current user: public




Query: 1t00_A mol:protein length:112 Thioredoxin, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst SHMAGTLKHVTDDSFEQDVLKNDKPVLVDFWAAWCGPCRQIAPSLEAIAAEYGDKIEIVKLNIDENPGTAAKYGVMSIPTLNVYQGGEVAKTIVGAKPKAAIVRDLEDFIADLast
1 -83.3001t00_A mol:protein length:112 Thioredoxin  ali model  100  1SHMAGTLKHVTDDSFEQDVLKNDKPVLVDFWAAWCGPCRQIAPSLEAIAAEYGDKIEIVKLNIDENPGTAAKYGVMSIPTLNVYQGGEVAKTIVGAKPKAAIVRDLEDFIAD 112
2 -80.7001thx_A mol:protein length:115 THIOREDOXIN  ali model follow..  36  3TAMSKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLNN 114
3 -79.7003dyr_A mol:protein length:111 Thioredoxin-1  ali model follow..  53  2...SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGTPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAA 110
4 -79.6002eir_A mol:protein length:108 Thioredoxin 1  ali model follow..  54  1...SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKCFLDCNLA. 108
5 -79.5001srx_A mol:protein length:108 THIOREDOXIN  ali model follow..  51  1...SDKIIHLTDDSFDTDLVKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYIERGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA. 108
6 -79.5002i1u_A mol:protein length:121 Thioredoxin  ali model follow..  49  8DSEKSATIKVTDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERATDLTVAKLDVDTNPETARNFQVVSIPTLILFKDGQPVKRIVGAKGKAALLRELSDVVPN 119
7 -79.5001txx_A mol:protein length:108 PROTEIN (THIOREDOXIN)  ali model follow..  52  1...SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCVWCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA. 108
8 -79.5001zcp_A mol:protein length:108 Thioredoxin 1  ali model follow..  51  1...SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCACAKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA. 108
9 -79.4001keb_A mol:protein length:108 Thioredoxin 1  ali model follow..  53  1...SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKLIASILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA. 108
10 -79.3004hu7_A mol:protein length:108 Thioredoxin-1  ali model follow..  52  1...SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGACKMIAAILDEIADEYQGKLTVAKLNIDQNAGTAAKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA. 108
11 -79.2002o8v_B mol:protein length:128 Thioredoxin 1  ali model follow..  52  12GSHSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPAKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA. 122
12 -78.8002i4a_A mol:protein length:107 thioredoxin  ali model follow..  45  1...SEHTLAVSDSSFDQDVLKASGLVLVDFWAEWCGPCKMIGPALGEIGKEFAGKVTVAKVNIDDNPETPNAYQVRSIPTLMLVRDGKVIDKKVGALPKSQLKAWVESAQ.. 107
13 -78.6004wxt_A mol:protein length:125 Thioredoxin  ali model follow..  52  11.....ATIEVSDASFSTDVLASNKPVLVDFWATWCGPCKMVAPVLEEIASERGDHLTVAKLDVDANPETAQNFQVVSIPTLILFKDGQPVKRIVGAKGKAALLRELSDAVPN 117
14 -78.2004pob_A mol:protein length:117 Thioredoxin  ali model follow..  52  5...DHATVTVTDDSFQEDVVSSNKPVLVDFWATWCGPCKMVAPVLEEIAKDHGEALTIAKLDVDANPETARAFQVTSIPTLILFQNGEATKRIVGAKSKSALLRELDGVV.. 111
15 -77.7002yn1_A mol:protein length:106 LGPCA THIOREDOXIN  ali model follow..  60  2.....SIIHVTDDSFDQDVLKADKPVLVDFWAEWCGPCKMIAPILDEIAEEYEGKLKVAKVNIDENPETAAKYGIRGIPTLMLFKNGEVAATKVGALSKSQLKEFLDANL.. 106
16 -77.6001dby_A mol:protein length:107 CHLOROPLAST THIOREDOXIN M CH2  ali model follow..  52  2.....EAGAVNDDTFKNVVLESSVPVLVDFWAPWCGPCRIIAPVVDEIAGEYKDKLKCVKLNTDESPNVASEYGIRSIPTIMVFKGGKKCETIIGAVPKATIVQTVEKYLN. 107
17 -77.5004knd_A mol:protein length:112 Thioredoxin  ali model follow..  42  3AMASNDVVVLQDSTFEQEVLKSDTPVLVDFWAVWCGPCKAIAPVVDDLAARYKGKLKVAKMDVDQHQGVPQQYGIRSIPTLLVFKGGRVVDTVIGA-DKTRLEDSVKKAIG. 112
18 -77.2002yj7_A mol:protein length:106 LPBCA THIOREDOXIN  ali model follow..  55  2.....SVIEVTDENFEQEVLKSDKPVLVDFWAPWCGPCRMIAPIIEELAKEYEGKVKVVKVNVDENPNTAAQYGIRSIPTLLLFKNGQVVDRLVGAQPKEALKERIDKHL.. 106
19 -77.1002puk_C mol:protein length:106 Thioredoxin M-type, chloroplast (TRX-M)  ali model follow..  42  1.....EVQDVNDSSWKEFVLESEVPVMVDFWAPWCGPSKLIAPVIDELAKEYSGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAVPKSTLTDSIEKYLS. 106
20 -77.0004ba7_A mol:protein length:106 LBCA THIOREDOXIN  ali model follow..  55  2.....SVIEINDENFEEEVLKSDKPVLVDFWAPWCGPCRMIAPIIEELAEEYEGKVKFAKVNVDENPETAAKYGIMSIPTLLLFKNGEVVDKLVGARPKEALKERIEKHL.. 106
21 -76.3003ziv_A mol:protein length:106 AECA THIOREDOXIN  ali model follow..  47  2.....SVIEINDENFDEVIKKSDKVVVVDFWAEWCGPCRMIAPIIEELAEEYAGKVVFGKVNVDENPEIAAKYGIMSIPTLLFFKNGKVVDQLVGARPKEALKERIKKYL.. 106
22 -76.1003dxb_A mol:protein length:222 thioredoxin N-terminally fused to Puf60(UHM)  ali model follow..  54  4..MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAG 113
23 -76.0002ynx_A mol:protein length:106 LACA THIOREDOXIN  ali model follow..  48  2.....SVVQLNDENFDEVIKKNNKVVVVDFWAEWCGPCRMIAPIIEELAKEYAGKVVFGKLNVDENPEIAAKYGIMSIPTLLFFKNGKVVDQLVGAMPKEALKERIKKYL.. 106
24 -75.5003hz4_A mol:protein length:140 Thioredoxin  ali model follow..  29  2SLNGSSIIEFEDMTWSQQVEDSKKPVVVMFYSPACPYCKAMEPYFEEYAKEYGSSAVFGRINIATNPWTAEKYGVQGTPTFKFFCHGRPVWEQVGQIYPSILKNAVRDMLQH 113
25 -75.1003vfi_A mol:protein length:104 thioredoxin  ali model follow..  21  1......LRSLSDSDFQLEVRQHPDPIIIMFTGSWCQPCKKMKPTFEEMASQMEGDIRFAYMDAEDAEKTMAELNIRTLPSLALFVDGMIREVFSGTMNKSDLRYWINNNI.. 104
26 -74.5001nw2_A mol:protein length:105 THIOREDOXIN  ali model follow..  48  1.....ATMTLTDANFQ-QAIQGDKPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGEPVKQLIGYQPKEQLEAQLADVLQ. 105
27 -74.4002cvk_A mol:protein length:110 Thioredoxin  ali model follow..  45  2....AKPIEVTDQNFD-ETLGQHPLVLVDFWAEWCAPCRMIAPILEEIAKEYEGKLLVAKLDVDENPKTAMRYRVMSIPTVILFKDGQPVEVLVGAQPKRNYQAKIEKHLPA 108
28 -74.3001nsw_A mol:protein length:105 THIOREDOXIN  ali model follow..  46  1.....ATMTLTDANFQ-QAIQGDGPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGRPVKQLIGYQPKEQLEAQLADVLQ. 105
29 -74.2001oaz_A mol:protein length:123 THIOREDOXIN 1  ali model follow..  55  1..MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA. 123
30 -74.1003tco_A mol:protein length:109 Thioredoxin (TrxA-1)  ali model follow..  32  1.KKEDVTLVLTEENFD-EVIRNNKLVLVDCWAEWCAPCHLYEPIYKKVAEKYKGKAVFGRLNVDENQKIADKYSVLNIPTTLIFVNGQLVDSLVGAVDEDTLESTVNKYL.. 108
31 -73.0004xhm_A mol:protein length:137 Thioredoxin (Trx-3)  ali model follow..  40  29RKVLDSPVKLNSSNFD-ETLKNNENVVVDFWAEWCHPCKMIAPVIEELAKEYAGKVVFGKLNTDENPTIAARYGISAIPTLIFFKKGKPVDQLVGAMPKSELKRWVQRNL.. 137
32 -72.7002voc_A mol:protein length:112 THIOREDOXIN  ali model follow..  49  2.....AIVKATDQSFSAET--SEGVVLADFWAPWCGPSKMIAPVLEELDQEMGDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKDGEVVETSVGFKPKEALQELVNKHLLE 106
33 -72.4003gnj_A mol:protein length:111 Thioredoxin domain protein  ali model follow..  19  5.....SLEKLDTNTFEQLIYDEGKACLVMFSRKNCHVCQKVTPVLEELRLNYEESFGFYYVDVEEEKTLFQRFSLKGVPQILYFKDGEYKGKMAGDVEDDEVEQMIADVLED 111
34 -72.1002o7k_A mol:protein length:107 Thioredoxin  ali model follow..  49  5.....AIVKVTDADFDSKVESG--VQLVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL.. 107
35 -72.1002o89_A mol:protein length:107 Thioredoxin  ali model follow..  47  5.....AIVKVTDADFDSKVESG--VQLVDFWATWCGTSKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL.. 107
36 -71.2002mcs_A mol:protein length:128 Thioredoxin  ali model follow..  33  11QGPGSMIEQIGDSEFDNKVTSDNILILVDFWAPWCGPCRSLEPQLEKLAQQYTENVKIYKINIEDNQDVATQYGVSAIPTILMFKNGKKLSQVIGADISKIISEINNN.... 120
37 -70.8001uvz_A mol:protein length:119 THIOREDOXIN  ali model follow..  31  2RGSGSTTFNIQDPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG. 113
38 -68.7002e0q_A mol:protein length:104 thioredoxin  ali model follow..  38  1......VIHLDSKNFD-SFLASHEIAVVDFWAEWCAPCLILAPIIEELAEDY-PQVGFGKLNSDENPDIAARYGVMSLPTVIFFKDGEPVDEIIGAVPREEIEIRIKNLLGE 104
39 -68.6003hhv_A mol:protein length:110 Thioredoxin (TrxA-2)  ali model follow..  35  2EKVKEPVKHLNSKNFD-EFITKNKIVVVDFWAEWCAPCLILAPVIEELANDY-PQVAFGKLNTEESQDIAMRYGIMSLPTIMFFKNGELVDQILGAVPREEIEVRLKSLL.. 109
40 -68.3004o32_A mol:protein length:138 Thioredoxin  ali model follow..  16  31.....PRLQQNGSNIINGVNMKNTVIVLYFFAKWCQACTMQSTEMDKLQKYYGKRIYLLKVDLDKNESLARKFSVKSLPTIILLKNKTMLARKDHFVSSNDLIALIKKHLVP 137
41 -65.7003aps_A mol:protein length:122 DnaJ homolog subfamily C member 10  ali model follow..  26  1..LPQASIDLTPQTFNEKVLQGKTHWVVDFYAPWCGPCQNFAPEFELLARMIKGKVRAGKVDCQAYPQTCQKAGIKAYPSVKLYQYERAKKSIINSRDAKTIAALIYGKLET 114
42 -64.5002l5l_A mol:protein length:136 Thioredoxin  ali model follow..  33  5TEGNGKVIHLTKAEFLAKVYEGDKPAIVDFYADWCGPCKMVAPILDELAKEYDGQIVIYKVDTEKEQELAGAFGIRSIPSILFIPMEGKPEMAQGAMPKASFKKAIDEFL.. 125
43 -64.1003hxs_A mol:protein length:141 Thioredoxin  ali model follow..  33  18EKPQSGTIHLTRAEFLKKIYLGDKPAIVDFYADWCGPCKMVAPILEELSKEYAGKIYIYKVNVDKEPELARDFGIQSIPTIWFVPMKGEPQVNMGALSKEQLKGYIDKVL.. 138
44 -64.0001m7t_A mol:protein length:107 Chimera of Human and E. coli thioredoxin  ali model follow..  36  2......VKQIESKTAFQEALDADKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVI-FLEVDVDDAQDVAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLV. 107
45 -63.3002j23_A mol:protein length:121 THIOREDOXIN  ali model follow..  29  5LVPRGSVQVISSYDQFKQVTGGDKVVVIDFWATWCGPCKMIGPVFEKISDTPAGKVGFYKVDVDEQSQIAQEVGIRAMPTFVFFKNGQKIDTVVGADPS-KLQAAITQHSA. 115
46 -61.6003emx_A mol:protein length:135 Thioredoxin  ali model follow..  22  14..EDGRLIYITPEEFRQLL---QGDAILAVYSKTCPHCHRDWPQLIQASKEVDVPIVIGERELSAARLEMNKAGVEGTPTLVFYKEGRIVDKLVGATPWSLKVEKAREIYGG 127
47 -61.0002yoi_A mol:protein length:106 LECA THIOREDOXIN  ali model follow..  37  6.........TNKEEFEAILSEADKLVVVDFFATWCGPCKMIAPFFEELSEEYPDKVVFIKVDVDEVPDVAAKYGITSMPTFKFFKNGKKVDELVGA-NQEKLKQMILKHAP. 106
48 -59.4002lrc_A mol:protein length:114 Probable thioredoxin  ali model follow..  16  2.....KTRYSAEAPARDELDRLAGPTLVEFGTDWCGHCQAAQPLLAEVFSDYPE-VGHLKVEDGPGRRLGRSFQVKLWPTFVFLRDGREVARVVRPGSASVLEEAFESLVGE 107
49 -58.5002l6c_A mol:protein length:110 Thioredoxin  ali model follow..  17  2....SAIRDITTEAGM-AHFEGLSDAIVFFHKNLCPHCKNMEKVLDKFGARA-PQVAISSVDSEARPELMKELGFERVPTLVFIRDGKVAKVFSGIMNPRELQALYAS.... 103
50 -57.5001v98_A mol:protein length:140 thioredoxin  ali model follow..  38  33....PWVVEADEKGFAQEVAGAP-LTLVDFFAPWCGPCRLVSPILEELARDHAGRLKVVKVNVDEHPGLAARYGVRSVPTLVLFRRGAPVATWVGASPRRVLEERLRPYLEG 139
51 -57.4002l57_A mol:protein length:126 Uncharacterized protein  ali model follow..  21  2.....SLEGIKQINFQSEEAKEGIPTIIMFKTDTCPYCVEMQKELSYVSKEREGKFNIYYARLEENIDLAYKYDANIVPTTVFLKEGNKFYVHQGLMRKNNIETILNSLGVK 118
52 -57.2002dj0_A mol:protein length:137 Thioredoxin-related transmembrane protein 2  ali model follow..  22  3SGSSGYIKYFNDKTIDEELERDRVTWIVEFFANWSNDCQSFAPIYADLSLKYNTGLNFGKVDVGRYTDVSTRYKVKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFS.... 118
53 -57.0004kca_A mol:protein length:692 Endo-1,5-alpha-L-arabinanase  ali model follow..  54  1..MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAG 110
54 -56.7002f51_A mol:protein length:118 thioredoxin  ali model follow..  29  1..MSDPIVHFTHEALLNRIKEAPGLVLVDFFATWCGPCQRLGQILPSIAEAN-KDVTFIKVDVDKNGNAADAYGVSSIPALFFVKKEGNEIKTLDQFDVSRIKADIEKF... 111
55 -54.2004ruv_A mol:protein length:114 Thioredoxin  ali model follow..  25  1....GSMQSIKSNESFKSVINSDTPVIVKFEAGWCPDCRAMDLWIDPIVEQY-NDYQWYTVNRDELEDVVVENEVMGIPSLLVFKNGDKIAHLHSANAKSQVESFLAETF.. 107
56 -53.0003qdn_A mol:protein length:287 Putative thioredoxin protein  ali model follow..  27  6...VQNIVNINESNLQQTLEQSTTPVLFYFWSERSQHCLQLTPVLESLAAQYHGQFILAKLDCDAEQMIAAQFGLRAIPTVYLFQNGQPVDGFQGPQPEEAIRALLDKVLPR 115
57 -52.8003qou_A mol:protein length:287 protein ybbN  ali model follow..  27  6...VENIVNINESNLQQVLEQSTTPVLFYFWSERSQHCLQLTPILESLAAQYNGQFILAKLDCDAEQMIAAQFGLRAIPTVYLFQNGQPVDGFQGPQPEEAIRALLDKVLPR 115
58 -52.2003p2a_A mol:protein length:148 Putative thioredoxin-like protein  ali model follow..  33  36..FDGEVINATAETLDK-LLQDDLPMVIDFWAPWCGPCRSFAPIFAETAAERAGKVRFVKVNTEAEPALSTRFRIRSIPTIMLYRNGKMIDMLNGAVPKAPFDNWLDEQLSR 144
59 -51.1002ppt_A mol:protein length:155 thioredoxin-2  ali model follow..  30  53...........DPAILARAERDDLPLLVDFWAPWCGPCRQMAPQFQAAAATLAGQVRLAKIDTQAHPAVAGRHRIQGIPAFILFHKGRELARAAGARPASELVGFVRGKLGA 153
60 -49.7002fa4_A mol:protein length:111 Thioredoxin II  ali model follow..  39  8..........SASEYDSALASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQYSD-AAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAA-IKQAIASNV.. 105
61 -49.1001r26_A mol:protein length:125 Thioredoxin  ali model follow..  26  9RARYPSVVDVYSVEQFRNIMSEDILTVAWFTAVWCGPCKTIERPMEKIAYEFPT-VKFAKVDADNNSEIVSKCRVLQLPTFIIARSGKMLGHVIGANPG-MLRQKLRDIIKD 118
62 -49.0003f3q_A mol:protein length:109 Thioredoxin-1  ali model follow..  36  2......VTQFKTASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQ-ADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAA............ 94
63 -49.0001qgv_A mol:protein length:142 SPLICEOSOMAL PROTEIN U5-15KD  ali model follow..  21  1..MSYMLPHLNGWQVDQAILSEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMED.... 108
64 -48.7004dss_B mol:protein length:112 Thioredoxin-2  ali model follow..  36  1..MGMVTQLKSASEYDSALASGDKLVVVDFFATWCGPSKMIAPMIEKFAEQYSD-AAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAA-IKQAIASNV.. 106
65 -48.7002ypm_A mol:protein length:106 LAFCA THIOREDOXIN  ali model follow..  35  7..........NKDEFESILSEADKLVVVDFTATWCGPCKMIAPKFEELSEEYPDNVVFLKVDVDEVEDVAAEYGISAMPTFQFFKNGKKVDELTGA-NQEKLKAMIKKHAA. 106
66 -48.2001xbs_A mol:protein length:149 Dim1-like protein  ali model follow..  15  1..MSFLLPKLSKKEVDQAIKTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKT.... 108
67 -47.9002av4_A mol:protein length:160 Thioredoxin-like protein 4A (DIM1)  ali model follow..  13  11RGSSFMLQHLSGWAVDQAIVNEERLVCIRFGHDYDPDCMKMDELLYKVADDIKNFCVIYLVDITEVPDFNTMYELYDPVSVMFFYRNKHMMIDLGTGNNNKINWPMNN.... 120
68 -47.3004j56_E mol:protein length:114 Thioredoxin  ali model follow..  33  3...SGSVKIVTSQAEFDSIISQNELVIVDFFAEWCGPSKRIAPFYEECSKTYT-KMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGA-NDSALKQLIEKYAA. 108
69 -47.3004cw9_A mol:protein length:109 THIOREDOXIN  ali model follow..  31  2.....AVLHINALDQLTALLSTEKVIVIDFFATWCGPSRSISPYFEELAGQYNN-IKFVKVDVDQAEEICVNYKVRSMPTFVLVKDGIEQKRFSGADRNA............ 95
70 -46.9001syr_A mol:protein length:112 thioredoxin  ali model follow..  33  2....AMVKIVTSQAEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECSKTYT-KMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGA-NDSALKQLIEKYAA. 106
71 -46.7002mmn_A mol:protein length:104 Thioredoxin  ali model follow..  34  1.....SVKIVTSQSEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECSKTYT-KMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGA-NDSALKQLIEKYAA. 104
72 -46.7002oe0_A mol:protein length:114 Thioredoxin-3  ali model follow..  29  2GSSYTSITKLTNLTEFRNLIKQNDKLVIDFYATWCGPCKMMQPHLTKLIQAYPD-VRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPTA............ 100
73 -46.3003jcm_L mol:protein length:143 Spliceosomal protein DIB1  ali model follow..  17  1..MASVLLPRTGWHVDQAIVTEKRLVVIRFGRKNDRQCMIMDELLSSIAERVRNFAVIYLCDIDEVSDFDEMYELTDPMTVMFFYHNKHMMCDFGTGNNNKLNFIVDDK... 110
74 -46.0004euy_A mol:protein length:105 Uncharacterized protein  ali model follow..  14  1.....GMNTFKTIEELATYIEEQQLVLLFIKTENCGVCDVMLRKVNYVLENY-NYVEKIEILLQDMQEIAGRYAVFTGPTVLLFYNGKEILRESRFISLENLERTIQLFE.. 104
75 -45.9001xwa_A mol:protein length:111 thioredoxin  ali model follow..  27  12..........DKADLDGQLTKAGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGA-NAKRLEDVIKANI.. 111

FFAS is supported by the NIH grant R01-GM087218-01
8 5 6 6 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.