current user: public

anford Burnham Prebys Medical Discovery Institute

Query: 1t00_A mol:protein length:112 Thioredoxin, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
44 -64.0001m7t_A mol:protein length:107 Chimera of Human and E. coli thioredoxin  ali model follow..  36  2......VKQIESKTAFQEALDADKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVI-FLEVDVDDAQDVAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLV. 107
52 -57.2002dj0_A mol:protein length:137 Thioredoxin-related transmembrane protein 2  ali model follow..  22  3SGSSGYIKYFNDKTIDEELERDRVTWIVEFFANWSNDCQSFAPIYADLSLKYNTGLNFGKVDVGRYTDVSTRYKVKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFS.... 118
62 -49.0003f3q_A mol:protein length:109 Thioredoxin-1  ali model follow..  36  2......VTQFKTASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQ-ADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAA............ 94

FFAS is supported by the NIH grant R01-GM087218-01
9 0 0 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35