIVDADKIYFI..................... 210
26 -10.6002iw3_A mol:protein length:986 ELONGATION FACTOR 3A  ali model follow..  14  438.............AYGAKILLNKTQLRLKGICGPNGCGKSTLMRAIA-----TQEECRTVYVEHDIDGTHSDTSVLDFVFESGVGTKEAIKDKLIEFGFTDEMIAMPISALSGGWKMKLAL-VNVAWLVNYLNTCGITSITISHDSVFLDN--CEYIINYEGLKLRKYKGNFTEFVKKCPAAKAYEELSNTDLEFKFPEPGYLEGVKTKQKAIKPQITDINFQCSLSSRIAVIQHAFAHIESHLDKTPEDRETMDRANRQINENDAEAMNKIFKPRGELVESHSKMVAEVDMKEALASGQFRPLTRKEIEEHCSM---LGLDPEIVSHSRIRGLSGGQKVKLVLAAGT----WQRPHLIVLDEPTNYLDRDSLGALSKALKEFEG----VIIITHSAEFTKNL........................... 958
27 -10.6002ghi_A mol:protein length:260 transport protein  ali model follow..  17  117................................................................................................................................................................................................................................................................................................KLDATDEEVIKATKSAQLYDFIEALPKKWDTIVGNKGMK------LSGGERQRIAIARCL----LKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRKNRTL-IIIAHRLSTISSAESIILL..................... 226
28 -10.4003bk7_A mol:protein length:607 ABC transporter ATP-binding protein  ali model follow..  12  81...FNAISIVNLNAFVLYRLPIVKDGMVVGIVGPNGTGKTTAVKILA---GQLIPNLCEDNDSWDNVIRAFRGNELQNYFERLKNGEIRPVVKPQYVDLLPKAVKGKVRELLKKVDEVGKFEEVVKEL--------ELENVLDRELHQLSGGELQRVAIAAALLRKAFFDEPSSYLDIRQKVARVIRRLANEGKAVLVVEHDLAVLDYLSDVITKLSERVDVERETLVEYPRLVKDYGSFKLEVEPGEIRKGEVIGIVGP-KTTFVKMLAGVEEPTEGKVEWDLTVAYKPQYIKAEYEGTVYELLSKIDSSKLNSNFYKTELLKPLGIRNVEDLSGGELQRVAIAATLL----RDADIYLLDEPSAYLDVEQRLAVSRAIRHLMEKNEKTALVVEHDVLMYVSDRLI....................... 543
29 -10.3002nq2_C mol:protein length:253 Hypothetical ABC transporter ATP-binding prot  ali model follow..  20  124........................................................................................................................................................................................................................................................................................................................................REFTSLSGGQRQLILIARAIA----SECKLILLDEPTSALDLANQDIVLSLLIDLAQSQNMTVVFTTHQ-LLNKQNFKFGETRNTSENLTALFHLPMF.... 230
30 -9.6304e40_A mol:protein length:252 Putative uncharacterized protein  ali model follow..  8...................................................ELEDSDDVAAACELRAQLAGVSIASGILLRPAVIRNATTEFSRKKSEDILAKGGAAVERASAAVDRVSGLDKTNETAQKVRKAAAVAHHALEHVKEEVEIKKVNEIIELTAGATEHAKGAKANGDASAVKVSNLLARAKESENQYVKEAAEECSESTNYDVTAKSLAAALDKLPGVKEDNAVKTTFQSILTSLDNLDKDVKSVEQRAEELETALEKA-ERQLEKAEKAAEEAETESSKVETE......................................................................................................................................... 250
31 -9.4902pzg_A mol:protein length:241 Cystic fibrosis transmembrane conductance reg  ali model follow..  18  118..............................................................................................................................................................................................................................................................................................................ACQLEEDISKFAEKDNIVLGEGG------ITLSGGQRARISLARAV----YKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKIL....................... 212
32 -9.3802pcj_A mol:protein length:224 Lipoprotein-releasing system ATP-binding prot  ali model follow..  20  139...........................................................................................................................................................................................................................................................................................................................................YELSGGEQQRVAIA-----RALANEPILLFDEPTGNLDSANTKRVMDIFLKINEGGTSIVMVTHERELAELTHRTLEM..................... 212
33 -9.2703vx4_A mol:protein length:273 Putative ABC transporter, ATP-binding protein  ali model follow..  22  166.......................................................................................................................................................................................................................................................................................................................................LSDGAGISGGQKQRIALARAL----LTQAPVLILDAATSSLDILTEKKIISNLLQMTEKTI--IFVAHRLSISQRTDEVI....................... 239
34 -9.2401jj7_A mol:protein length:260 PEPTIDE TRANSPORTER TAP1  ali model follow..  20  153...........................................................................................................................................................................................................................................................................................................................................SQLSGGQRQAVALARAL----IRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRVLLITQHLSLVEQADHILFL..................... 227
35 -9.2101b0u_A mol:protein length:262 HISTIDINE PERMEASE  ali model follow..  19  152...........................................................................................................................................................................................................................................................................................................................................VHLSGGQQQRVSIARALAM---EPD-VLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGF-HVSSHVIGKIEEE................. 234
36 -9.1204yms_J mol:protein length:240 ABC-type polar amino acid transport system, A  ali model follow..  23  135...........................................................................................................................................................................................................................................................................................................................................IKLSGGQKQRLAIARALAMQ----PEVMLFDEPTSALDPEMVKEVLNVMKQLANEGMTMVVVTHEMGF-EVGDRVIGVIVEEGT............... 219
37 -9.0604fye_A mol:protein length:761 SidF, inhibitor of growth family, member 3  ali model follow..  436....................................................VTKNQNARFVNQMTDDVIRNLDKVAQNLGDYDKAGA--LHTLLKGPDVSDLNQQITEKENALKEVKGAYREALFSYFEEYQKGEGKWDQAKLDQLKNQVDGYEKSIKKQESAIYELHNQIDALRKAYYTEHKG--QINKALQELKEQISPVIQNKETDPETKSRLQHFYNSCAYLTQAQELYYENTWHHGKNNF--KLQTLMASLSCELDYANTKGSKSNNDRGQRLAQKIV---------------GNALWTAMSEDGLYTGEFLDHRRTHGKEVSNVEQLDRE---LTTIQALHHTANTGVSGGKFEIQDKANFADNGLFGKVANFAKI-KEMGPENAFTKNMGTKIKA........................... 761

FFAS is supported by the NIH grant R01-GM087218-01
8 5 6 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.