current user: public




Query: 1t00_A mol:protein length:112 Thioredoxin, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst SHMAGTLKHVTDDSFEQDVLKNDKPVLVDFWAAWCGPCRQIAPSLEAIAAEYGDKIEIVKLNIDENPGTAAKYGVMSIPTLNVYQGGEVAKTIVGAKPKAAIVRDLEDFIADLast
1 -83.4001t00_A mol:protein length:112 Thioredoxin  ali model  100  1SHMAGTLKHVTDDSFEQDVLKNDKPVLVDFWAAWCGPCRQIAPSLEAIAAEYGDKIEIVKLNIDENPGTAAKYGVMSIPTLNVYQGGEVAKTIVGAKPKAAIVRDLEDFIAD 112
2 -80.4001thx_A mol:protein length:115 THIOREDOXIN  ali model follow..  36  3TAMSKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLNN 114
3 -80.0001zcp_A mol:protein length:108 Thioredoxin 1  ali model follow..  51  1...SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCACAKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA. 108
4 -80.0001txx_A mol:protein length:108 PROTEIN (THIOREDOXIN)  ali model follow..  52  1...SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCVWCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA. 108
5 -79.9002eir_A mol:protein length:108 Thioredoxin 1  ali model follow..  54  1...SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKCFLDCNLA. 108
6 -79.9001keb_A mol:protein length:108 Thioredoxin 1  ali model follow..  53  1...SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKLIASILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA. 108
7 -79.8001srx_A mol:protein length:108 THIOREDOXIN  ali model follow..  51  1...SDKIIHLTDDSFDTDLVKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYIERGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA. 108
8 -79.4003dyr_A mol:protein length:111 Thioredoxin-1  ali model follow..  53  2...SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGTPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA. 109
9 -78.9002puk_C mol:protein length:106 Thioredoxin M-type, chloroplast (TRX-M)  ali model follow..  42  1.....EVQDVNDSSWKEFVLESEVPVMVDFWAPWCGPSKLIAPVIDELAKEYSGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAVPKSTLTDSIEKYLS. 106
10 -78.6001dby_A mol:protein length:107 CHLOROPLAST THIOREDOXIN M CH2  ali model follow..  52  2.....EAGAVNDDTFKNVVLESSVPVLVDFWAPWCGPCRIIAPVVDEIAGEYKDKLKCVKLNTDESPNVASEYGIRSIPTIMVFKGGKKCETIIGAVPKATIVQTVEKYLN. 107
11 -78.4002i1u_A mol:protein length:121 Thioredoxin  ali model follow..  49  8DSEKSATIKVTDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERATDLTVAKLDVDTNPETARNFQVVSIPTLILFKDGQPVKRIVGAKGKAALLRELSDVVPN 119
12 -78.1002i4a_A mol:protein length:107 thioredoxin  ali model follow..  46  1...SEHTLAVSDSSFDQDVLKASGLVLVDFWAEWCGPCKMIGPALGEIGKEFAGKVTVAKVNIDDNPETPNAYQVRSIPTLMLVRDGKVIDKKVGALPKSQLKAWVESA... 106
13 -78.0002o8v_B mol:protein length:128 Thioredoxin 1  ali model follow..  52  12GSHSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPAKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA. 122
14 -76.9001oaz_A mol:protein length:123 THIOREDOXIN 1  ali model follow..  55  1..MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA. 123
15 -76.5003VFI Entity 1(prereleased)  ali follow..  21  1......LRSLSDSDFQLEVRQHPDPIIIMFTGSWCQPCKKMKPTFEEMASQMEGDIRFAYMDAEDAEKTMAELNIRTLPSLALFVDGMIREVFSGTMNKSDLRYWINNNI.. 104
16 -76.2003tco_A mol:protein length:109 Thioredoxin (TrxA-1)  ali model follow..  32  1.KKEDVTLVLTEENFD-EVIRNNKLVLVDCWAEWCAPCHLYEPIYKKVAEKYKGKAVFGRLNVDENQKIADKYSVLNIPTTLIFVNGQLVDSLVGAVDEDTLESTVNKYLK. 109
17 -75.7002cvk_A mol:protein length:110 Thioredoxin  ali model follow..  45  2....AKPIEVTDQNFD-ETLGQHPLVLVDFWAEWCAPCRMIAPILEEIAKEYEGKLLVAKLDVDENPKTAMRYRVMSIPTVILFKDGQPVEVLVGAQPKRNYQAKIEKHLPA 108
18 -74.9001nw2_A mol:protein length:105 THIOREDOXIN  ali model follow..  48  1.....ATMTLTDANFQ-QAIQGDKPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGEPVKQLIGYQPKEQLEAQLADVLQ. 105
19 -74.8001nsw_A mol:protein length:105 THIOREDOXIN  ali model follow..  46  1.....ATMTLTDANFQ-QAIQGDGPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGRPVKQLIGYQPKEQLEAQLADVLQ. 105
20 -74.5002voc_A mol:protein length:112 THIOREDOXIN  ali model follow..  49  2.....AIVKATDQSFSAET--SEGVVLADFWAPWCGPSKMIAPVLEELDQEMGDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKDGEVVETSVGFKPKEALQELVNKHLLE 106
21 -74.5003gnj_A mol:protein length:111 Thioredoxin domain protein  ali model follow..  19  5.....SLEKLDTNTFEQLIYDEGKACLVMFSRKNCHVCQKVTPVLEELRLNYEESFGFYYVDVEEEKTLFQRFSLKGVPQILYFKDGEYKGKMAGDVEDDEVEQMIADVLED 111
22 -73.9002o7k_A mol:protein length:107 Thioredoxin  ali model follow..  49  5.....AIVKVTDADFDSKVESG--VQLVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL.. 107
23 -73.9002o89_A mol:protein length:107 Thioredoxin  ali model follow..  47  5.....AIVKVTDADFDSKVESG--VQLVDFWATWCGTSKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL.. 107
24 -73.8003hz4_A mol:protein length:140 Thioredoxin  ali model follow..  29  2SLNGSSIIEFEDMTWSQQVEDSKKPVVVMFYSPACPYCKAMEPYFEEYAKEYGSSAVFGRINIATNPWTAEKYGVQGTPTFKFFCHGRPVWEQVGQIYPSILKNAVRDMLQH 113
25 -73.4001uvz_A mol:protein length:119 THIOREDOXIN  ali model follow..  31  5..GSTTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG. 113
26 -71.5002l5l_A mol:protein length:136 Thioredoxin  ali model follow..  29  16KAEFLAKVYNFEKNPEEWKYEGDKPAIVDFYADWCGPCKMVAPILDELAKEYDGQIVIYKVDTEKEQELAGAFGIRSIPSILFIPMEGKPEMAQGAMPKASFKKAIDEFLLK 127
27 -70.9002e0q_A mol:protein length:104 thioredoxin  ali model follow..  38  1......VIHLDSKNFD-SFLASHEIAVVDFWAEWCAPCLILAPIIEELAEDY-PQVGFGKLNSDENPDIAARYGVMSLPTVIFFKDGEPVDEIIGAVPREEIEIRIKNLLGE 104
28 -70.9003hxs_A mol:protein length:141 Thioredoxin  ali model follow..  33  18EKPQSGTIHLTRAEFLKKIADGDKPAIVDFYADWCGPCKMVAPILEELSKEYAGKIYIYKVNVDKEPELARDFGIQSIPTIWFVPMKGEPQVNMGALSKEQLKGYIDKVLLK 140
29 -70.0003hhv_A mol:protein length:110 Thioredoxin (TrxA-2)  ali model follow..  35  2EKVKEPVKHLNSKNFD-EFITKNKIVVVDFWAEWCAPCLILAPVIEELANDY-PQVAFGKLNTEESQDIAMRYGIMSLPTIMFFKNGELVDQILGAVPREEIEVRLKSLL.. 109
30 -69.7003ul3_B mol:protein length:128 Thioredoxin  ali model follow..  17  25.....PRLQQNGSNIINGVNMKNTVIVLYFFAKWCQACTMQSTEMDKLQKYYGKRIYLLKVDLDKNESLARKFSVKSLPTIILLKNKTMLARKDHFVSSNDLIALIKKH... 128
31 -69.3003emx_A mol:protein length:135 Thioredoxin  ali model follow..  22  14..EDGRLIYITPEEFRQLL---QGDAILAVYSKTCPHCHRDWPQLIQASKEVDVPIVIGERELSAARLEMNKAGVEGTPTLVFYKEGRIVDKLVGATPWSLKVEKAREIYG. 126
32 -65.4002j23_A mol:protein length:121 THIOREDOXIN  ali model follow..  29  5LVPRGSVQVISSYDQFKQVTGGDKVVVIDFWATWCGPCKMIGPVFEKISDTPAGKVGFYKVDVDEQSQIAQEVGIRAMPTFVFFKNGQKIDTVVGADPS-KLQAAITQHSA. 115
33 -64.9003p2a_A mol:protein length:148 Putative thioredoxin-like protein  ali model follow..  33  36..FDGEVINATAETLD-KLLQDDLPMVIDFWAPWCGPCRSFAPIFAETAAERAGKVRFVKVNTEAEPALSTRFRIRSIPTIMLYRNGKMIDMLNGAVPKAPFDNWLDEQLSR 144
34 -64.8003aps_A mol:protein length:122 DnaJ homolog subfamily C member 10  ali model follow..  26  1..LPQASIDLTPQTFNEKVLQGKTHWVVDFYAPWCGPCQNFAPEFELLARMIKGKVRAGKVDCQAYPQTCQKAGIKAYPSVKLYQYERAKKSIWEEQINSRDAKTIAALIYG 110
35 -64.4001m7t_A mol:protein length:107 Chimera of Human and E. coli thioredoxin  ali model follow..  35  2......VKQIESKTAFQEALDADKLVVVDFSATWCGPCKMIKPFFHSLSEKYSN-VIFLEVDVDDAQDVAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL.. 106
36 -64.2002ppt_A mol:protein length:155 thioredoxin-2  ali model follow..  27  42AGLITGKVAGIDPAILARAERDDLPLLVDFWAPWCGPCRQMAPQFQAAAATLAGQVRLAKIDTQAHPAVAGRHRIQGIPAFILFHKGRELARAAGARPASELVGFVRGKLG. 152
37 -63.7001v98_A mol:protein length:140 thioredoxin  ali model follow..  37  29KTPLPWVVEADEKGFAQEVAGAP-LTLVDFFAPWCGPCRLVSPILEELARDHAGRLKVVKVNVDEHPGLAARYGVRSVPTLVLFRRGAPVATWVGASPRRVLEERLRPYLE. 138
38 -63.1001xwa_A mol:protein length:111 thioredoxin  ali model follow..  27  11.........KDKADLDGQLTKSGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAK-RLEDVIKANI.. 111
39 -62.9001ep7_A mol:protein length:112 THIOREDOXIN CH1, H-TYPE  ali model follow..  29  2...GSVIVIDSKAAWDAQLAKEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKVDVDAVAAVAEAAGITAMPTFHVYKDGVKADDLVGA-SQDKLKALVAKHAAA 112
40 -62.4002l6c_A mol:protein length:110 Thioredoxin  ali model follow..  17  2....SAIRDITTEAGMAHF-EGLSDAIVFFHKNLCPHCKNMEKVLDKFGARA-PQVAISSVDSEARPELMKELGFERVPTLVFIRDGKVAKVFSGIMNPRELQALYAS.... 103
41 -62.2003dxb_A mol:protein length:222 thioredoxin N-terminally fused to Puf60(UHM)  ali model follow..  53  2KPMSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAG 113
42 -61.7002dj0_A mol:protein length:137 Thioredoxin-related transmembrane protein 2  ali model follow..  21  5..SSGYIKYFNDKTIDEELERDRVTWIVEFFANWSNDCQSFAPIYADLSLKYNTGLNFGKVDVGRYTDVSTRYKVKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSE... 119
43 -61.2002oe0_A mol:protein length:114 Thioredoxin-3  ali model follow..  28  7.....SITKLTNLTEFRNLIKQNDKLVIDFYATWCGPCKMMQPHLTKLIQAY-PDVRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPT-ALEKGIKD.... 107
44 -60.3001syr_A mol:protein length:112 thioredoxin  ali model follow..  33  2....AMVKIVTSQAEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECSKTY-TKMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGA-NDSALKQLIEKYAA. 106
45 -60.3001r26_A mol:protein length:125 Thioredoxin  ali model follow..  26  9RARYPSVVDVYSVEQFRNIMSEDILTVAWFTAVWCGPCKTIERPMEKIAYEFP-TVKFAKVDADNNSEIVSKCRVLQLPTFIIARSGKMLGHVIGANPG-MLRQKLRDIIKD 118
46 -60.2002fa4_A mol:protein length:111 Thioredoxin II  ali model follow..  37  4......TQLKSASEYDSALASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQY-SDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPA-AIKQAIASNV.. 105
47 -59.8002l57_A mol:protein length:126 Uncharacterized protein  ali model follow..  17  4EGIKQINFQSINVVENLEEAKEGIPTIIMFKTDTCPYCVEMQKELSYVSKEREGKFNIYYARLEKNIDLAYKYDANIVPTTVFLKEGNKFYVHQGLMRKNNIETILNSLGVK 118
48 -59.7001x5d_A mol:protein length:133 Protein disulfide-isomerase A6  ali model follow..  31  3SGSSGDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSD 118
49 -59.2001faa_A mol:protein length:124 THIOREDOXIN F  ali model follow..  30  14EAIVGKVTEVNKDTFWPIVKAADKPVVLDMFTQWCGPCKAMAPKYEKLAEEYLD-VIFLKLDCNENKTLAKELGIRVVPTFKILKENSVVGEVTGAKYD-KLLEAIQAARS. 124
50 -59.2003f3q_A mol:protein length:109 Thioredoxin-1  ali model follow..  34  2......VTQFKTASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYP-QADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPA-AIKQAIAAN... 102
51 -58.7003d6i_A mol:protein length:112 Monothiol glutaredoxin-3  ali model follow..  22  4.....EINDQEQFTYLTTTAAGDKLIVLYFHTSWAEPCKALKQVFEAISNEPSSNVSFLSIDADENSEISELFEISAVPYFIIIHKGTILKELSGADPK-EYVSLLEDCKNS 110
52 -58.2002xbi_A mol:protein length:108 THIOREDOXIN  ali model follow..  31  1GSMSKLIELKQDGDLESLLEQHNKLVVVDFFATWCGPCKTIAPLFKELSEKY--DAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIA-KVEDMIKKFI.. 108
53 -58.0002xbq_A mol:protein length:117 THIOREDOXIN  ali model follow..  31  10VIMSELIELKQDGDLESLLEQHNKLVVVDFFATWCGPCKTIAPLFKELSEKY--DAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIA-KVEDMIKKFI.. 117
54 -57.9001x5c_A mol:protein length:121 Protein disulfide-isomerase  ali model follow..  27  6...SGPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVINGERTLDGFKKFLESGGQ. 115
55 -57.3002dml_A mol:protein length:130 Protein disulfide-isomerase A6  ali model follow..  23  14.SSSDDVIELTPSNFNREVIQSDGLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVNADKHQSLGGQYGVQGFPTIKIFGANKKPEDYQGGRTGEAIVDAALSALRS 125
56 -57.2002f51_A mol:protein length:118 thioredoxin  ali model follow..  29  1..MSDPIVHFTHEALLNRIKEAPGLVLVDFFATWCGPCQRLGQILPSIAEAN-KDVTFIKVDVDKNGNAADAYGVSSIPALFFVKKEGNEIKTLDQFDVSRIKADIEKF... 111
57 -57.2002vim_A mol:protein length:104 THIOREDOXIN  ali model follow..  33  2......RVLATAADLEKLINENGRLIVVDFFAQWCGPCRNIAPKVEALAKEI-PEVEFAKVDVDQNEEAAAKYSVTAMPTFVFIKDGKEVDRFSGA-NETKLRETITRH... 103
58 -57.0003qdn_A mol:protein length:287 Putative thioredoxin protein  ali model follow..  27  6...VQNIVNINESNLQQTLEQSTTPVLFYFWSERSQHCLQLTPVLESLAAQYHGQFILAKLDCDAEQMIAAQFGLRAIPTVYLFQNGQPVDGFQGPQPEEAIRALLDKVLPR 115
59 -56.7002dj3_A mol:protein length:133 Protein disulfide-isomerase A4  ali model follow..  25  6...SGPVKVVVGKTFDAIVMDPKKDVLIEFYAPWCGHCKQLEPIYTSLGKKYKGQLVIAKMDATANDITNDQYKVEGFPTIYFAPSGDKIKFEGGNRDLEHLSKFIDEHAT. 118
60 -56.5003qou_A mol:protein length:287 protein ybbN  ali model follow..  27  6...VENIVNINESNLQQVLEQSTTPVLFYFWSERSQHCLQLTPILESLAAQYNGQFILAKLDCDAEQMIAAQFGLRAIPTVYLFQNGQPVDGFQGPQPEEAIRALLDKVLPR 115
61 -56.1001ti3_A mol:protein length:113 thioredoxin H  ali model follow..  25  5QVIACHTVDTWKEHFE-KGKGSQKLIVVDFTASWCPPCKMIAPIFAELAKKF-PNVTFLKVDVDELKAVAEEWNVEAMPTFIFLKDGKLVDKTVGA-DKDGLPTLVAKHATA 113
62 -55.1003Q6O Entity 1(prereleased)  ali follow..  20  9.SPSDPLTLLQADTVRGAVLGSRSAWAVEFFASWCGHCIAFAPTWXGGSYLAREKGVAVRRVLNTEANVVRKFGVTDFPSCLLFRNGSVSRVPVLMESRSFYTAYLQRLSG. 127
63 -54.9002diz_A mol:protein length:117 Thioredoxin domain-containing protein 5  ali model follow..  23  3SGSSGTVLALTENNFDDTI--AEGITFIKFYAPWCGHCKTLAPTWEELSKKELAGVKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSLHRFVLSQAKD 115
64 -54.6001qgv_A mol:protein length:142 SPLICEOSOMAL PROTEIN U5-15KD  ali model follow..  21  1..MSYMLPHLNGWQVDQAILEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDK... 109
65 -54.3003ZZX Entity 1(prereleased)  ali follow..  26  7..........DQEDFTKQLNEANKLVVIDFYATWCGPCKMIAPKLEELSQSM-SDVVFLKVDVDECEDIAQDNQIACMPTFLFMKNGQKLDSLSGA-NYDKLLELVEKN... 104
66 -53.9002av4_A mol:protein length:160 Thioredoxin-like protein 4A (DIM1)  ali model follow..  13  11RGSSFMLQHLSGWAVDQAIVNEERLVCIRFGHDYDPDCMKMDELLYKVADDIKNFCVIYLVDITEVPDFNTMYELYDPVSVMFFYRNKHMMIDLGTGNNNKINWPMNNK... 121
67 -53.9002vm1_A mol:protein length:118 THIOREDOXIN H ISOFORM 1.  ali model follow..  26  3AEEGAVIACHTKQEFDTHMANTGKLVIIDFTASWCGPCRVIAPVFAEYAKKFPG-AIFLKVDVDELKDVAEAYNVEAMPTFLFIKDGEKVDSVVGGRKD-DIHTKIVALMGS 115
68 -53.7002diy_A mol:protein length:130 Thioredoxin-like protein 2  ali model follow..  22  15AAVAAVEEVGSAGQFEELLLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELP-QVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAP-ELTKKVQRHASS 125
69 -53.2003kd0_A mol:protein length:105 Thioredoxin  ali model follow..  25  7..........SKTAFQEALDAADKLVVVDFSATWCGPSKMIKPFFHSLSEKY-SNVIFLEVDVDDSQDVASESEVKSMPTFQFFKKGQKVGEFSGA-NKEKLEATINELV.. 105
70 -53.1001aiu_A mol:protein length:105 THIOREDOXIN  ali model follow..  24  7..........SKTAFQEALDAADKLVVVDFSATWCGPCKMIKPFFHSLSEKY-SNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGA-NKEKLEATINELV.. 105
71 -53.1001gh2_A mol:protein length:107 THIOREDOXIN-LIKE PROTEIN  ali model follow..  20  8..........SDPDFQPELSGASRLAVVKFTMRGCGPCLRIAPAFSSMSNKYP-QAVFLEVDVHQCQGTAATNNISATPTFQFFRNKVRIDQYQGA-DAVGLEEKIKQHL.. 106
72 -52.9003e3e_A mol:protein length:105 Thioredoxin  ali model follow..  24  7..........SKTAFQEALDAADKLVVVDFSATWCGPSKMIKPFFHSLSEKY-SNVIFLEVDVDDCQDVASECEVKRMPTFQFFKKGQKVGEFSGA-NKEKLEATINELV.. 105
73 -52.8001erv_A mol:protein length:105 THIOREDOXIN  ali model follow..  26  7..........SKTAFQEALDAADKLVVVDFSATWCGPCKMIKPFFHSLSEKY-SNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGA-NKEKLEATINELV.. 105
74 -52.7001cqg_A mol:protein length:105 THIOREDOXIN  ali model follow..  24  7..........SKTAFQEALDAADKLVVVDFSATWCGPAKMIKPFFHSLSEKY-SNVIFLEVDVDDAQDVASEAEVKATPTFQFFKKGQKVGEFSGA-NKEKLEATINELV.. 105
75 -52.6001erw_A mol:protein length:105 THIOREDOXIN  ali model follow..  23  7..........SKTAFQEALDAADKLVVVDFSATWSGPSKMIKPFFHSLSEKY-SNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGA-NKEKLEATINELV.. 105

FFAS is supported by the NIH grant R01-GM087218-01
5 7 1 5 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.