current user: public




Query: 1syr_A mol:protein length:112 thioredoxin, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MAMVKIVTSQAEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECSKTYTKMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGANDSALKQLIEKYAALast
1 -75.5001syr_A mol:protein length:112 thioredoxin  ali model  100  1MAMVKIVTSQAEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECSKTYTKMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGANDSALKQLIEKYAA 106
2 -73.3004j56_E mol:protein length:114 Thioredoxin  ali model follow..  97  4.GSVKIVTSQAEFDSIISQNELVIVDFFAEWCGPSKRIAPFYEECSKTYTKMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGANDSALKQLIEKYAA 108
3 -73.0002mmn_A mol:protein length:104 Thioredoxin  ali model follow..  99  2...VKIVTSQSEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECSKTYTKMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGANDSALKQLIEKYAA 104
4 -71.3003f3q_A mol:protein length:109 Thioredoxin-1  ali model follow..  47  1..MVTQFKTASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAIAANA. 103
5 -70.4002oe0_A mol:protein length:114 Thioredoxin-3  ali model follow..  35  6.TSITKLTNLTEFRNLIKQNDKLVIDFYATWCGPCKMMQPHLTKLIQAYPDVRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPTALEKGIKD... 107
6 -70.2004cw9_A mol:protein length:109 THIOREDOXIN  ali model follow..  36  3...VLHINALDQLTALLSTEKVIVIDFFATWCGPSRSISPYFEELAGQYNNIKFVKVDVDQAEEICVNYKVRSMPTFVLVKDGIEQKRFSGADRNALKQMVET... 102
7 -69.5001r26_A mol:protein length:125 Thioredoxin  ali model follow..  32  12YPSVVDVYSVEQFRNIMSEDILTVAWFTAVWCGPCKTIERPMEKIAYEFPTVKFAKVDADNNSEIVSKCRVLQLPTFIIARSGKMLGHVIGANPGMLRQKLRDIIK 117
8 -69.1004dss_B mol:protein length:112 Thioredoxin-2  ali model follow..  48  1MGMVTQLKSASEYDSALSGDKLVVVDFFATWCGPSKMIAPMIEKFAEQYSDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAIASN.. 105
9 -67.8003m9j_A mol:protein length:105 Thioredoxin  ali model follow..  39  1..MVKQIESKTAFQEALAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASESEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV. 105
10 -67.7003kd0_A mol:protein length:105 Thioredoxin  ali model follow..  38  1..MVKQIESKTAFQEALAGDKLVVVDFSATWCGPSKMIKPFFHSLSEKYSNVIFLEVDVDDSQDVASESEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV. 105
11 -67.7001cqg_A mol:protein length:105 THIOREDOXIN  ali model follow..  36  1..MVKQIESKTAFQEALAGDKLVVVDFSATWCGPAKMIKPFFHSLSEKYSNVIFLEVDVDDAQDVASEAEVKATPTFQFFKKGQKVGEFSGANKEKLEATINELV. 105
12 -67.6001erw_A mol:protein length:105 THIOREDOXIN  ali model follow..  36  1..MVKQIESKTAFQEALAGDKLVVVDFSATWSGPSKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV. 105
13 -67.6003e3e_A mol:protein length:105 Thioredoxin  ali model follow..  37  1..MVKQIESKTAFQEALAGDKLVVVDFSATWCGPSKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKRMPTFQFFKKGQKVGEFSGANKEKLEATINELV. 105
14 -67.3004puf_C mol:protein length:117 Thioredoxin  ali model follow..  38  6.SMVKQIESKTAFQEALAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV. 111
15 -67.0004pok_A mol:protein length:109 Thioredoxin  ali model follow..  39  4.TMVKQIESKTAFQKALAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKKKLEATINKLV. 109
16 -67.0001gh2_A mol:protein length:107 THIOREDOXIN-LIKE PROTEIN  ali model follow..  33  3...VKPVGSDPDFQPELAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFQFFRNKVRIDQYQGADAVGLEEKIKQHL. 106
17 -67.0003zzx_A mol:protein length:105 THIOREDOXIN  ali model follow..  47  1..MVYQVKDQEDFTKQLAGNKLVVIDFYATWCGPCKMIAPKLEELSQSMSDVVFLKVDVDECEDIAQDNQIACMPTFLFMKNGQKLDSLSGANYDKLLELVEKN.. 104
18 -66.7003qfa_C mol:protein length:116 Thioredoxin  ali model follow..  37  5.GSVKQIESKTAFQEALAGDKLVVVDFSATWCGPSKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV. 110
19 -66.7001ti3_A mol:protein length:113 thioredoxin H  ali model follow..  38  4.GQVIACHTVDTWKEHFESQKLIVVDFTASWCPPCKMIAPIFAELAKKFPNVTFLKVDVDELKAVAEEWNVEAMPTFIFLKDGKLVDKTVGADKDGLPTLVAKHAT 112
20 -66.5002vim_A mol:protein length:104 THIOREDOXIN  ali model follow..  39  1...MRVLATAADLEKLINKGRLIVVDFFAQWCGPCRNIAPKVEALAKEIPEVEFAKVDVDQNEEAAAKYSVTAMPTFVFIKDGKEVDRFSGANETKLRETITRH.. 103
21 -66.3002fa4_A mol:protein length:111 Thioredoxin II  ali model follow..  49  2..MVTQLKSASEYDSALSGDKLVVVDFFATWCGPCKMIAPMIEKFAEQYSDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAIASN.. 104
22 -66.1001xfl_A mol:protein length:124 Thioredoxin h1  ali model follow..  36  10.GQVIACHTVETWNEQLQSKTLVVVDFTASWCGPCRFIAPFFADLAKKLPNVLFLKVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAKHLA 118
23 -65.8002vm1_A mol:protein length:118 THIOREDOXIN H ISOFORM 1.  ali model follow..  38  6.GAVIACHTKQEFDTHMATGKLVIIDFTASWCGPCRVIAPVFAEYAKKFPGAIFLKVDVDELKDVAEAYNVEAMPTFLFIKDGEKVDSVVGGRKDDIHTKIVALMG 114
24 -65.2002ypm_A mol:protein length:106 LAFCA THIOREDOXIN  ali model follow..  55  1..MVIQVTNKDEFESILSADKLVVVDFTATWCGPCKMIAPKFEELSEEYPDVVFLKVDVDEVEDVAAEYGISAMPTFQFFKNGKKVDELTGANQEKLKAMIKKHAA 106
25 -64.9002iwt_A mol:protein length:125 THIOREDOXIN H ISOFORM 2  ali model follow..  36  15.AEVISVHSLEQWTMQIEAKKLVVIDFTASWCGPSRIMAPVFADLAKKFPNAVFLKVDVDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTAKVGLHAA 123
26 -64.2001ep7_A mol:protein length:112 THIOREDOXIN CH1, H-TYPE  ali model follow..  46  2.GSVIVIDSKAAWDAQLAEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGVIFLKVDVDAVAAVAEAAGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAA 111
27 -63.6002j23_A mol:protein length:121 THIOREDOXIN  ali model follow..  40  8RGSVQVISSYDQFKQVTGGDKVVVIDFWATWCGPCKMIGPVFEKISDTPDKVGFYKVDVDEQSQIAQEVGIRAMPTFVFFKNGQKIDTVVGADPSKLQAAITQHSA 115
28 -63.3001xwa_A mol:protein length:111 thioredoxin  ali model follow..  43  5.AMVYQVKDKADLDGQLASGKLVVLDFFATWCGPCKMISPKLVELSTQFADVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKAN.. 110
29 -63.1001wmj_A mol:protein length:130 Thioredoxin H-type  ali model follow..  41  14.GVVIACHNKDEFDAQMTAGKVVIIDFTASWCGPCRFIAPVFAEYAKKFPGAVFLKVDVDELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTIVKHVG 122
30 -62.5002xbi_A mol:protein length:108 THIOREDOXIN  ali model follow..  41  3MSKLIELKQDGDLESLLHKNKLVVVDFFATWCGPCKTIAPLFKELSEKY-DAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIAKVEDMIKKFI. 108
31 -62.5003d6i_A mol:protein length:112 Monothiol glutaredoxin-3  ali model follow..  26  2...VIEINDQEQFTYLTTGDKLIVLYFHTSWAEPCKALKQVFEAISNENSNVSFLSIDADENSEISELFEISAVPYFIIIHKGTILKELSGADPKEYVSLLEDCKN 109
32 -61.9004i8b_A mol:protein length:105 Thioredoxin  ali model follow..  41  1.SNVLHIETDDDFDSFLNKDKLIVVDFFATWCGPCKKIAPAFEALSADRS-ALYVKVDVDKLEETARKYDVSAMPTFIVIKNGEKVDTVVGASIENVEAAIRKH.. 104
33 -61.8002yoi_A mol:protein length:106 LECA THIOREDOXIN  ali model follow..  60  1..MVIQVTNKEEFEAILEADKLVVVDFFATWCGPCKMIAPFFEELSEEYPDVVFIKVDVDEVPDVAAKYGITSMPTFKFFKNGKKVDELVGANQEKLKQMILKHAP 106
34 -61.8003d22_A mol:protein length:139 Thioredoxin H-type  ali model follow..  35  24.GNVHLITTKERWDQKLSDGKIVLANFSARWCGPSRQIAPYYIELSENYPSLMFLVIDVDELSDFSASWEIKATPTFFFLRDGQQVDKLVGANKPELHKKITAILD 132
35 -61.8003d21_A mol:protein length:139 Thioredoxin H-type  ali model follow..  37  24.GNVHLITTKERWDQKLSDGKIVLANFSARWCGPCKQIAPYYIELSENYPSLMFLVIDVDELSDFSASWEIKATPTFFFLRDGQQVDKLVGANKPELHKKITAILD 132
36 -61.3002xbq_A mol:protein length:117 THIOREDOXIN  ali model follow..  41  12MSELIELKQDGDLESLLHKNKLVVVDFFATWCGPCKTIAPLFKELSEKY-DAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIAKVEDMIKKFI. 117
37 -61.2002diy_A mol:protein length:130 Thioredoxin-like protein 2  ali model follow..  31  17VAAVEEVGSAGQFEELLRAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHAS 124
38 -59.2002wz9_A mol:protein length:153 GLUTAREDOXIN-3  ali model follow..  31  11VAAVEEVGSAGQFEELLRAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHAS 118
39 -59.2003cxg_A mol:protein length:133 Putative thioredoxin  ali model follow..  26  14.SIYIELKNTGSLNQVFSQNSSIVIKFGAVWCKPCNKIKEYFKNQL-NYYYVTLVDIDVDIHPKLNDQHNIKALPTFEFYFNLNNVHTVEGANQNDIEKAFQKYCL 123
40 -59.0001faa_A mol:protein length:124 THIOREDOXIN F  ali model follow..  30  17VGKVTEVNKDTFWPIVKAGDKPVVLDMFTQWCGPCKAMAPKYEKLAEEYLDVIFLKLDCNENKTLAKELGIRVVPTFKILKENSVVGEVTGAKYDKLLEAIQAARS 124
41 -55.2002f51_A mol:protein length:118 thioredoxin  ali model follow..  34  9.....NGTHEALLNRIKEAPGLVLVDFFATWCGPCQRLGQILPSIAEANKDVTFIKVDVDKNGNAADAYGVSSIPALFFVKKEKTLDQFVGADVSRIKADIEKF.. 111
42 -55.1001m7t_A mol:protein length:107 Chimera of Human and E. coli thioredoxin  ali model follow..  38  1..MVKQIESKTAFQEALAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDAQDVAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDANLV 107
43 -52.0002e0q_A mol:protein length:104 thioredoxin  ali model follow..  32  5........DSKNFDSFLASHEIAVVDFWAEWCAPCLILAPIIEELAEDYPQVGFGKLNSDENPDIAARYGVMSLPTVIFFKDGEPVDEIIGAPREEIEIRIKNLLG 103
44 -51.7003hhv_A mol:protein length:110 Thioredoxin (TrxA-2)  ali model follow..  32  4VKEPVKHLNSKNFDEFITKNKIVVVDFWAEWCAPCLILAPVIEELANDYPQVAFGKLNTEESQDIAMRYGIMSLPTIMFFKNGELVDQILGAPREEIEVRLKSL.. 108
45 -51.3004ruv_A mol:protein length:114 Thioredoxin  ali model follow..  25  1.GSMQSIKSNESFKSVINSDTPVIVKFEAGWCPDCRAMDLWIDPIVEQYNDYQWYTVNRDELEDVVVENEVMGIPSLLVFKNGDKIAHLHSANAKSPEQVES.... 101
46 -50.7002l6c_A mol:protein length:110 Thioredoxin  ali model follow..  17  1MSAIRDITT-EAGMAHFEGLSDAIVFFHKNLCPHCKNMEKVLDKFGARAPQVAISSVDSEARPELMKELGFERVPTLVFIRDGKVAKVFSGINPRELQALYAS... 103
47 -50.7003tco_A mol:protein length:109 Thioredoxin (TrxA-1)  ali model follow..  36  2KEDVTLVLTEENFDEVIRNNKLVLVDCWAEWCAPCHLYEPIYKKVAEKYKKAVFGRLNVDENQKIADKYSVLNIPTTLIFVNGQLVDSLVGADEDTLESTVNKY.. 107
48 -50.6002cvk_A mol:protein length:110 Thioredoxin  ali model follow..  40  1MAKPIEVTD-QNFDETLGQHPLVLVDFWAEWCAPCRMIAPILEEIAKEYEKLLVAKLDVDENPKTAMRYRVMSIPTVILFKDGQPVEVLVGAPKRNYQAKIEKHLP 107
49 -49.7004knd_A mol:protein length:112 Thioredoxin  ali model follow..  34  7.NDVVVLQDSTFEQEVLKSDTPVLVDFWAVWCGPCKAIAPVVDDLAARYKKLKVAKMDVDQHQGVPQQYGIRSIPTLLVFKGGRVVDTVIGADKTRLEDSVKKAIG 112
50 -48.5001nsw_A mol:protein length:105 THIOREDOXIN  ali model follow..  35  6........TDANFQQAIQGDGPVLVDFWAAWCGPCRMMAPVLEEFAEAHAKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGRPVKQLIGYPKEQLEAQLADV.. 103
51 -48.4001nw2_A mol:protein length:105 THIOREDOXIN  ali model follow..  34  6........TDANFQQAIQGDKPVLVDFWAAWCGPCRMMAPVLEEFAEAHAKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGEPVKQLIGYPKEQLEAQLADVLQ 105
52 -48.1002puk_C mol:protein length:106 Thioredoxin M-type, chloroplast (TRX-M)  ali model follow..  36  2...VQDVNDSSWKEFVLESEVPVMVDFWAPWCGPSKLIAPVIDELAKEYSKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAPKSTLTDSIEKYLS 106
53 -47.9002lrc_A mol:protein length:114 Probable thioredoxin  ali model follow..  19  2..KTRYSAEAPARDELDRLAGPTLVEFGTDWCGHCQAAQPLLAEVFSDYPEVGHLKVEDGPGRRLGRSFQVKLWPTFVFLRDGREVARVVRPSASVLEEAFESLVG 106
54 -47.9004xhm_A mol:protein length:137 Thioredoxin (Trx-3)  ali model follow..  42  39........NSSNFDETLKNNENVVVDFWAEWCHPCKMIAPVIEELAKEYAKVVFGKLNTDENPTIAARYGISAIPTLIFFKKGKPVDQLVGAPKSELKRWVQRN.. 136
55 -47.7002ynx_A mol:protein length:106 LACA THIOREDOXIN  ali model follow..  47  3...VVQLNDENFDEVIKKNNKVVVVDFWAEWCGPCRMIAPIIEELAKEYAKVVFGKLNVDENPEIAAKYGIMSIPTLLFFKNGKVVDQLVGAPKEALKERIKKY.. 105
56 -47.5001dby_A mol:protein length:107 CHLOROPLAST THIOREDOXIN M CH2  ali model follow..  33  2..EAGAVNDDTFKNVVLESSVPVLVDFWAPWCGPCRIIAPVVDEIAGEYKKLKCVKLNTDESPNVASEYGIRSIPTIMVFKGGKKCETIIGAPKATIVQTVEKYLN 107
57 -47.5003ziv_A mol:protein length:106 AECA THIOREDOXIN  ali model follow..  46  3...VIEINDENFDEVIKKSDKVVVVDFWAEWCGPCRMIAPIIEELAEEYAKVVFGKVNVDENPEIAAKYGIMSIPTLLFFKNGKVVDQLVGAPKEALKERIKKY.. 105
58 -47.4004ba7_A mol:protein length:106 LBCA THIOREDOXIN  ali model follow..  43  3...VIEINDENFEEEVLKSDKPVLVDFWAPWCGPCRMIAPIIEELAEEYEKVKFAKVNVDENPETAAKYGIMSIPTLLLFKNGEVVDKLVGAPKEALKERIEKH.. 105
59 -47.4003gnj_A mol:protein length:111 Thioredoxin domain protein  ali model follow..  20  6...LEKLDTNTFEQLIYDEGKACLVMFSRKNCHVCQKVTPVLEELRLNYESFGFYYVDVEEEKTLFQRFSLKGVPQILYFKDGEYKGKMAGDEDDEVEQMIADVLE 110
60 -47.3002yj7_A mol:protein length:106 LPBCA THIOREDOXIN  ali model follow..  42  3...VIEVTDENFEQEVLKSDKPVLVDFWAPWCGPCRMIAPIIEELAKEYEKVKVVKVNVDENPNTAAQYGIRSIPTLLLFKNGQVVDRLVGAPKEALKERIDKH.. 105
61 -47.2001uvz_A mol:protein length:119 THIOREDOXIN  ali model follow..  28  6.STTFNIQDGPDFQDVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIDEDQLEAFLKKLIG 113
62 -46.9001t00_A mol:protein length:112 Thioredoxin  ali model follow..  33  5.GTLKHVTDDSFEQDVLKNDKPVLVDFWAAWCGPCRQIAPSLEAIAAEYGKIEIVKLNIDENPGTAAKYGVMSIPTLNVYQGGEVAKTIVGAPKAAIVRDLEDFIA 111
63 -46.9003vfi_A mol:protein length:104 thioredoxin  ali model follow..  20  1...LRSLSDSDFQLEVRQHPDPIIIMFTGSWCQPCKKMKPTFEEMASQMEDIRFAYMDAEDAEKTMAELNIRTLPSLALFVDGMIREVFSGTNKSDLRYWINNN.. 103
64 -46.8001srx_A mol:protein length:108 THIOREDOXIN  ali model follow..  30  2.DKIIHLTDDSFDTDLVKADGAILVDFWAEWCGPCKMIAPILDEIADEYQKLTVAKLNIDQNPGTAPKYIERGIPTLLLFKNGEVAATKVGASKGQLKEFLDANLA 108
65 -46.7002eir_A mol:protein length:108 Thioredoxin 1  ali model follow..  31  2.DKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKCFLDCNLA 108
66 -46.7001txx_A mol:protein length:108 PROTEIN (THIOREDOXIN)  ali model follow..  29  2.DKIIHLTDDSFDTDVLKADGAILVDFWAEWCVWCKMIAPILDEIADEYQKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDANLA 108
67 -46.6003dyr_A mol:protein length:111 Thioredoxin-1  ali model follow..  31  3.DKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQKLTVAKLNIDQNPGTAPKYGIRGTPTLLLFKNGEVAATKVGASKGQLKEFLDANLA 109
68 -46.6001zcp_A mol:protein length:108 Thioredoxin 1  ali model follow..  28  2.DKIIHLTDDSFDTDVLKADGAILVDFWAEWCACAKMIAPILDEIADEYQKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDANLA 108
69 -46.6004hu7_A mol:protein length:108 Thioredoxin-1  ali model follow..  29  2.DKIIHLTDDSFDTDVLKADGAILVDFWAEWCGACKMIAAILDEIADEYQKLTVAKLNIDQNAGTAAKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDANLA 108
70 -46.6003hz4_A mol:protein length:140 Thioredoxin  ali model follow..  23  6.SSIIEFEDMTWSQQVEDSKKPVVVMFYSPACPYCKAMEPYFEEYAKEYGSAVFGRINIATNPWTAEKYGVQGTPTFKFFCHGRPVWEQVGQYPSILKNAVRDMLQ 112
71 -46.6001keb_A mol:protein length:108 Thioredoxin 1  ali model follow..  30  2.DKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKLIASILDEIADEYQKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDANLA 108
72 -46.4004wxt_A mol:protein length:125 Thioredoxin  ali model follow..  31  12...TIEVSDASFSTDVLASNKPVLVDFWATWCGPCKMVAPVLEEIASERGHLTVAKLDVDANPETAQNFQVVSIPTLILFKDGQPVKRIVGAGKAALLRELSDAVP 116
73 -46.3002voc_A mol:protein length:112 THIOREDOXIN  ali model follow..  37  7........TDQSFSAETS-EGVVLADFWAPWCGPSKMIAPVLEELDQEMGKLKIVKIDVDENQETAGKYGVMSIPTLLVLKDGEVVETSVGFPKEALQELVNKHLL 105
74 -46.3002i1u_A mol:protein length:121 Thioredoxin  ali model follow..  32  11KSATIKVTDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERADLTVAKLDVDTNPETARNFQVVSIPTLILFKDGQPVKRIVGAGKAALLRELSDVVP 118
75 -46.1002o89_A mol:protein length:107 Thioredoxin  ali model follow..  37  10........TDADFDSKVESG-VQLVDFWATWCGTSKMIAPVLEELAADYEKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFPKENLAEVLDKH.. 106

FFAS is supported by the NIH grant R01-GM087218-01
8 3 0 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.