current user: public




1syrA
Query: 1syr_A mol:protein length:112 thioredoxin, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MAMVKIVTSQAEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECSKTYTKMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGANDSALKQLIEKYAALast
1 -71.7001syr_A mol:protein length:112 thioredoxin  ali model  100  1MAMVKIVTSQAEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECSKTYTKMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGANDSALKQLIEKYAA 106
2 -68.0002j23_A mol:protein length:121 THIOREDOXIN  ali model follow..  40  8RGSVQVISSYDQFKQVTGGDKVVVIDFWATWCGPCKMIGPVFEKISDTPDKVGFYKVDVDEQSQIAQEVGIRAMPTFVFFKNGQKIDTVVGADPSKLQAAITQHSA 115
3 -67.4003f3q_A mol:protein length:109 Thioredoxin-1  ali model follow..  47  1..MVTQFKTASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAIAANA. 103
4 -66.9002oe0_A mol:protein length:114 Thioredoxin-3  ali model follow..  34  6.TSITKLTNLTEFRNLIKQNDKLVIDFYATWCGPCKMMQPHLTKLIQAYPDVRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPTALEKGIKDL.. 108
5 -66.7001r26_A mol:protein length:125 Thioredoxin  ali model follow..  32  13.PSVVDVYSVEQFRNIMSEDILTVAWFTAVWCGPCKTIERPMEKIAYEFPTVKFAKVDADNNSEIVSKCRVLQLPTFIIARSGKMLGHVIGANPGMLRQKLRDIIK 117
6 -66.4002fa4_A mol:protein length:111 Thioredoxin II  ali model follow..  42  1MMVTQLKSASEYDSALASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQYSDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAIASNV. 105
7 -66.0001ti3_A mol:protein length:113 thioredoxin H  ali model follow..  39  7IACHTVDTWKEHFEKGKGSQKLIVVDFTASWCPPCKMIAPIFAELAKKFPNVTFLKVDVDELKAVAEEWNVEAMPTFIFLKDGKLVDKTVGADKDGLPTLVAKHAT 112
8 -64.3003qfa_C mol:protein length:116 Thioredoxin  ali model follow..  37  4SGSVKQIESKTAFQEALAGDKLVVVDFSATWCGPSKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV. 110
9 -64.3001xfl_A mol:protein length:124 Thioredoxin h1  ali model follow..  36  10.GQVIACHTVETWNKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKLPNVLFLKVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAKHLA 118
10 -64.1003kd0_A mol:protein length:105 Thioredoxin  ali model follow..  38  1..MVKQIESKTAFQEALDADKLVVVDFSATWCGPSKMIKPFFHSLSEKYSNVIFLEVDVDDSQDVASESEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV. 105
11 -64.1003ZZX Entity 1(prereleased)  ali follow..  47  1..MVYQVKDQEDFTKQLAGNKLVVIDFYATWCGPCKMIAPKLEELSQSMSDVVFLKVDVDECEDIAQDNQIACMPTFLFMKNGQKLDSLSGANYDKLLELVEKN.. 104
12 -64.1003trx_A mol:protein length:105 THIOREDOXIN  ali model follow..  37  1..MVKQIESKTAFQEALDADKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCTPTFQFFKKGQKVGEFSGANKEKLEATINELV. 105
13 -64.1001erv_A mol:protein length:105 THIOREDOXIN  ali model follow..  39  1..MVKQIESKTAFQEALDADKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV. 105
14 -63.9001erw_A mol:protein length:105 THIOREDOXIN  ali model follow..  36  1..MVKQIESKTAFQEALDADKLVVVDFSATWSGPSKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV. 105
15 -63.9002vm1_A mol:protein length:118 THIOREDOXIN H ISOFORM 1.  ali model follow..  38  6.GAVIACHTKQEFDTHMDTGKLVIIDFTASWCGPCRVIAPVFAEYAKKFPGAIFLKVDVDELKDVAEAYNVEAMPTFLFIKDGEKVDSVVGGRKDDIHTKIVALMG 114
16 -63.9001cqg_A mol:protein length:105 THIOREDOXIN  ali model follow..  36  1..MVKQIESKTAFQEALDADKLVVVDFSATWCGPAKMIKPFFHSLSEKYSNVIFLEVDVDDAQDVASEAEVKATPTFQFFKKGQKVGEFSGANKEKLEATINELV. 105
17 -63.9003e3e_A mol:protein length:105 Thioredoxin  ali model follow..  37  1..MVKQIESKTAFQEALDADKLVVVDFSATWCGPSKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKRMPTFQFFKKGQKVGEFSGANKEKLEATINELV. 105
18 -63.8002xbq_A mol:protein length:117 THIOREDOXIN  ali model follow..  41  12MSELIELKQDGDLESLLHKNKLVVVDFFATWCGPCKTIAPLFKELSEKY-DAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIAKVEDMIKKFI. 117
19 -63.8001aiu_A mol:protein length:105 THIOREDOXIN  ali model follow..  37  1..MVKQIESKTAFQEALAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV. 105
20 -63.7002vim_A mol:protein length:104 THIOREDOXIN  ali model follow..  39  1...MRVLATAADLEKLINKGRLIVVDFFAQWCGPCRNIAPKVEALAKEIPEVEFAKVDVDQNEEAAAKYSVTAMPTFVFIKDGKEVDRFSGANETKLRETITRH.. 103
21 -63.3002xbi_A mol:protein length:108 THIOREDOXIN  ali model follow..  41  3MSKLIELKQDGDLESLLHKNKLVVVDFFATWCGPCKTIAPLFKELSEKY-DAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIAKVEDMIKKFI. 108
22 -63.2001gh2_A mol:protein length:107 THIOREDOXIN-LIKE PROTEIN  ali model follow..  33  2..GVKPVGSDPDFQPELAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFQFFRNKVRIDQYQGADAVGLEEKIKQHL. 106
23 -63.1002diy_A mol:protein length:130 Thioredoxin-like protein 2  ali model follow..  31  17VAAVEEVGSAGQFEELLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHAS 124
24 -63.1001ep7_A mol:protein length:112 THIOREDOXIN CH1, H-TYPE  ali model follow..  47  2.GSVIVIDSKAAWDAQLEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYGKVIFLKVDVDAVAAVAEAAGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
25 -62.7001faa_A mol:protein length:124 THIOREDOXIN F  ali model follow..  30  17VGKVTEVNKDTFWPIVKAADKPVVLDMFTQWCGPCKAMAPKYEKLAEEYLDVIFLKLDCNENKTLAKELGIRVVPTFKILKENSVVGEVTGAKYDKLLEAIQAARS 124
26 -62.4002iwt_A mol:protein length:125 THIOREDOXIN H ISOFORM 2  ali model follow..  35  15.AEVISVHSLEQWTEANTAKKLVVIDFTASWCGPSRIMAPVFADLAKKFPNAVFLKVDVDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTAKVGLHAA 123
27 -62.4001xwa_A mol:protein length:111 thioredoxin  ali model follow..  43  5.AMVYQVKDKADLDGQLASGKLVVLDFFATWCGPCKMISPKLVELSTQFDNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKANI. 111
28 -62.3001wmj_A mol:protein length:130 Thioredoxin H-type  ali model follow..  41  14.GVVIACHNKDEFDAQMEAGKVVIIDFTASWCGPCRFIAPVFAEYAKKFPGAVFLKVDVDELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTIVKHVG 122
29 -62.2002i1u_A mol:protein length:121 Thioredoxin  ali model follow..  33  11KSATIKVTDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERTDLTVAKLDVDTNPETARNFQVVSIPTLILFKDGQPVKRIVGAGKAALLRELSDVVP 118
30 -62.1001m7t_A mol:protein length:107 Chimera of Human and E. coli thioredoxin  ali model follow..  38  1..MVKQIESKTAFQEALDADKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDAQDVAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDANL. 106
31 -62.0002o8v_B mol:protein length:128 Thioredoxin 1  ali model follow..  30  15SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPAKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDANLA 122
32 -62.0003d6i_A mol:protein length:112 Monothiol glutaredoxin-3  ali model follow..  22  2VIEINDQEQFTYLTTTAAGDKLIVLYFHTSWAEPCKALKQVFEAISNEPSNVSFLSIDADENSEISELFEISAVPYFIIIHKGTILKELSGADPKEYVSLLEDCKN 109
33 -61.9002wz9_A mol:protein length:153 GLUTAREDOXIN-3  ali model follow..  31  11VAAVEEVGSAGQFEELLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHAS 118
34 -61.8003hhv_A mol:protein length:110 Thioredoxin (TrxA-2)  ali model follow..  32  4VKEPVKHLNSKNFDEFITKNKIVVVDFWAEWCAPCLILAPVIEELANDYPQVAFGKLNTEESQDIAMRYGIMSLPTIMFFKNGELVDQILGAPREEIEVRLKSLL. 109
35 -60.6002f51_A mol:protein length:118 thioredoxin  ali model follow..  33  6..VHFNGTHEALLNRIKEAPGLVLVDFFATWCGPCQRLGQILPSIAEANKDVTFIKVDVDKNGNAADAYGVSSIPALFFVKKEKTLDQFVGADVSRIKADIEKF.. 111
36 -60.6001uvz_A mol:protein length:119 THIOREDOXIN  ali model follow..  29  6STTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIDEDQLEAFLKKLIG 113
37 -60.5002e0q_A mol:protein length:104 thioredoxin  ali model follow..  32  5........DSKNFDSFLASHEIAVVDFWAEWCAPCLILAPIIEELAEDYPQVGFGKLNSDENPDIAARYGVMSLPTVIFFKDGEPVDEIIGAPREEIEIRIKNLLG 103
38 -60.4003dyr_A mol:protein length:111 Thioredoxin-1  ali model follow..  31  3.DKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGTPTLLLFKNGEVAATKVGASKGQLKEFLDANLA 109
39 -60.3001t00_A mol:protein length:112 Thioredoxin  ali model follow..  33  5.GTLKHVTDDSFEQDVLKNDKPVLVDFWAAWCGPCRQIAPSLEAIAAEYDKIEIVKLNIDENPGTAAKYGVMSIPTLNVYQGGEVAKTIVGAPKAAIVRDLEDFIA 111
40 -60.3003d21_A mol:protein length:139 Thioredoxin H-type  ali model follow..  36  24.GNVHLITTKERWDQKLRDGKIVLANFSARWCGPCKQIAPYYIELSENYPSLMFLVIDVDELSDFSASWEIKATPTFFFLRDGQQVDKLVGANKPELHKKITAILD 132
41 -60.3003d22_A mol:protein length:139 Thioredoxin H-type  ali model follow..  34  24.GNVHLITTKERWDQKLRDGKIVLANFSARWCGPSRQIAPYYIELSENYPSLMFLVIDVDELSDFSASWEIKATPTFFFLRDGQQVDKLVGANKPELHKKITAILD 132
42 -60.2002eir_A mol:protein length:108 Thioredoxin 1  ali model follow..  31  2.DKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKCFLDCNLA 108
43 -60.2001keb_A mol:protein length:108 Thioredoxin 1  ali model follow..  30  2.DKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKLIASILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDANLA 108
44 -60.2001srx_A mol:protein length:108 THIOREDOXIN  ali model follow..  30  2.DKIIHLTDDSFDTDLVKADGAILVDFWAEWCGPCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYIERGIPTLLLFKNGEVAATKVGASKGQLKEFLDANLA 108
45 -60.1001zcp_A mol:protein length:108 Thioredoxin 1  ali model follow..  28  2.DKIIHLTDDSFDTDVLKADGAILVDFWAEWCACAKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDANLA 108
46 -60.1001txx_A mol:protein length:108 PROTEIN (THIOREDOXIN)  ali model follow..  29  2.DKIIHLTDDSFDTDVLKADGAILVDFWAEWCVWCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDANLA 108
47 -60.1002cvk_A mol:protein length:110 Thioredoxin  ali model follow..  41  1MAKPIEVTDQN-FDETLGQHPLVLVDFWAEWCAPCRMIAPILEEIAKEYGKLLVAKLDVDENPKTAMRYRVMSIPTVILFKDGQPVEVLVGAPKRNYQAKIEKHLP 107
48 -59.9003hz4_A mol:protein length:140 Thioredoxin  ali model follow..  23  5GSSIIEFEDMTWSQQVEDSKKPVVVMFYSPACPYCKAMEPYFEEYAKEYSSAVFGRINIATNPWTAEKYGVQGTPTFKFFCHGRPVWEQVGQYPSILKNAVRDMLQ 112
49 -59.9001thx_A mol:protein length:115 THIOREDOXIN  ali model follow..  20  7.KGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVSKDKLLSFLDTHLN 113
50 -59.9002puk_C mol:protein length:106 Thioredoxin M-type, chloroplast (TRX-M)  ali model follow..  36  1..EVQDVNDSSWKEFVLESEVPVMVDFWAPWCGPSKLIAPVIDELAKEYGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAPKSTLTDSIEKYLS 106
51 -59.6002i4a_A mol:protein length:107 thioredoxin  ali model follow..  33  2.EHTLAVSDSSFDQDVLKASGLVLVDFWAEWCGPCKMIGPALGEIGKEFGKVTVAKVNIDDNPETPNAYQVRSIPTLMLVRDGKVIDKKVGAPKSQLKAWVESA.. 106
52 -59.6003tco_A mol:protein length:109 Thioredoxin (TrxA-1)  ali model follow..  35  2KEDVTLVLTEENFDEVIRNNKLVLVDCWAEWCAPCHLYEPIYKKVAEKYGKAVFGRLNVDENQKIADKYSVLNIPTTLIFVNGQLVDSLVGADEDTLESTVNKYLK 109
53 -59.4001dby_A mol:protein length:107 CHLOROPLAST THIOREDOXIN M CH2  ali model follow..  33  2..EAGAVNDDTFKNVVLESSVPVLVDFWAPWCGPCRIIAPVVDEIAGEYDKLKCVKLNTDESPNVASEYGIRSIPTIMVFKGGKKCETIIGAPKATIVQTVEKYLN 107
54 -59.0003cxg_A mol:protein length:133 Putative thioredoxin  ali model follow..  25  14.SIYIELKNTGSLNQVFSSNSSIVIKFGAVWCKPCNKIKEYFKNQLNYY-YVTLVDIDVDIHPKLNDQHNIKALPTFEFYFNLNNVHTVEGANQNDIEKAFQKYCL 123
55 -58.6003VFI Entity 1(prereleased)  ali follow..  20  1...LRSLSDSDFQLEVRQHPDPIIIMFTGSWCQPCKKMKPTFEEMASQMGDIRFAYMDAEDAEKTMAELNIRTLPSLALFVDGMIREVFSGTNKSDLRYWINNNI. 104
56 -58.6002l5l_A mol:protein length:136 Thioredoxin  ali model follow..  26  19FLAKVYNFEKNPEEWKYEGDKPAIVDFYADWCGPCKMVAPILDELAKEYGQIVIYKVDTEKEQELAGAFGIRSIPSILFIPMEGKPEMAQGAPKASFKKAIDEFLL 126
57 -58.6003ul3_B mol:protein length:128 Thioredoxin  ali model follow..  22  25..PRLQQNGSNIINGVNMKNTVIVLYFFAKWCQACTMQSTEMDKLQKYYKRIYLLKVDLDKNESLARKFSVKSLPTIILLKNKTMLARKDHFSSNDLIALIKKH.. 128
58 -57.6003gnj_A mol:protein length:111 Thioredoxin domain protein  ali model follow..  20  5..SLEKLDTNTFEQLIYDEGKACLVMFSRKNCHVCQKVTPVLEELRLNYESFGFYYVDVEEEKTLFQRFSLKGVPQILYFKDGEYKGKMAGDEDDEVEQMIADVL. 109
59 -57.5002l6c_A mol:protein length:110 Thioredoxin  ali model follow..  18  1MSAIRDITTEA-GMAHFEGLSDAIVFFHKNLCPHCKNMEKVLDKFGARAPQVAISSVDSEARPELMKELGFERVPTLVFIRDGKVAKVFSGINPRELQALYAS... 103
60 -57.4001nsw_A mol:protein length:105 THIOREDOXIN  ali model follow..  34  6........TDANFQQAIQGDGPVLVDFWAAWCGPCRMMAPVLEEFAEAHDKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGRPVKQLIGYPKEQLEAQLADVLQ 105
61 -57.3001nw2_A mol:protein length:105 THIOREDOXIN  ali model follow..  34  6........TDANFQQAIQGDKPVLVDFWAAWCGPCRMMAPVLEEFAEAHDKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGEPVKQLIGYPKEQLEAQLADVLQ 105
62 -56.9003hxs_A mol:protein length:141 Thioredoxin  ali model follow..  34  21QSGTIHLTRAEFLKKIADGDKPAIVDFYADWCGPCKMVAPILEELSKEYGKIYIYKVNVDKEPELARDFGIQSIPTIWFVPMKGEPQVNMGASKEQLKGYIDKVL. 138
63 -56.7003emx_A mol:protein length:135 Thioredoxin  ali model follow..  18  15DGRLIYITPEEFRQLL---QGDAILAVYSKTCPHCHRDWPQLIQASKEVDGSLIGERELSAARLEMNKAGVEGTPTLVFYKEGRIVDKLVGAPWSLKVEKAREIYG 126
64 -56.2002voc_A mol:protein length:112 THIOREDOXIN  ali model follow..  35  2..AIVKATDQSFSAET--SEGVVLADFWAPWCGPSKMIAPVLEELDQEMDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKDGEVVETSVGFPKEALQELVNKHLL 105
65 -56.2002o7k_A mol:protein length:107 Thioredoxin  ali model follow..  35  5..AIVKVTDADFDSKVESG--VQLVDFWATWCGPCKMIAPVLEELAADYGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFPKENLAEVLDKHL. 107
66 -56.1002o89_A mol:protein length:107 Thioredoxin  ali model follow..  33  5..AIVKVTDADFDSKVESG--VQLVDFWATWCGTSKMIAPVLEELAADYGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFPKENLAEVLDKHL. 107
67 -56.0001oaz_A mol:protein length:123 THIOREDOXIN 1  ali model follow..  31  3.DKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDANLA 123
68 -53.2003p2a_A mol:protein length:148 Putative thioredoxin-like protein  ali model follow..  26  36FDGEVINATAETLDKLLQDDLPMVIDFWAPWCGPCRSFAPIFAETAAERGKVRFVKVNTEAEPALSTRFRIRSIPTIMLYRNGKMIDMLNGAPKAPFDNWLDEQLS 143
69 -52.6002ppt_A mol:protein length:155 thioredoxin-2  ali model follow..  22  45ITGKVAGIDPAILARAERDDLPLLVDFWAPWCGPCRQMAPQFQAAAATLGQVRLAKIDTQAHPAVAGRHRIQGIPAFILFHKGRELARAAGAPASELVGFVRGKLG 152
70 -52.4003aps_A mol:protein length:122 DnaJ homolog subfamily C member 10  ali model follow..  23  3.QASIDLTPQTFNEKVLQGKTHWVVDFYAPWCGPCQNFAPEFELLARMIGKVRAGKVDCQAYPQTCQKAGIKAYPSVKLYQYERAKKSIWEEDAKTIAALIYGKLE 113
71 -52.2001v98_A mol:protein length:140 thioredoxin  ali model follow..  28  32LPWVVEADEKGFAQEVAGAP-LTLVDFFAPWCGPCRLVSPILEELARDHGRLKVVKVNVDEHPGLAARYGVRSVPTLVLFRRGAPVATWVGAPRRVLEERLRPYLE 138
72 -51.9001x5d_A mol:protein length:133 Protein disulfide-isomerase A6  ali model follow..  20  7.GDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGTRSDIVSRALDLFS 117
73 -51.5002dj0_A mol:protein length:137 Thioredoxin-related transmembrane protein 2  ali model follow..  22  7.GYIKYFNDKTIDEELERDKRTWIVEFFANWSNDCQSFAPIYADLSLKYTGLNFGKVDVGRYTDVSTRYKVKQLPTLILFQGGKEAMRRPQIKKGRAVSWTFSE.. 119
74 -50.8002l57_A mol:protein length:126 Uncharacterized protein  ali model follow..  12  7KQINFQSINVVENLEEAKEGIPTIIMFKTDTCPYCVEMQKELSYVSKERENIYYARLEEEKNIDLAYKYDANIVPTTVFLKEGNKFYVHQGLRKNNIETILNSLG. 116
75 -49.8002dj3_A mol:protein length:133 Protein disulfide-isomerase A4  ali model follow..  22  7.GPVKVVVGKTFDAIVMDPKKDVLIEFYAPWCGHCKQLEPIYTSLGKKYKDLVIAKMDATANDITNDQYKVEGFPTIYFAPSGDKKNPIKNRDLEHLSKFIDEHAT 118

FFAS is supported by the NIH grant R01-GM087218-01
6 2 0 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.