current user: public




Query: 1unf_X mol:protein length:238 IRON SUPEROXIDE DISMUTASE, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .
# Score Template Links and tools%idFirst NVAGINLLFKEGPKVNAKFELKPPPYPLNGLEPVMSQQTLEFHWGKHHRTYVENLKKQVVGTELDGKSLEEIIVTAYNKGDILPAFNNAAQVWNHDFFWECMKPGGGGKPSGELLELIERDFGSFEKFLDEFKAAAATQFGSGWAWLAYKASKLDGENAANPPSADEDNKLVVIKSPNAVNPLVWGGYYPLLTIDVWEHAYYLDFQNRRPDYISVFMDKLVSWDAVSSRLEQAKALSALast
1 -131.0001unf_X mol:protein length:238 IRON SUPEROXIDE DISMUTASE  ali model  100  1NVAGINLLFKEGPKVNAKFELKPPPYPLNGLEPVMSQQTLEFHWGKHHRTYVENLKKQVVGTELDGKSLEEIIVTAYNKGDILPAFNNAAQVWNHDFFWECMKPGGGGKPSGELLELIERDFGSFEKFLDEFKAAAATQFGSGWAWLAYKASKLDGENAANPPSADEDNKLVVIKSPNAVNPLVWGGYYPLLTIDVWEHAYYLDFQNRRPDYISVFMDKLVSWDAVSSRLEQAKALSA 238
2 -114.0001my6_A mol:protein length:199 Iron (III) Superoxide Dismutase  ali model follow..  57  1.................AFVQEPLPFDPGALEPYMSAKTLEFHYGKHHKGYVDNLNKLTQDTELADKSLEDVIRTTYGDAAKVGIFNNAAQVWNHTFFWNSLKPGGGGVPTGDVAARINSAFGSYDEFKAQFKNAAATQFGSGWAWLVL-----------------EAGTLKVTKTANAENPLV-HGQVPLLTIDVWEHAYYLDYQNRRPDFIDNFLNQLVNWDFVAKNLAAA..... 199
3 -112.0003js4_A mol:protein length:227 Superoxide dismutase  ali model follow..  47  2...AMGTLEAQTQGPGSMFELSDLPY--EGLEPYISSHLLDRHYNGHHKTYVDVLNKLVVGTEFEGESLGDIVVKAHNGSAGRAIFNNAAQIWNHDFYWQSMKPNGGGNPPEKLREMIEHSFGSVEGFNNAFTTSGLGQFGSGWVWLVYD---------------EDAKALKVVSTANADSPLLTQGQLPLATMDVWEHAYYLDYLNLRKKYIDVFLEHLLNWDFVLGRLEDAGVL.. 221
4 -112.0002awp_A mol:protein length:198 Iron Super-Oxide Dismutase  ali model follow..  42  1................MAIILPKLKYALNALSPHISEETLNFHYNKHHAGYVNKLNGLIKDTPFATKSLVEIMKESTG-----AIFNNAAQIWNHSFYWDSMGPNCGGEPHGEIKEKIQEDFGSFNNFKNEFSNVLCGHFGSGWGWLVLN----------------NNNKLVILQTHDAGNPIKDNTGIPILTCDIWEHAYYIDYRNDRPSYVKAWWN-LVNWNFANENLKKALQK.. 198
5 -111.0002w7w_A mol:protein length:194 SUPEROXIDE DISMUTASE [FE]  ali model follow..  48  1................MSFELPALPFAKDALEPHISAETLDYHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIIKTSTG-----GVFNNAAQIWNHTFYWNCLAPNAGGQPTGAVAAAIDAAFGSFEEFKAKFTDSAINNFGSSWTWLVKNA----------------DGSLAIVNTSNAATPLTDEGVTPLLTVDLWEHAYYIDFRNVRPDYMGAFWS-LVNWSFVEENLAK...... 194
6 -111.0002a03_A mol:protein length:206 Fe-superoxide dismutase homolog  ali model follow..  43  1..............MAMAITLPKLKYALNALSPHISEETLSFHYNKHHAGYVNKLNGLIKDTPLANKSLTDILKESTG-----AIFNNAAQIWNHSFYWDSMGPNCGGEPHGEIKEKIQEDFGSFNNFKDQFSNVLCGHFGSGWGWLALN----------------KNNKLVILQTHDAGNPIKENTGIPILTCDVWEHAYYIDYRNDRLSYVKAWWN-LVNWNFANENLKNALNK.. 200
7 -111.0003lio_A mol:protein length:192 iron superoxide dismutase  ali model follow..  44  1.................AFELPSLPYAIDALEPHISKETLEFHHGKHHNTYVVKLNGLIPGTKFENKSLEEIVCSSDG-----GVFNNAAQIWNHTFYWNSLSPNGGGAPTGAVADAINAKWGSFDAFKEALNDKAVNNFGSSWTWLVKL----------------ADGSLDIVNTSNAATPLTDDGVTPILTVDLWEHAYYIDYRNVRPDYLKGFWS-LVNWEFANANFA....... 192
8 -110.0002bpi_A mol:protein length:206 FE-SUPEROXIDE DISMUTASE  ali model follow..  41  1................MVITLPKLKYALNALSPHISEETLNFHYNKHHAGYVNKLNTLIKDTPFAEKSLLDIVKESSG-----AIFNNAAQIWNHTFYWDSMGPDCGGEPHGEIKEKIQEDFGSFNNFKEQFSNILCGHFGSGWGWLALN----------------NNNKLVILQTHDAGNPIKDNTGIPILTCDIWEHAYYIDYRNDRASYVKAWWN-LVNWNFANENLKKAMQKL. 199
9 -110.0004yet_A mol:protein length:203 Superoxide dismutase  ali model follow..  41  2.............PGSMAFKLPALPYGMRELIPHISEETLSFHYGKHHAGYVNKLNSLIKGTPMESCTIEELILGQTG-----AVFNNAAQIWNHTFYWNSMGPNCGGEPTGPIRKKIEEKFGSFSAFKTDFSNLLAGHFGSGWGWLVLK----------------DDGTADIVQTHDAGSPLKENLGRPLLCCDVWEHAYYIDYKNDRLSYINSWWN-LVNWDFANKNLEAPFKWS. 203
10 -109.0003tqj_A mol:protein length:210 Superoxide dismutase [Fe]  ali model follow..  50  1................MAFELPDLPYKLNALEPHISQETLEYHHGKHHRAYVNKLNKLIEGTPFEKEPLEEIIRKSDG-----GIFNNAAQHWNHTFYWHCMSPDGGGDPSGELASAIDKTFGSLEKFKALFTDSANNHFGSGWAWLVK----------------DNNGKLEVLSTVNARNPMT-EGKKPLMTCDVWEHAYYIDTRNDRPKYVNNFWQ-VVNWDFVMKNFKSENLYFQ 199
11 -109.0001dt0_A mol:protein length:197 SUPEROXIDE DISMUTASE  ali model follow..  50  1.................AFELPPLPYAHDALQPHISKETLEFHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKTSSG-----GIFNNAAQVWNHTFYWNCLSPNAGGQPTGALADAINAAFGSFDKFKEEFTKTSVGTFGSGWGWLVKKA----------------DGSLALASTIGAGCPLT-IGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWN-LVNWAFVAEQFEGKTYKV. 197
12 -109.0001isa_A mol:protein length:192 IRON(II) SUPEROXIDE DISMUTASE  ali model follow..  49  1.................SFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSSEG-----GVFNNAAQVWNHTFYWNCLAPNAGGEPTGKVAEAIAASFGSFADFKAQFTDAAIKNFGSGWTWLVKN----------------SDGKLAIVSTSNAGTPLT-TDATPLLTVDVWEHAYYIDYRNARPGYLEHFWA-LVNWEFVAKNLAA...... 192
13 -108.0001qnn_A mol:protein length:191 SUPEROXIDE DISMUTASE  ali model follow..  49  1................MTHELISLPYAVDALAPVISKETVEFHHGKHLKTYVDNLNKLIIGTEFENADLNTIVQKSEG-----GIFNNAGQTLNHNLYFTQFRPGKGGAPKGKLGEAIDKQFGSFEKFKEEFNTAGTTLFGSGWVWLAS----------------DANGKLSIEKEPNAGNPVR-KGLNPLLGFDVWEHAYYLTYQNRRADHLKDLWS-IVDWDIVESRY........ 191
14 -108.0003sdp_A mol:protein length:195 IRON SUPEROXIDE DISMUTASE  ali model follow..  49  1.................AFELPPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKSS-----SGGIFNNAAQVWNHTFYWNCLSPDAGGQPTGALADAINAAFGSFDKFKEEFTKTSVGTFGSGWAWLVK-----------------ADGSLALCSTIGAGAPLT-SGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWN-LVNWAFVAEEGKTFKA... 195
15 -107.0003esf_A mol:protein length:197 Iron-containing superoxide dismutase B2  ali model follow..  44  1................MAFSIPPLPWGYDGLAAKISKEQVTFHYDKHHMGYVTKLNAAANSNALAAKSVEEIIRTE-----KGPIFNLAAQIFNHNFYWESMSPNGGGEPSGKLAEAIRASFGSFAKFKEEFTNAAVGHFGSGWAWLVQDT---------------TTKKLKVFQTHDAGCPLTEADLKPILTCDVWEHAYYIDYKNDRPAYVQTFWN-VVNWDHAENQFTR...... 197
16 -106.0003h1s_A mol:protein length:195 Superoxide dismutase  ali model follow..  47  3...............AMKFELPKLPYAVDALESTISKETIEYHYGKHHQTYVTNLNNLVEGTEHDGRNLEEIVKTSNG-----GIFNNAAQVFNHTFYWNCLTPNKTE-ASSQLKAALIETFGSVENFKEQFSKAAIATFGSGWAWLVK----------------NTEGKLEIVTTSNAGCPLT-ENKKPLLTFDVWEHAYYIDYRNARPKYVEALWD-IVNWQFVSEQFAD...... 195
17 -106.0002cw2_A mol:protein length:226 superoxide dismutase 1  ali model follow..  46  24.........RCFSSVTGPFQCPPLPYVKNALEPHMSAETLTYHHDKHHQTYVDTLNSIAANSTIASKTLEQIIKTETG-----KPFNQAAQVYNHTFFFNNLAPNGGGEPTGKIAELITRDFGSFEKFKEDFSAAAVGHFGSGWVWLIAD-----------------DGKLKIVQGHDAGNPIR-ESKTPLMNIDVWEHAYYIDYRNARAQYVKNYWN-LVNWDFVNDNVAKAG.... 225
18 -105.0002gpc_A mol:protein length:194 iron superoxide dismutase  ali model follow..  44  2..................FSIPPLPWGYDGLAAKLSKQQVTLHYDKHHQGYVTKLNAAAQNSALATKSIEEIIRTE-----KGPIFNLAAQIFNHTFYWESMCPNGGGEPTGKVADEINASFGSFAKFKEEFTNVAVGHFGSGWAWLVKDT---------------NSGKLKVYQTHDAGCPLTEPNLKPLLTCDVWEHAYYVDYKNDRAAYVQTFWN-VVNWKNVERQL........ 194
19 -105.0003cei_A mol:protein length:213 Superoxide dismutase  ali model follow..  42  2..................FTLRELPFAKDSMGDFLSPVAFDFHHGKHHQTYVNNLNNLIKGTDFEKSSLFAILTKSSG-----GVFNNAAQIYNHDFYWDCLSPKATA-LSDELKGALEKDFGSLEKFKEDFIKSATTLFGSGWNWAAYNL---------------DTQKIEIIQTSNAQTPVT-DKKVPLLVVDVWEHAYYIDHKNARPVYLEKFYG-HINWHFVSQCYEWAKK... 195
20 -104.0002cdy_A mol:protein length:231 SUPEROXIDE DISMUTASE [MN]  ali model follow..  41  8.........TSLYKKALAYTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQRVPADKKGALRNNAGGHANHSMFWQIMGQNGANQPSGELLDAINSAFGSFDAFKQKFEDAAKTRFGSGWAWLVV-----------------KDGKLDVVSTANQDNPLMGESGTPILGVDVWEHAYYLNYQNRRPDYLAAFWN-VVNWDEVSKRYAAAK.... 225
21 -103.0001y67_A mol:protein length:229 Manganese Superoxide dismutase  ali model follow..  42  1...............MAAYTLPQLPYAYDALEPHIDARTMEIHHTKHHQTYVDNANKALEGTEFADLPVEQLIQQRVPADKKGALRNNAGGHANHSMFWQIMGQNGANQPSGELLDAINSAFGSFDAFKQKFEDAAKTRFGSGWAWLVV-----------------KDGKLDVVSTANQDNPLMGESGTPILGVDVWEHAYYLNYQNRRPDYLAAFWN-VVNWDEVSKRYAAAKLVPR 216
22 -103.0004dvh_A mol:protein length:208 Superoxide dismutase  ali model follow..  41  2.................PAELPKLGFNWDGCAPVFSPRQMELHYTKHHKAYVDKLNALA-GTTYDGKSIEEIILAVANDAEKKGLFNQAAQHFNHTFYFRCITPNGKAMPKS-LESAVTAQFGSVEQFKDAFVQAGVNNFGSGWTWLCVDP--------------SNKNQLVIDNTSNAGCPLT-KGLRPVLAVDVWEHAYYKDFENRRPDYLKEIWS-VIDWEFVAKMHAQAIK... 202
23 -103.0001xuq_A mol:protein length:212 Superoxide dismutase  ali model follow..  44  1............GSSMAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGAELADKSVEELVANEVPEAIRTAVRNNGGGHANHTFFWTILSPNGGGQPVGELATAIEAKFGSFDAFKEEFAKAGATRFGSGWAWLVVN-----------------NGELEVTSTPNQDSPLT-EGKTPVIGLDVWEHAYYLNYQNRRPDYIGAFWN-VVDWNAAEKRYQEAK.... 206
24 -103.0002rcv_A mol:protein length:202 Superoxide dismutase [Mn]  ali model follow..  46  1................MAYELPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAVEGTALANKSVEELVADSVPENIRTAVRNNGGGHANHKLFWTLLSPNGGGEPTGALAEEINSVFGSFDKFKEQFAAAAAGRFGSGWAWLVVN-----------------NGKLEITSTPNQDSPLS-EGKTPILGLDVWEHAYYLNYQNRRPDYISAFWN-VVNWDEVARLYSERK.... 202
25 -103.0004f2n_A mol:protein length:230 Superoxide dismutase  ali model follow..  40  27............PHLRYPAELPTLGFNYDGIQPVMSPRQLELHYSKHHSAYVDKLNTLGKG--YEGKTIEEIILATTGINESKVMFNQAAQHFNHSFFWKCLSPGGKPMP-KTLENAIAKQFGSVDDFMVSFQQAGVNNFGSGWTWLCVDP---------------QTKELLIDSTSNAGCPLT-SGLRPIFTADVWEHAYYKDFENRRADYLKELWQ-IVDWEFVCHMYERATK... 230
26 -103.0001xre_A mol:protein length:217 Superoxide dismutase  ali model follow..  39  1............GSSMSSFQLPKLSYDYDELEPYIDSNTLSIHHGKHHATYVNNLNAALENSELHNKSLEELLCNTLPKEIVTAVRNNGGGHYCHSLFWEVMSPRGGGEPNGDVAKVIDYYFNTFDNLKDQLSKAAISRFGSGYGWLVLD-----------------GEELSVMSTPNQDTPLQ-EGKIPLLVIDVWEHAYYLKYQNRRPEFVTNWWH-TVNWDRVNEKYLQAIQ... 207
27 -102.0001jr9_A mol:protein length:202 manganese superoxide dismutase  ali model follow..  46  2.................KFELPELPYAYDALEPTIDKETMNIHHTKHHNTYVTKLNGALEGEDLKNKSLNDLISNAVPENIRTAVRNNGGGHANHSLFWKLMSPNGGGKPTGEVADKINDKYGSFEKFQEEFAAAAAGRFGSGWAWLVVN-----------------NGEIEIMSTPIQDNPLM-EGKKPILGLDVWEHAYYLKYQNKRPDYISAFWN-VVNWDEVAAQYSQA..... 201
28 -101.0001mng_A mol:protein length:203 MANGANESE SUPEROXIDE DISMUTASE  ali model follow..  38  3.................PFKLPDLGYPYEALEPHIDAKTMEIHHQKHHGAYVTNLNAALEKYYLHGVEVEVLLRHALPQDIQTAVRNNGGGHLNHSLFWRLLTPGGAKEPVGELKKAIDEQFGGFQALKEKLTQAAMGRFGSGWAWLVK----------------DPFGKLHVLSTPNQDNPVM-EGFTPIVGIDVWEHAYYLKYQNRRADYLQAIWN-VLNWDVAEEFFKKA..... 203
29 -100.0004yip_A mol:protein length:210 Superoxide dismutase [Mn/Fe]  ali model follow..  36  1................MAILLPDLPYAYDALEPYIDAETMTLHHDKHHATYVANANAALEKHPEIGENLEVLLADQIPADIRQSLINNGGGHLNHALFWELLSPEKT-KVTAEVAAAINEAFGSFDDFKAAFTAAATTRFGSGWAWLVV----------------DKEGKLEVTSTANQDTPIS-QGLKPILALDVWEHAYYLNYRNVRPNYIKAFFE-VINWNTVARLYAEALT... 202
30 -99.9004yio_A mol:protein length:208 Superoxide dismutase  ali model follow..  36  1................MAIILPDLPYAYDALEPYIDAETMTLHHDKHHATYVANANAALEKHPEIGEDLEALLADKIPADIRQALINNGGGHLNHALFWELLSPEKQ-EPTAEVAAAINEAFGSFEAFQEVFTTSATTRFGSGWAWLVV----------------NAEGKLEVVSTPNQDTPIS-DGKKPILALDVWEHAYYLKYRNVRPNYIKAFFE-IINWNKVAELYAEALE... 202
31 -99.5005a9g_A mol:protein length:236 MANGANESE SUPEROXIDE DISMUTASE  ali model follow..  39  21..........QGIDPFTQFKQTPLPYAYDALEGAIDAKTMEIHYSKHAAGYTANLNKAIAGTPAEKESIENILAKV--SQYSDAVRNNAGGHYNHELFWSILTPNKGTKPSAALQKAIDETFGSLDALKEKINAAGAARFGSGWAWLIV----------------DNGGKLQVTSTPNQDNPLMDEKGTPILGIDVWEHAYYLRYQNKRADYLTTIWD-VINWEEVSARYEKALKK.. 230
32 -99.0001d5n_A mol:protein length:205 PROTEIN (MANGANESE SUPEROXIDE DISMUTASE)  ali model follow..  41  1.................SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLEFANLPVEELITKQLPADKKTVLRNNAGGHANHSLFWKGLKK--GTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLK-----------------GDKLAVVSTANQDSPLMGESGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWN-VVNWDEAAARFAAKK.... 205
33 -98.1003tjt_A mol:protein length:208 Superoxide dismutase  ali model follow..  40  3...............NNKFKVKPLPYAYDALEPYIDKETMKLHHDKHYQAYVDKLNAALEKPELYNYSLCELLQNSLPKDIATTVRNNAGGAYNHKFFFDIMTPEKTI-PSESLKEAIDRDFGSFEKFKQEFQKSALDVFGSGWAWLVA----------------TKDGKLSIMTTPNQDSPVS-KNLTPIIGLDVWEHAYYLKYQNRRNEYIDNWFN-VVNWNGALENYKNLKS... 206
34 -97.5004h3e_A mol:protein length:241 Superoxide dismutase  ali model follow..  40  30............KPSGAPAELPKLGFNWDGCAPVFSPRQMELHYTKHHKAYVDKLNA-LAGTTYDGKSIEEIILAVANDAEKKGLFNQAAQHFNHTFYFRCITPNGKAMPKS-FESAVTAQFGSVEQFKDAFVQAGVNNFGSGWTWLCVDP--------------SNKNQLVIDNTSNAGCPLT-KGLRPVLAVDVWEHAYYKDFENRRPDYLKEIWS-VIDWEFVAKMHAQAIK... 235
35 -97.4002cw3_A mol:protein length:280 iron superoxide dismutase  ali model follow..  30  61GLRAKPFVPSRSGVAPSSGLRMTLPYGLEALEPVISAATVDFHYNKHHQGYIQKLLDAT-GLPESRINLKSLVTLG-PDRAGENVFNAAGQIYNHNMYWLSMVPTSGSHVPPRLLKLIRARWGNVDEMKENFMRKATALFGSGWIWLVWDT---------------RERRLDLVGTKDAHSPLSEDGKIPLFTCDVWEHAYYLDYQHDRAAYLTRWWS-LINWEFADSNLPSDIE... 280
36 -96.6001n0j_A mol:protein length:199 Superoxide dismutase [Mn]  ali model follow..  37  1................MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAK-----DVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNK---------------ERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWN-VINWENVTERYMACKK... 199
37 -95.5001gv3_A mol:protein length:248 MANGANESE SUPEROXIDE DISMUTASE  ali model follow..  35  29.........IDRQLGTNPAELPPLPYGYDALEKAIDAETMKLHHDKHHAAYVNNLNNALKKPELQNSSVEALLRDSVPEDIRTTVRNNGGGHLNHTIFWQIMSPDGGGQPTGDIAQEINQTFGSFEEFKKQFNQAGGDRFGSGWVWLVR----------------NPQGQLQVVSTPNQDNPIM-EGSYPIMGNDVWEHAYYLRYQNRRPEYLNNWWN-VVNWSEINRRTQASRQSNS 242
38 -94.9001szx_A mol:protein length:198 Superoxide dismutase [Mn], mitochondrial  ali model follow..  36  1.................KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAK-----DVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGFGWLGFNK---------------ERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWN-VINWENVTERYMACKK... 198
39 -94.8001pm9_A mol:protein length:198 Superoxide dismutase [Mn], mitochondrial  ali model follow..  36  1.................KHSLPDLPYDYGALEPHINAQIMQLHHSKNHAAYVNNLNVTEEKYQEALAK-----DVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNK---------------ERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYFLQYKNVRPDYLKAIWN-VINWENVTERYMACKK... 198
40 -92.0001wb7_A mol:protein length:210 SUPEROXIDE DISMUTASE [FE]  ali model follow..  30  1..........TLQIQFKKYELPPLPYKIDALEPYISKDIIDVHYNGHHKGFVNGANSLLEREKVVKGDLQTGQYDI--QGIIRGLTFNINGHKLHALYWENMAPSGGGKPGGALADLINKQYGSFDRFKQVFTETANSLPGTGWAVLYYDT---------------ESGNLQIMTFENHFQNHI-AEIPIILILDEFEHAYYLQYKNKRADYVNAWWN-VVNWDAAEKKLQKYLTK.. 210
41 -92.0003bfr_A mol:protein length:215 Superoxide dismutase [Mn]  ali model follow..  30  1...............MGKVTLPDLKWDFGALEPYISGQINELHYTKHHQTYVNGFNTAVDQQELSDLLAKEPSPARKMIAIQQNIKFHGGGFTNHCLFWENLAPEGGEPPTGALAKAIDEQFGSLDELIKLTNTKLAGVQGSGWAFIVKN--------------LSNGGKLDVVQTYNQDTVTG--PLVPLVAIDAWEHAYYLQYQNKKADYFKAIWN-VVNWKEASRRFDAGK.... 208
42 -91.8003rn4_A mol:protein length:215 Superoxide dismutase [Mn], mitochondrial  ali model follow..  30  2..........STTARRTKVTLPDLKWDFGALEPYISGQINELHYTKHHQTYVNGFNTAVDQQELSDLLAKEPSPARKMIAIQQNIKFHGGGFTNHCLFWENLAPEGGEPPTGALAKAIDEQFGSLDELIKLTNTKLAGVQGSGWAFIVKN--------------LSNGGKLDVVQTYNQDTVTG--PLVPLVAIDAWEHAYYLQYQNKKADYFKAIWN-VVNWKEASRRFDAGK.... 214
43 -91.6003dc6_A mol:protein length:198 Superoxide dismutase [Mn] 1  ali model follow..  34  1................MKHSLPDLPYDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSK-----NVKEAIALQPALKFNGGGHINHSIFWTNLAK-DGGEPSAELLTAIKSDFGSLDNLQKQLSASTVAVQGSGWGWLGYCP---------------KGKILKVATCANQDPLEATTGLVPLFGIDVWEHAYYLQYKNVRPDYVNAIWK-IANWKNVSERFAKAQQ... 198
44 -91.3001b06_A mol:protein length:210 PROTEIN (SUPEROXIDE DISMUTASE)  ali model follow..  29  1..........TQVIQLKRYEFPQLPYKVDALEPYISKDIIDVHYNGHHKGYVNGANSLLDREKLIKGDLPQGQYDL--QGILRGLTFNINGHKLHAIYWNNMAPKGGGKPGGALADLIDKQYGSFDRFKQVFSESANSLPGSGWTVLYYDN---------------ESGNLQIMTVENHFMNHI-AELPVILIVDEFEHAYYLQYKNKRGDYLNAWWN-VVNWDDAEKRLQKYLNK.. 210
45 -90.8004ffk_A mol:protein length:223 Superoxide dismutase  ali model follow..  32  1......MRGSGSVVSLKRYELPPLPYNYDALEPIISAETLRYHHDKHHLGYVNGANAALDKLE---KYLNGQLTDIDVRAVSRDFEFNYGGHILHTLYWLNMAPKGGGTPGGAIGDAINKFFGSFDKFKKLFGDAAKNVEGVGWAILAYDP---------------VTGDLRILQVEKHNNVVTT-NLIPLLAVDVFEHAYYIDYRNDRAKYVDSWWD-LINWDDVEARYQKALNTPK 214
46 -89.7003dc5_A mol:protein length:195 Superoxide dismutase [Mn] 2  ali model follow..  33  1................MKHTLPDLPFDYADLEPVISHEIMQLHHQKHHATYVNNLNQIEEKLHEAVSK-----NLKEAIALQPALKFNGGGHINHSIFWTNLAK-DGGEPSKELMDTIKRDFGSLDNLQKRLSDITIAVQGSGWGWLGYCK---------------KDKILKIATCANQDPLE---GMVPLFGIDVWEHAYYLQYKNVRPDYVHAIWK-IANWKNISERFANARQ... 195
47 -89.2001ma1_A mol:protein length:205 superoxide dismutase  ali model follow..  37  6...............KKFYELPELPYPYDALEPHISREQLTIHHQKHHQAYVDGANALLRKLDEARESDTDVDIKAA----LKELSFHVGGYVLHLFFWGNMGPECGGEPSGKLAEYIEKDFGSFERFRKEFSQAAISAEGSGWAVLTYCQ---------------RTDRLFIMQVEKHNVNVIP-HFRILLVLDVWEHAYYIDYRNVRPDYVEAFWN-IVNWKEVEKRFEDI..... 204
48 -89.2004c7u_A mol:protein length:225 SUPEROXIDE DISMUTASE [MN] 1, MITOCHONDRIAL  ali model follow..  32  12...........KKAGFMTFTLPDLPYDYGALEPAISGEIMQIHHQKHHQAYVTNYNNALEQDQAVNKGDASTVVKL-----QSAIKFNGGGHVNHSIFWKNLAPSGGEPPKGSLGSAIDAHFGSLEGLVKKMSAEGAAVQGSGWVWLGLDK---------------ELKKLVVDTTANQDPLVTKGGSVPLVGIDVWEHAYYLQYKNVRPEYLKNVWK-VINWKYASEVYEKENN... 219
49 -88.7001gn2_A mol:protein length:207 SUPEROXIDE DISMUTASE  ali model follow..  35  1...............MAEYTLPDLDWDYGALEPHISGQINELHHSKHHATYVKGANDAVAKEEARAKEDHSAILLN-----EKNLAFNLAGHVNHTIWWKNLSPNGGDKPTGELAAAIADAFGSFDKFRAQFHAAATTVQGCGWAALGWDT---------------LGNKLLIFQVYDHQTNFPL-GIVPLLLLDMWEHAFYLQYKNVKVDFAKAFWN-VVNWADVQSRYAAATSQT. 201
50 -88.3003qvn_A mol:protein length:206 Manganese-containing superoxide dismutase  ali model follow..  26  4..............ENEKISLPKIDWALDALEPYISKEINDLHINKHHVAYVNGYNAAIDALEKAVGKRD-----KSVVEIQQNIKFHGGGHTNHSLFWKNLAPVSKGDTSSALGKQIVAQYGSVSNLIDITNSKLAGIQGSGWAFIVKN--------------KQNGGALDVVTTANQDTISA-PHLVPIIAIDAWEHAYYLQYQNVKLDYFKAIWN-VINWAEAESRYSA...... 206
51 -87.3001ar4_A mol:protein length:201 SUPEROXIDE DISMUTASE  ali model follow..  33  2.................VYTLPELPYDYSALEPYISGEIMELHHDKHHKAYVDGANTALDKAEARDKADFGAINKL-----EKDLAFNLAGHVNHSVFWKNMAPKGSARPTDELGAAIDEFFGSFDNMKAQFTAAATGIQGSGWASLVWDP---------------LGKRINTLQFYDHQNNLPA-GSIPLLQLDMWEHAFYLQYKNVKGDYVKSWWN-VVNWDDVALRFSEARV... 200
52 -87.0004br6_A mol:protein length:197 SUPEROXIDE DISMUTASE  ali model follow..  36  1.................KATLPDLKYDYGALEPYISARIMELHHSKHHQTYVNGLNSALEATA----EAEAKGDFTKAASLAPLLNFHGGGHLNHTLFWENLAPEGGGEPDGALKKAIEADFGSFETFRKQMNAALTGIQGSGWAWLAKDK---------------DSGNLAIVTRANQDP--VTGQLVPLMGIDAWEHAYYLQYENRKAEYFEAIWN-VINWKTVAQRFEKA..... 197
53 -86.6001p7g_A mol:protein length:222 Superoxide dismutase  ali model follow..  32  2........RGSGSVTTKRYTLPPLPYAYNALEPYISAEIMQLHHQKHHQGYVNGANAALEKEKFRKGEAQIDIRAV-----LRDLSFHLNGHILHSIFWPNMAPKGGGKPGGKIADLINKFFGSFEKFKEEFSQAAKNVEGVGWAILVYEP---------------LEEQLLILQIEKHNLMHAA-DAQVLLALDVWEHAYYLQYKNDRGSYVDNWWN-VVNWDDVERRLQKALNGQ. 211
54 -85.7003ak1_A mol:protein length:214 Superoxide dismutase [Mn/Fe]  ali model follow..  38  6.................RYELPPLPYNYNALEPYIIEEIMKLHHQKHHNTYVKGANAALEKIEKHLKGEIQIDVRAV----MRDFSFNYAGHIMHTIFWPNMAPKGGGTPGGRVADLIEKQFGGFEKFKALFSAAAKTVEGVGWGVLAFDP---------------LTEELRILQVEKHNVLMTA-GLVPILVIDVWEHAYYLQYKNDRGSYVENWWN-VVNWDDVEKRLEQALNNA. 206
55 -85.1001kkc_A mol:protein length:221 Manganese Superoxide Dismutase  ali model follow..  27  1...GTSPIQTPINTMSQQYTLPPLPYPYDALQPYISQQIMELHHKKHHQTYVNGLNAALEAQKKAAEATD-----PKLVSVQQAIKFNGGGHINHSLFWKNLAPEKSGDQAPVLKAAIEQRWGSFDKFKDAFNTTLLGIQGSGWGWLVTDG---------------PKGKLDITTTHDQDPVT---GAAPVFGVDMWEHAYYLQYLNDKASYAKGIWN-VINWAEAENRYIAGDKGGH 216
56 -79.8001coj_A mol:protein length:212 PROTEIN (SUPEROXIDE DISMUTASE)  ali model follow..  28  2.................VHKLEPKDHLKPQNLEGISNEQIEPHFEAHYKGYVAKYNEIQEKADQNFADRSKANQNYSERELKVEETFNYMGVVLHELYFGMLTPGGKGEPSEALKKKIEEDIGGLDACTNELKAAAMA--FRGWAILGLDI---------------FSGRLVVNGLDAHNVYNLT-GLIPLIVIDTYEHAYYVDYKNKRPPYIDAFFK-NINWDVVNERFEKAMK... 202

FFAS is supported by the NIH grant R01-GM087218-01
8 5 9 5 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ma H, Xiong H, Liu T, Zhang L, Godzik A., Zhang Z. Aggregate formation and synaptic abnormality induced by DSCR1. J Neurochem. 2004 Mar;88(6):1485-96.