current user: public




Query: 1unf_X mol:protein length:238 IRON SUPEROXIDE DISMUTASE, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .
# Score Template Links and tools%idFirst NVAGINLLFKEGPKVNAKFELKPPPYPLNGLEPVMSQQTLEFHWGKHHRTYVENLKKQVVGTELDGKSLEEIIVTAYNKGDILPAFNNAAQVWNHDFFWECMKPGGGGKPSGELLELIERDFGSFEKFLDEFKAAAATQFGSGWAWLAYKASKLDGENAANPPSADEDNKLVVIKSPNAVNPLVWGGYYPLLTIDVWEHAYYLDFQNRRPDYISVFMDKLVSWDAVSSRLEQAKALSALast
1 -123.0001unf_X mol:protein length:238 IRON SUPEROXIDE DISMUTASE  ali model  100  1NVAGINLLFKEGPKVNAKFELKPPPYPLNGLEPVMSQQTLEFHWGKHHRTYVENLKKQVVGTELDGKSLEEIIVTAYNKGDILPAFNNAAQVWNHDFFWECMKPGGGGKPSGELLELIERDFGSFEKFLDEFKAAAATQFGSGWAWLAYKASKLDGENAANPPSADEDNKLVVIKSPNAVNPLVWGGYYPLLTIDVWEHAYYLDFQNRRPDYISVFMDKLVSWDAVSSRLEQAKALSA 238
2 -109.0001my6_A mol:protein length:199 Iron (III) Superoxide Dismutase  ali model follow..  56  1.................AFVQEPLPFDPGALEPYMSAKTLEFHYGKHHKGYVDNLNKLTQDTELADKSLEDVIRTTYGDAAKVGIFNNAAQVWNHTFFWNSLKPGGGGVPTGDVAARINSAFGSYDEFKAQFKNAAATQFGSGWAWLVLE-----------------AGTLKVTKTANAENPLV-HGQVPLLTIDVWEHAYYLDYQNRRPDFIDNFLNQLVNWDFVAKNLAAA..... 199
3 -108.0002awp_A mol:protein length:198 Iron Super-Oxide Dismutase  ali model follow..  43  1................MAIILPKLKYALNALSPHISEETLNFHYNKHHAGYVNKLNGLIKDTPFATKSLVEIMKES-----TGAIFNNAAQIWNHSFYWDSMGPNCGGEPHGEIKEKIQEDFGSFNNFKNEFSNVLCGHFGSGWGWLVLN----------------NNNKLVILQTHDAGNPIKDNTGIPILTCDIWEHAYYIDYRNDRPSYVKAWWN-LVNWNFANENLKKALQ... 197
4 -108.0002bpi_A mol:protein length:206 FE-SUPEROXIDE DISMUTASE  ali model follow..  42  1................MVITLPKLKYALNALSPHISEETLNFHYNKHHAGYVNKLNTLIKDTPFAEKSLLDIVKES-----SGAIFNNAAQIWNHTFYWDSMGPDCGGEPHGEIKEKIQEDFGSFNNFKEQFSNILCGHFGSGWGWLALN----------------NNNKLVILQTHDAGNPIKDNTGIPILTCDIWEHAYYIDYRNDRASYVKAWWN-LVNWNFANENLKKAMQ... 197
5 -108.0002a03_A mol:protein length:206 Fe-superoxide dismutase homolog  ali model follow..  43  1..............MAMAITLPKLKYALNALSPHISEETLSFHYNKHHAGYVNKLNGLIKDTPLANKSLTDILKES-----TGAIFNNAAQIWNHSFYWDSMGPNCGGEPHGEIKEKIQEDFGSFNNFKDQFSNVLCGHFGSGWGWLALN----------------KNNKLVILQTHDAGNPIKENTGIPILTCDVWEHAYYIDYRNDRLSYVKAWWN-LVNWNFANENLKNALN... 199
6 -107.0002w7w_A mol:protein length:194 SUPEROXIDE DISMUTASE [FE]  ali model follow..  47  1................MSFELPALPFAKDALEPHISAETLDYHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIIKTS-----TGGVFNNAAQIWNHTFYWNCLAPNAGGQPTGAVAAAIDAAFGSFEEFKAKFTDSAINNFGSSWTWLVKN----------------ADGSLAIVNTSNAATPLTDEGVTPLLTVDLWEHAYYIDFRNVRPDYMGAFWS-LVNWSFVEENLAK...... 194
7 -107.0003lio_A mol:protein length:192 iron superoxide dismutase  ali model follow..  44  1.................AFELPSLPYAIDALEPHISKETLEFHHGKHHNTYVVKLNGLIPGTKFENKSLEEIVCSS-----DGGVFNNAAQIWNHTFYWNSLSPNGGGAPTGAVADAINAKWGSFDAFKEALNDKAVNNFGSSWTWLVKL----------------ADGSLDIVNTSNAATPLTDDGVTPILTVDLWEHAYYIDYRNVRPDYLKGFWS-LVNWEFANANFA....... 192
8 -106.0003js4_A mol:protein length:227 Superoxide dismutase  ali model follow..  47  1..MAMGTLEAQTQGPGSMFELSDLPY--EGLEPYISSHLLDRHYNGHHKTYVDVLNKLVVGTELGNESLGDIVVKAHNSSAGRAIFNNAAQIWNHDFYWQSMKPNGGGNPPEKLREMIEHSFGSVEGFNNAFTTSGLGQFGSGWVWLVYDE---------------DAKALKVVSTANADSPLLTQGQLPLATMDVWEHAYYLDYLNLRKKYIDVFLEHLLNWDFVLGRLEDAGV... 220
9 -106.0003tqj_A mol:protein length:210 Superoxide dismutase [Fe]  ali model follow..  50  1................MAFELPDLPYKLNALEPHISQETLEYHHGKHHRAYVNKLNKLIEGTPFEKEPLEEIIRKS-----DGGIFNNAAQHWNHTFYWHCMSPDGGGDPSGELASAIDKTFGSLEKFKALFTDSANNHFGSGWAWLVKD----------------NNGKLEVLSTVNARNPMT-EGKKPLMTCDVWEHAYYIDTRNDRPKYVNNFWQ-VVNWDFVMKNFKSENLYF. 198
10 -106.0001dt0_A mol:protein length:197 SUPEROXIDE DISMUTASE  ali model follow..  50  1.................AFELPPLPYAHDALQPHISKETLEFHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKTS-----SGGIFNNAAQVWNHTFYWNCLSPNAGGQPTGALADAINAAFGSFDKFKEEFTKTSVGTFGSGWGWLVKK----------------ADGSLALASTIGAGCPLT-IGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWN-LVNWAFVAEQFEGKTY... 195
11 -106.0001n0j_A mol:protein length:199 Superoxide dismutase [Mn]  ali model follow..  38  1................MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIA----LQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNK---------------ERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWN-VINWENVTERYMACKK... 199
12 -105.0002cdy_A mol:protein length:231 SUPEROXIDE DISMUTASE [MN]  ali model follow..  41  1..MSYYLESTSLYKKALAYTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQRVPADKKGALRNNAGGHANHSMFWQIMGQNGANQPSGELLDAINSAFGSFDAFKQKFEDAAKTRFGSGWAWLVVK-----------------DGKLDVVSTANQDNPLMGESGTPILGVDVWEHAYYLNYQNRRPDYLAAFWN-VVNWDEVSKRYAAAK.... 225
13 -105.0001qnn_A mol:protein length:191 SUPEROXIDE DISMUTASE  ali model follow..  48  1................MTHELISLPYAVDALAPVISKETVEFHHGKHLKTYVDNLNKLIIGTEFENADLNTIVQKS-----EGGIFNNAGQTLNHNLYFTQFRPGKGGAPKGKLGEAIDKQFGSFEKFKEEFNTAGTTLFGSGWVWLASD----------------ANGKLSIEKEPNAGNPVR-KGLNPLLGFDVWEHAYYLTYQNRRADHLKDLWS-IVDWDIVESRY........ 191
14 -105.0001szx_A mol:protein length:198 Superoxide dismutase [Mn], mitochondrial  ali model follow..  37  1.................KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIA----LQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGFGWLGFNK---------------ERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWN-VINWENVTERYMACKK... 198
15 -105.0001pm9_A mol:protein length:198 Superoxide dismutase [Mn], mitochondrial  ali model follow..  37  1.................KHSLPDLPYDYGALEPHINAQIMQLHHSKNHAAYVNNLNVTEEKYQEALAKGDVTAQIA----LQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNK---------------ERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYFLQYKNVRPDYLKAIWN-VINWENVTERYMACKK... 198
16 -104.0002rcv_A mol:protein length:202 Superoxide dismutase [Mn]  ali model follow..  46  1................MAYELPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAVEGTALANKSVEELVADSVPENIRTAVRNNGGGHANHKLFWTLLSPNGGGEPTGALAEEINSVFGSFDKFKEQFAAAAAGRFGSGWAWLVVN-----------------NGKLEITSTPNQDSPLS-EGKTPILGLDVWEHAYYLNYQNRRPDYISAFWN-VVNWDEVARLYSERK.... 202
17 -104.0001xuq_A mol:protein length:212 Superoxide dismutase  ali model follow..  44  1............GSSMAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGAELADKSVEELVANEVPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQPVGELATAIEAKFGSFDAFKEEFAKAGATRFGSGWAWLVVN-----------------NGELEVTSTPNQDSPLT-EGKTPVIGLDVWEHAYYLNYQNRRPDYIGAFWN-VVDWNAAEKRYQEAK.... 206
18 -104.0001isa_A mol:protein length:192 IRON(II) SUPEROXIDE DISMUTASE  ali model follow..  49  1.................SFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSS-----EGGVFNNAAQVWNHTFYWNCLAPNAGGEPTGKVAEAIAASFGSFADFKAQFTDAAIKNFGSGWTWLVKN----------------SDGKLAIVSTSNAGTPLT-TDATPLLTVDVWEHAYYIDYRNARPGYLEHFWA-LVNWEFVAKNLAA...... 192
19 -104.0001y67_A mol:protein length:229 Manganese Superoxide dismutase  ali model follow..  42  1...............MAAYTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQRVPADKKGALRNNAGGHANHSMFWQIMGQNGANQPSGELLDAINSAFGSFDAFKQKFEDAAKTRFGSGWAWLVVK-----------------DGKLDVVSTANQDNPLMGESGTPILGVDVWEHAYYLNYQNRRPDYLAAFWN-VVNWDEVSKRYAAAKLVPR 216
20 -104.0001xre_A mol:protein length:217 Superoxide dismutase  ali model follow..  39  1............GSSMSSFQLPKLSYDYDELEPYIDSNTLSIHHGKHHATYVNNLNAALENSELHNKSLEELLCNTLPKEIVTAVRNNGGGHYCHSLFWEVMSPRGGGEPNGDVAKVIDYYFNTFDNLKDQLSKAAISRFGSGYGWLVLD-----------------GEELSVMSTPNQDTPLQ-EGKIPLLVIDVWEHAYYLKYQNRRPEFVTNWWH-TVNWDRVNEKYLQAIQSQ. 209
21 -104.0002cw2_A mol:protein length:226 superoxide dismutase 1  ali model follow..  44  15TPVLRMGLARCFSSVTGPFQCPPLPYVKNALEPHMSAETLTYHHDKHHQTYVDTLNSIAANSTIASKTLEQIIKTE-----TGKPFNQAAQVYNHTFFFNNLAPNGGGEPTGKIAELITRDFGSFEKFKEDFSAAAVGHFGSGWVWLIAD-----------------DGKLKIVQGHDAGNPIR-ESKTPLMNIDVWEHAYYIDYRNARAQYVKNYWN-LVNWDFVNDNVAKAG.... 225
22 -104.0001mng_A mol:protein length:203 MANGANESE SUPEROXIDE DISMUTASE  ali model follow..  37  2................YPFKLPDLGYPYEALEPHIDAKTMEIHHQKHHGAYVTNLNAALEKYYLHGVEVEVLLRHALPQDIQTAVRNNGGGHLNHSLFWRLLTPGGAKEPVGELKKAIDEQFGGFQALKEKLTQAAMGRFGSGWAWLVKD----------------PFGKLHVLSTPNQDNPVM-EGFTPIVGIDVWEHAYYLKYQNRRADYLQAIWN-VLNWDVAEEFFKKA..... 203
23 -103.0003sdp_A mol:protein length:195 IRON SUPEROXIDE DISMUTASE  ali model follow..  49  1.................AFELPPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKSS-----SGGIFNNAAQVWNHTFYWNCLSPDAGGQPTGALADAINAAFGSFDKFKEEFTKTSVGTFGSGWAWLVKA-----------------DGSLALCSTIGAGAPLT-SGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWN-LVNWAFVAEEGKTFKA... 195
24 -103.0001jr9_A mol:protein length:202 manganese superoxide dismutase  ali model follow..  46  1................AKFELPELPYAYDALEPTIDKETMNIHHTKHHNTYVTKLNGALEGHDLKNKSLNDLISNAVPENIRTAVRNNGGGHANHSLFWKLMSPNGGGKPTGEVADKINDKYGSFEKFQEEFAAAAAGRFGSGWAWLVVN-----------------NGEIEIMSTPIQDNPLM-EGKKPILGLDVWEHAYYLKYQNKRPDYISAFWN-VVNWDEVAAQYSQAA.... 202
25 -103.0003esf_A mol:protein length:197 Iron-containing superoxide dismutase B2  ali model follow..  44  1................MAFSIPPLPWGYDGLAAKISKEQVTFHYDKHHMGYVTKLNAAANSNALAAKSVEEIIRTE-----KGPIFNLAAQIFNHNFYWESMSPNGGGEPSGKLAEAIRASFGSFAKFKEEFTNAAVGHFGSGWAWLVQDT---------------TTKKLKVFQTHDAGCPLTEADLKPILTCDVWEHAYYIDYKNDRPAYVQTFWN-VVNWDHAENQFTR...... 197
26 -103.0003h1s_A mol:protein length:195 Superoxide dismutase  ali model follow..  46  1.............SNAMKFELPKLPYAVDALESTISKETIEYHYGKHHQTYVTNLNNLVEGTEHDGRNLEEIVKTS-----NGGIFNNAAQVFNHTFYWNCLTPNKT-EASSQLKAALIETFGSVENFKEQFSKAAIATFGSGWAWLVKN----------------TEGKLEIVTTSNAGCPLT-ENKKPLLTFDVWEHAYYIDYRNARPKYVEALWD-IVNWQFVSEQFAD...... 195
27 -102.0002gpc_A mol:protein length:194 iron superoxide dismutase  ali model follow..  44  2..................FSIPPLPWGYDGLAAKLSKQQVTLHYDKHHQGYVTKLNAAAQNSALATKSIEEIIRTE-----KGPIFNLAAQIFNHTFYWESMCPNGGGEPTGKVADEINASFGSFAKFKEEFTNVAVGHFGSGWAWLVKDT---------------NSGKLKVYQTHDAGCPLTEPNLKPLLTCDVWEHAYYVDYKNDRAAYVQTFWN-VVNWKNVERQL........ 194
28 -101.0001wb7_A mol:protein length:210 SUPEROXIDE DISMUTASE [FE]  ali model follow..  31  1..........TLQIQFKKYELPPLPYKIDALEPYISKDIIDVHYNGHHKGFVNGANSLLERLEKVVKGDLQTGQYDI-QGIIRGLTFNINGHKLHALYWENMAPSGGGKPGGALADLINKQYGSFDRFKQVFTETANSLPGTGWAVLYYDT---------------ESGNLQIMTFENHFQNHI-AEIPIILILDEFEHAYYLQYKNKRADYVNAWWN-VVNWDAAEKKLQKYLT... 209
29 -100.0001p7g_A mol:protein length:222 Superoxide dismutase  ali model follow..  34  2........RGSGSVTTKRYTLPPLPYAYNALEPYISAEIMQLHHQKHHQGYVNGANAALEKLEKFRKGEAQIDIRAV----LRDLSFHLNGHILHSIFWPNMAPKGGGKPGGKIADLINKFFGSFEKFKEEFSQAAKNVEGVGWAILVYEP---------------LEEQLLILQIEKHNLMHA-ADAQVLLALDVWEHAYYLQYKNDRGSYVDNWWN-VVNWDDVERRLQKALNGQ. 211
30 -100.0001ma1_A mol:protein length:205 superoxide dismutase  ali model follow..  36  2...........NDLEKKFYELPELPYPYDALEPHISREQLTIHHQKHHQAYVDGANALLRKLDEARESDTDVDIKAA----LKELSFHVGGYVLHLFFWGNMGPECGGEPSGKLAEYIEKDFGSFERFRKEFSQAAISAEGSGWAVLTYCQ---------------RTDRLFIMQVEKHNVNVI-PHFRILLVLDVWEHAYYIDYRNVRPDYVEAFWN-IVNWKEVEKRFEDI..... 204
31 -100.0001d5n_A mol:protein length:205 PROTEIN (MANGANESE SUPEROXIDE DISMUTASE)  ali model follow..  41  1.................SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLEFANLPVEELITKQLPADKKTVLRNNAGGHANHSLFWKGLKK--GTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLK-----------------GDKLAVVSTANQDSPLMGESGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWN-VVNWDEAAARFAAKK.... 205
32 -100.0001gv3_A mol:protein length:248 MANGANESE SUPEROXIDE DISMUTASE  ali model follow..  34  20TTDKRSIGFIDRQLGTNPAELPPLPYGYDALEKAIDAETMKLHHDKHHAAYVNNLNNALKKPELQNSSVEALLRDSVPEDIRTTVRNNGGGHLNHTIFWQIMSPDGGGQPTGDIAQEINQTFGSFEEFKKQFNQAGGDRFGSGWVWLVRN----------------PQGQLQVVSTPNQDNPIM-EGSYPIMGNDVWEHAYYLRYQNRRPEYLNNWWN-VVNWSEINRRTQASRQSNS 242
33 -100.0003dc6_A mol:protein length:198 Superoxide dismutase [Mn] 1  ali model follow..  34  1................MKHSLPDLPYDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSKGNV----KEAIALQPALKFNGGGHINHSIFWTNLAKDGG-EPSAELLTAIKSDFGSLDNLQKQLSASTVAVQGSGWGWLGYCP---------------KGKILKVATCANQDPLEATTGLVPLFGIDVWEHAYYLQYKNVRPDYVNAIWK-IANWKNVSERFAKAQQ... 198
34 -100.0003cei_A mol:protein length:213 Superoxide dismutase  ali model follow..  42  2..................FTLRELPFAKDSMGDFLSPVAFDFHHGKHHQTYVNNLNNLIKGTDFEKSSLFAILTKS-----SGGVFNNAAQIYNHDFYWDCLSPKATA-LSDELKGALEKDFGSLEKFKEDFIKSATTLFGSGWNWAAYNL---------------DTQKIEIIQTSNAQTPVT-DKKVPLLVVDVWEHAYYIDHKNARPVYLEKFYG-HINWHFVSQCYEWAKKEGL 198
35 -100.0001gn2_A mol:protein length:207 SUPEROXIDE DISMUTASE  ali model follow..  34  1...............MAEYTLPDLDWDYGALEPHISGQINELHHSKHHATYVKGANDAVAKLEEARAKEDHSAIL----LNEKNLAFNLAGHVNHTIWWKNLSPNGGDKPTGELAAAIADAFGSFDKFRAQFHAAATTVQGCGWAALGWDT---------------LGNKLLIFQVYDHQTNFP-LGIVPLLLLDMWEHAFYLQYKNVKVDFAKAFWN-VVNWADVQSRYAAATSQT. 201
36 -99.6003ak1_A mol:protein length:214 Superoxide dismutase [Mn/Fe]  ali model follow..  37  2.............VSFKRYELPPLPYNYNALEPYIIEEIMKLHHQKHHNTYVKGANAALEKIEKHLKGEIQIDVRAV----MRDFSFNYAGHIMHTIFWPNMAPKGGGTPGGRVADLIEKQFGGFEKFKALFSAAAKTVEGVGWGVLAFDP---------------LTEELRILQVEKHNVLMT-AGLVPILVIDVWEHAYYLQYKNDRGSYVENWWN-VVNWDDVEKRLEQALNNAK 207
37 -99.6001b06_A mol:protein length:210 PROTEIN (SUPEROXIDE DISMUTASE)  ali model follow..  29  1..........TQVIQLKRYEFPQLPYKVDALEPYISKDIIDVHYNGHHKGYVNGANSLLDRLKLIKGDLPQGQYDL--QGILRGLTFNINGHKLHAIYWNNMAPKGGGKPGGALADLIDKQYGSFDRFKQVFSESANSLPGSGWTVLYYDN---------------ESGNLQIMTVENHFMNHI-AELPVILIVDEFEHAYYLQYKNKRGDYLNAWWN-VVNWDDAEKRLQKYLN... 209
38 -99.3003rn4_A mol:protein length:215 Superoxide dismutase [Mn], mitochondrial  ali model follow..  30  2..........STTARRTKVTLPDLKWDFGALEPYISGQINELHYTKHHQTYVNGFNTAVDQQELSDLLAKEPSPARKMIAIQQNIKFHGGGFTNHCLFWENLAPEGGEPPTGALAKAIDEQFGSLDELIKLTNTKLAGVQGSGWAFIVKNL--------------SNGGKLDVVQTYNQDTVTG--PLVPLVAIDAWEHAYYLQYQNKKADYFKAIWN-VVNWKEASRRFDAGK.... 214
39 -99.1004DVH Entity 1(prereleased)  ali follow..  41  1................APAELPKLGFNWDGCAPVFSPRQMELHYTKHHKAYVDKLNALA-GTTYDGKSIEEIILAVANDAEKKGLFNQAAQHFNHTFYFRCITPNGKAMP-KSLESAVTAQFGSVEQFKDAFVQAGVNNFGSGWTWLCVDP--------------SNKNQLVIDNTSNAGCPLT-KGLRPVLAVDVWEHAYYKDFENRRPDYLKEIWS-VIDWEFVAKMHAQAIK... 202
40 -99.0003bfr_A mol:protein length:215 Superoxide dismutase [Mn]  ali model follow..  30  1...............MGKVTLPDLKWDFGALEPYISGQINELHYTKHHQTYVNGFNTAVDQFELSDLLAKEPSPARKMIAIQQNIKFHGGGFTNHCLFWENLAPEGGEPPTGALAKAIDEQFGSLDELIKLTNTKLAGVQGSGWAFIVKNL--------------SNGGKLDVVQTYNQDTVTG--PLVPLVAIDAWEHAYYLQYQNKKADYFKAIWN-VVNWKEASRRFDAGK.... 208
41 -97.8001kkc_A mol:protein length:221 Manganese Superoxide Dismutase  ali model follow..  27  1...GTSPIQTPINTMSQQYTLPPLPYPYDALQPYISQQIMELHHKKHHQTYVNGLNAALEAQKKAAEATDVPKLV----SVQQAIKFNGGGHINHSLFWKNLAPEKSGDQAPVLKAAIEQRWGSFDKFKDAFNTTLLGIQGSGWGWLVTDG---------------PKGKLDITTTHDQDPVT---GAAPVFGVDMWEHAYYLQYLNDKASYAKGIWN-VINWAEAENRYIAGDKGG. 215
42 -97.3001ar4_A mol:protein length:201 SUPEROXIDE DISMUTASE  ali model follow..  33  1................AVYTLPELPYDYSALEPYISGEIMELHHDKHHKAYVDGANTALDKLEARDKADFGAINKL-----EKDLAFNLAGHVNHSVFWKNMAPKGSARPTDELGAAIDEFFGSFDNMKAQFTAAATGIQGSGWASLVWDP---------------LGKRINTLQFYDHQNNLP-AGSIPLLQLDMWEHAFYLQYKNVKGDYVKSWWN-VVNWDDVALRFSEARVA.. 201
43 -97.3003qvn_A mol:protein length:206 Manganese-containing superoxide dismutase  ali model follow..  26  2............ITENEKISLPKIDWALDALEPYISKEINDLHINKHHVAYVNGYNAAIDALEVGKRDLKSVVE------IQQNIKFHGGGHTNHSLFWKNLAPVSKGDTSSALGKQIVAQYGSVSNLIDITNSKLAGIQGSGWAFIVKNK--------------QNGGALDVVTTANQDTISA-PHLVPIIAIDAWEHAYYLQYQNVKLDYFKAIWN-VINWAEAESRYSA...... 206
44 -96.5003dc5_A mol:protein length:195 Superoxide dismutase [Mn] 2  ali model follow..  35  1................MKHTLPDLPFDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHVSKGNLKEAI------ALQPALKFNGGGHINHSIFWTNLAKDGG-EPSKELMDTIKRDFGSLDNLQKRLSDITIAVQGSGWGWLGYCK---------------KDKILKIATCANQDPLE---GMVPLFGIDVWEHAYYLQYKNVRPDYVHAIWK-IANWKNISERFANARQ... 195
45 -93.6001coj_A mol:protein length:212 PROTEIN (SUPEROXIDE DISMUTASE)  ali model follow..  28  2.................VHKLEPKDHLKPQNLEGISNEQIEPHFEAHYKGYVAKYNEIQEKLADQNFADRSKANQNYSEELKVEETFNYMGVVLHELYFGMLTPGGKGEPSEALKKKIEEDIGGLDACTNELKAAAM--AFRGWAILGLDI---------------FSGRLVVNGLDAHNVYNL-TGLIPLIVIDTYEHAYYVDYKNKRPPYIDAFFK-NINWDVVNERFEKAMKAYE 205
46 -91.9002cw3_A mol:protein length:280 iron superoxide dismutase  ali model follow..  30  61GLRAKPFVPSRSGVAPSSGLRMTLPYGLEALEPVISAATVDFHYNKHHQGYIQKLLDATG-LPESRINLKSLVTLG-PDRAGENVFNAAGQIYNHNMYWLSMVPTSGSHVPPRLLKLIRARWGNVDEMKENFMRKATALFGSGWIWLVWDT---------------RERRLDLVGTKDAHSPLSEDGKIPLFTCDVWEHAYYLDYQHDRAAYLTRWWS-LINWEFADSNLPSDIE... 280

FFAS is supported by the NIH grant R01-GM087218-01
5 7 0 7 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Grynberg M, Jaroszewski L, Godzik A. Domain analysis of the tubulin cofactor system: a model for tubulin folding and dimerization. BMC Bioinformatics. 2003 Oct 10;4(1):46.