current user: public




Query: 1spx_A mol:protein length:278 short-chain reductase family member (5L265), from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .
# Score Template Links and tools%idFirst MTRFAEKVAIITGSSNGIGRATAVLFAREGAKVTITGRHAERLEETRQQILAAGVSEQNVNSVVADVTTDAGQDEILSTTLGKFGKLDILVNNAGAAIPDSQSKTGTAQSIESYDATLNLNLRSVIALTKKAVPHLSSTKGEIVNISSIASGLHATPDFPYYSIAKAAIDQYTRNTAIDLIQHGIRVNSISPGLVATGFGSAMGMPEETSKKFYSTMATMKECVPAGVMGQPQDIAEVIAFLADRKTSSYIIGHQLVVDGGSSLIMGLHCQDFAKLLHLast
1 -107.0001spx_A mol:protein length:278 short-chain reductase family member (5L265)  ali model  100  1MTRFAEKVAIITGSSNGIGRATAVLFAREGAKVTITGRHAERLEETRQQILAAGVSEQNVNSVVADVTTDAGQDEILSTTLGKFGKLDILVNNAGAAIPDSQSKTGTAQSIESYDATLNLNLRSVIALTKKAVPHLSSTKGEIVNISSIASGLHATPDFPYYSIAKAAIDQYTRNTAIDLIQHGIRVNSISPGLVATGFGSAMGMPEETSKKFYSTMATMKECVPAGVMGQPQDIAEVIAFLADRKTSSYIIGHQLVVDGGSSLIMGLHCQDFAKLLH 278
2 -104.0001xkq_A mol:protein length:280 short-chain reductase family member (5D234)  ali model follow..  63  1MPRFSNKTVIITGSSNGIGRTTAILFAQEGANVTITGRSSERLEETRQIILKSGVSEKQVNSVVADVTTEDGQDQIINSTLKQFGKIDVLVNNAGAAIPDAFGTTGTDQGIDIYHKTLKLNLQAVIEMTKKVKPHLVASKGEIVNVSSIVAGPQAQPDFLYYAIAKAALDQYTRSTAIDLAKFGIRVNSVSPGMVETGFTNAMGMPDQASQKFYNFMASHKECIPIGAAGKPEHIANIILFLADRNLSFYILGQSIVADGGTSLVMGTQAHDVMSIMS 278
3 -101.0001xhl_A mol:protein length:297 Short-chain dehydrogenase/reductase family me  ali model follow..  60  15MARFSGKSVIITGSSNGIGRSAAVIFAKEGAQVTITGRNEDRLEETKQQILKAGVPAEKINAVVADVTEASGQDDIINTTLAKFGKIDILVNNAGANLADGT--ANTDQPVELYQKTFKLNFQAVIEMTQKTKEHLIKTKGEIVNVSSIVAGPQAHSGYPYYACAKAALDQYTRCTAIDLIQHGVRVNSVSPGAVATGFMGAMGLPETASDKLYSFIGSRKECIPVGHCGKPEEIANIIVFLADRNLSSYIIGQSIVADGGSTLVMGMQTHDLMSVLS 290
4 -85.7005epo_A mol:protein length:262 7-alpha-hydroxysteroid deydrogenase  ali model follow..  31  1MKRLEGKVAIVTSSTRGIGRASAEALAKEGALVYLAARSEELANEVIADIKKQG---GVAKFVYFNAREEETYTSMVEKVAEAEGRIDILVNNYGGT-NVNLDKNLTAGDTDEFFRILKDNVQSVYLPAKAAIPHMEKVGGSIVNISTIG-SVVPDISRIAYCVSKSAINSLTQNIALQYARKNIRCNAVLPGLIGTRAALENMTD--------EFRDSFLGHVPLNRVGRPEDIANAVLYYASDD-SGYVTGMIHEVAGGFALGTPQ.......... 255
5 -84.5001zem_A mol:protein length:262 xylitol dehydrogenase  ali model follow..  28  4..KFNGKVCLVTGAGGNIGLATALRLAEEGTAIALLDMNREALEKAEASVREKG---VEARSYVCDVTSEEAVIGTVDSVVRDFGKIDFLFNNAGY---QGAFAPVQDYPSDDFARVLTINVTGAFHVLKAVSRQMITQNGRIVNTASMA-GVKGPPNMAAYGTSKGAIIALTETAALDLAPYNIRVNAISPGYMGPGFMWERQVELQAKTDPKVVAQQMIGSVPMRRYGDINEIPGVVAFLLGDD-SSFMTGVNLPIAGG................. 262
6 -84.3003afm_A mol:protein length:258 Carbonyl reductase  ali model follow..  32  2FPDLKGKRVLITGSSQGIGLATARLFARAGAKVGLHGRAPANIDETIASMRADG---GDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGGL---VGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAATSAVISTGSIAGHTGGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDTAFHADKT---------QDVRDRISNGIPMGRFGTAEEMAPAFLFFASHLASGYITGQVLDINGGQYK.............. 257
7 -84.2004w7h_A mol:protein length:258 Carbonyl reductase  ali model follow..  31  2FPDLKGKRVLITGSTEGIGLATARLFARAGAKVGLNSHDPANIDETIASMRADG---GDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGGL---VGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAAASAVISTGSIAGHTGGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDTAFHADKT---------QDVRDRISNGIPMGRFGTAEEMAPAFLFFASHLASGYITGQVLDINGGQYK.............. 257
8 -84.2005f1p_A mol:protein length:265 PtmO8  ali model follow..  32  4VGRLEGKIAIVTGAASGIGAVTAERLAAEGARVALADLDAVGVQTLAEKIRGAD--GTHAIGIEVDLADPASVRAMVAAAVEEFGGLDILHNNAAATLASSLDVPVADADPEVWDRTMRVNLSGAMVATQAALPHLIARGGCVINTSSAA-GLSGDLSHPAYAASKAALISLTRSVATQAGRSGVRCNAIAPGLIITRPERE------------AAYRVMLPHHLTTRLGRPEDVASAVVFLASDE-ASFITGQTLVVDGGLLAHQP........... 256
9 -84.1002d1y_A mol:protein length:256 hypothetical protein TT0321  ali model follow..  28  1MGLFAGKGVLVTGGARGIGRAIAQAFAREGALVALCDLRPEGKEVAEA----------GGAFFQVDLEDERERVRFVEEAAYALGRVDVLVNNAAI----AAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGAIVNVASVQ-GLFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAIALSPDPE---RTRRDWEDLHALRRLGKPEEVAEAVLFLASEK-ASFITGAILPVDGGMTASFMMAGRPV..... 256
10 -83.4001yde_A mol:protein length:270 Retinal dehydrogenase/reductase 3  ali model follow..  30  4GTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQEL-------PGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPP---QRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLV-GAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPR---ASIREGMLAQPLGRMGQPAEVGAAAVFLASE--ANFCTGIELLVTGGAELGYGCKAS....... 258
11 -83.4003gaf_A mol:protein length:256 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  34  7PFHLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDLKSEGAEAVAAAIRQAG---GKAIGLECNVTDEQHREAVIKAALDQFGKITVLVNNAGGG-----GPKPFDMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGAILNISSMA-GENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDALATVLTP--------EIERAMLKHTPLGRLGEAQDIANAALFLCSPA-AAWISGQVLTVSGGGVQ.............. 253
12 -83.1005er6_A mol:protein length:251 Oxidoreductase, short chain dehydrogenase/red  ali model follow..  29  2MELLKEKLVLVTGAGRGLGAAISSGAAEQGARVILVDIDGTAAKAQADALTAKG---FVAEGHALDVTDRDAVAALADDILSRFGGLDVLVNNAGVA---GRAAFDQPEAVEVWDRVIGVNLEGAFNVSHALVPALKAAKGNVVHLCSVA-GFVSGGSTAGYVVSKGAIRSLTQVMARDLAPHGIRVNAVAPGIMMSEMAVAQLNRP-------GGTDWFMNRVMMKRIGETSEVVDPVVFLASPM-ASYITGTILPVDGGFLAA............. 251
13 -83.1004tkl_A mol:protein length:258 NADH-dependent reductase for 4-deoxy-L-erythr  ali model follow..  28  2FSDLKGKRILITGSTEGIGMATAIELARYGAVVGLNSHDPADPALLLGKLREAG---GDGAFFRADITKTAECQRLVSAFVERFDGIDVLINNAGGL---AGRSNLENIDDAFYDRVMDLNGRSVLMMTKFAIPHLRASASAVISTGSIAAREGGGIGAGVYAASKAWLHDIHRNWVKEFTKDSIRFNIVAPGTVDTAFHADKS---------DELKTRIANSIPMGRFGTVQELAPAYVFFASHAASGYITGQILDVNGGQIC.............. 257
14 -83.1004w7i_A mol:protein length:258 4-deoxy-L-erythro-5-hexoseulose uronate reduc  ali model follow..  30  2FSDLKGKRILITGSSQGIGMATAIELARYGAVVGLHGRAPADPALLLGKLREAG---GDGAFFRADITKTAECQRLVSAFVERFDGIDVLINNAGGL---AGRSNLENIDDAFYDRVMDLNGRSVLMMTKFAIPHLRASASAVISTGSIAAREGGGIGAGVYAASKAWLHDIHRNWVKEFTKDSIRFNIVAPGTVDTAFHADKS---------DELKTRIANSIPMGRFGTVQELAPAYVFFASHAASGYITGQILDVNGGQIC.............. 257
15 -83.1001ahh_A mol:protein length:255 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  31  6NLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLG---GQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGG-----GPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGVILTITSMA-AENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITP--------EIEQKMLQHTPIRRLGQPQDIANAALFLCSPA-ASWVSGQILTVSGGGVQ.............. 252
16 -83.0002cfc_A mol:protein length:250 2-(R)-HYDROXYPROPYL-COM DEHYDROGENASE  ali model follow..  32  2.....SRVAIVTGASSGNGLAIATRFLARGDRVAALDLSAETLEETARTHWHA--YADKVLRVRADVADEGDVNAAIAATMEQFGAIDVLVNNAGIT-GNSEAGVLHTTPVEQFDKVMAVNVRGIFLGCRAVLPHMLLQGGVIVNIASVA-SLVAFPGRSAYTTSKGAVLQLTKSVAVDYAGSGIRCNAVCPGMIETPMTQWRLDQPE-------LRDQVLARIPQKEIGTAAQVADAVMFLAGED-ATYVNGAALVMDGAYTAI............. 250
17 -82.8004nim_A mol:protein length:277 Versicolorin reductase  ali model follow..  29  4GGQLKGKIAVITGSTQGLGAATARLFAERGAQGLVIGRSAEKGRAQAAGLEELG---AKAVFVQVDLENVEDCRRIVAEADRAFGRLDILVNAAGL----TDRGTILDTSPELFDRLFAVNTRAPFFLIQEAIKLFRRDRGAIVNVSSMS-SMGGQPFIAAYCASKGALDTLTRNVAYSVLRNRIRVNSLNIGWMASDGEDRIQREYHGAPA--NWLEEAVKTQPFGRLLDPAKVARAIAFLASEE-SGLMTGAIVNFDQSVWG.............. 259
18 -82.7003ucx_A mol:protein length:264 Short chain dehydrogenase  ali model follow..  25  7.GLLTDKVVVISGVGPALGTTLARRCAEQGADLVLAARTVERLEDVAKQVTDTG---RRALSVGTDITDDAQVAHLVDETMKAYGRVDVVINNAFRV---PSMKPFANTTFEHMRDAIELTVFGALRLIQGFTPALEESKGAVVNVNSMV-VRHSQAKYGAYKMAKSALLAMSQTLATELGEKGIRVNSVLPGYIWGGTLKSYFEHQAGKYGTEDIYNAAAAGSDLKRLPTEDEVASAILFMASDL-ASGITGQALDVNCGEYKA............. 264
19 -82.7004gh5_A mol:protein length:269 Short-chain dehydrogenase/reductase SDR  ali model follow..  32  11.NRLKNEVIAITGGGAGIGLAIASAALREGAKVALIDLDQGLAERSAAMLSTGG---AVAKGFGADVTKAADITAAITSAEQTIGSLTGLVNNAGIAGFGS----VHDADAAAWDRIMAVNVTGTFLASKAALAGMLERKGTIVNFGSVA-GLVGIPTMAAYCAAKGAIVNLTRQMAADYSGRGVRVNAVCPGTVTSTGMGQQLLGSDTSP---EVQARRLAKYPIGRFGTPEDIAEAVIFLLSDQ-AAFVTGAAFAVDGGMTAI............. 263
20 -82.6003qiv_A mol:protein length:253 short-chain dehydrogenase or 3-oxoacyl-[acyl-  ali model follow..  32  4SMRFENKVGIVTGSGGGIGQAYAEALAREGAAVVVADINAEAAEAVAKQIVADG---GTAISVAVDVSDPESAKAMADRTLAEFGGIDYLVNNAAIF-GGMKLDFLLTIDPEYYKKFMSVNLDGALWCTRAVYKKMTKRGGAIVNQSSTA----AWLYSNYYGLAKVGINGLTQQLSRELGGRNIRINAIAPGPIDTEANRTTTPK--------EMVDDIVKGLPLSRMGTPDDLVGMCLFLLSDE-ASWITGQIFNVDGGQII.............. 251
21 -82.4005HS6 Entity 1(prereleased)  ali follow..  31  6GTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQEL-------PGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPP---QRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLV-GAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPR---ATIREGMLAQPLGRMGQPAEVGAAAVFLASE--ANFCTGIELLVTGGAELGYGCKAS....... 260
22 -82.4004nbv_A mol:protein length:246 3-oxoacyl-[acyl-carrier-protein] reductase pu  ali model follow..  30  2..KLQGRVAIITGAAAGIGFATAQRFAEDGAIVVLCDVQEARVREAAARLAATG---ATVSAYRVDVTRRDEVDAMVAAVLAAHQRVDILVNNAGI----TKDARLAKMTEAQFDAVIDVNLKGVFNCAQAVAGLMTEQGGVILNASSVV-GLYGNFGQTNYAASKFGVIGFTKTWARELGPKGVRVNAVCPGFVNTEILQTVP---------DKVLDGMTSSCWLRRLAEPAEIASIYAFLASDD-ASYVNGVAIEASGGMSL.............. 246
23 -82.1003pk0_A mol:protein length:262 Short-chain dehydrogenase/reductase SDR  ali model follow..  30  5MFDLQGRSVVVTGGTKGIGRGIATVFARAGANVAVAGRSTADIDACVADLDQLG--SGKVIGVQTDVSDRAQCDALAGRAVEEFGGIDVVCANAGV----FPDAPLATMTPEQLNGIFAVNVNGTFYAVQACLDALIASGGRVVLTSSITGPITGYPGWSHYGATKAAQLGFMRTAAIELAPHKITVNAIMPGNIMTEGLLENG---------EEYIASMARSIPAGALGTPEDIGHLAAFLATKE-AGYITGQAIAVDGGQVL.............. 253
24 -81.9004is2_A mol:protein length:268 Bile acid 3-alpha hydroxysteroid dehydrogenas  ali model follow..  28  14MNLVQDKVTIITGGTRGIGFAAAKIFIDNGAKVSIFGETQEEVDTALAQLKELY-PEEEVLGFAPDLTSRDAVMAAVGQVAQKYGRLDVMINNAGI----TSNNVFSRVSEEEFKHIMDINVTGVFNGAWCAYQCMKDAKGVIINTASVT-GIFGSLSGVGYPASKASVIGLTHGLGREIIRKNIRVVGVAPGVVNTDMTNGNP---------PEIMEGYLKALPMKRMLEPEEIANVYLFLASDL-ASGITATTVSVDGAY................ 260
25 -81.7003v8b_A mol:protein length:283 Putative dehydrogenase, possibly 3-oxoacyl-[a  ali model follow..  30  17MMNQPSPVALITGAGSGIGRATALALAADGVTVGALGRTRTEVEEVADEIVGAG---GQAIALEADVSDELQMRNAVRDLVLKFGHLDIVVANAGI---NGVWAPIDDLKPFEWDETIAVNLRGTFLTLHLTVPYLKQRGGAIVVVSSING-TFTTPGATAYTATKAAQVAIVQQLALELGKHHIRVNAVCPGAIETNISDNTKLRHEEETAIPVEWPKGQVPITDGQPGRSEDVAELIRFLVSER-ARHVTGSPVWIDGGQGLL............. 276
26 -81.6004fn4_A mol:protein length:254 Short chain dehydrogenase  ali model follow..  31  2YQSLKNKVVIVTGAGSGIGRAIAKKFALNDSIVVAVELLEDRLNQIVQELRGMG---KEVLGVKADVSKKKDVEEFVRRTFETYSRIDVLCNNAGIM---DGVTPVAEVSDELWERVLAVNLYSAFYSSRAVIPIMLKQGGVIVNTASIA-GIRGGFAGAPYTVAKHGLIGLTRSIAAHYGDQGIRAVAVLPGTVKTNIGLGSSKPSE-----LGMRTLTKLMSLSSRLAEPEDIANVIVFLASDE-ASFVNGDAVVVDGGLTVL............. 254
27 -81.5003uxy_A mol:protein length:266 Short-chain dehydrogenase/reductase SDR  ali model follow..  28  17MQGFEGKVALVTGAAGGIGGAVVTALRAAGARVAVADRAVAGIAA--------------DLHLPGDLREAAYADGLPGAVAAGLGRLDIVVNNAGV----ISRGRITETTDADWSLSLGVNVEAPFRICRAAIPLMAAAGGAIVNVASCW-GLRPGPGHALYCLTKAALASLTQCMGMDHAPQGIRINAVCPNEVNTPMLRTGFAKRGFDPD--RAVAELGRTVPLGRIAEPEDIADVVLFLASDA-ARYLCGSLVEVNGGKAVA............. 260
28 -81.5004cr6_A mol:protein length:271 N-ACYLMANNOSAMINE 1-DEHYDROGENASE  ali model follow..  27  10PGRLAGKAAIVTGAAGGIGRATVEAYLREGASVVAMDLAPRLAATRYE--------EPGAIPIACDLADRAAIDAAMADAVARLGGLDILVAGGALK---GGTGNFLDLSDADWDRYVDVNMTGTFLTCRAGARAMVAAGARIITIGSVN-SFMAEPEAAAYVAAKGGVAMLTRAMAVDLARHGILVNMIAPGPVDVTGNNTGYSEP-------RLAEQVLDEVALGRPGLPEEVATAAVFLAEDG-SSFITGSTITIDGGLSAM............. 261
29 -81.4003ak4_A mol:protein length:263 NADH-dependent quinuclidinone reductase  ali model follow..  27  7IFDLSGRKAIVTGGSKGIGAAIARALDKAGATVAIADLDVMAAQAVVAGLENGG------FAVEVDVTKRASVDAAMQKAIDALGGFDLLCANAGV----STMRPAVDITDEEWDFNFDVNARGVFLANQIACRHFLASNGVIVNTASLA-AKVGAPLLAHYSASKFAVFGWTQALAREMAPKNIRVNCVCPGFVKTAMQEREIIWEAELRGMEAVRAEYVSLTPLGRIEEPEDVADVVVFLASDA-ARFMTGQGINVTGGVRM.............. 262
30 -81.2004ni5_A mol:protein length:254 Oxidoreductase, short-chain dehydrogenase/red  ali model follow..  29  2AMRFKDKVVIVTGGASGIGEATARAFIREGAKVVIADFSDHG-QQLADERAGAH---EQALFIKTDVADTRAVQALIARTVENYGRLDIMFANAGI----AADAPIDELDEAAWQKTIDINLTGVYLCDKYAIDQMRSQGGVIVNCGSIH-SHVGKSGVTAYAAAKGGVKLLTQTLAIDYGPQNIRVNAVCPGYIDTPLLKNIP---------DDKKQALVALHPMGRLGRAEEVANAVLFLASDE-ASFVNGASLLVDGGYTA.............. 247
31 -81.2004gkb_A mol:protein length:258 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  31  4..NLQDKVVIVTGGASGIGGAISMRLAEERAIPVVFARHAPD-GAFLDALAQRQ---PRATYLPVELQDDAQCRDAVAQTIATFGRLDGLVNNAGVN-----DGIGLDAGRDAFVASLERNLIHYYAMAHYCVPHLKATRGAIVNISSKT-AVTGQGNTSGYCASKGAQLALTREWAVALREHGVRVNAVIPAEVMTPLYRNWIATFEDPE---AKLAEIAAKVPLGRFTTPDEIADTAVFLLSPR-ASHTTGEWLFVDGGYTHL............. 253
32 -81.2004qec_A mol:protein length:248 ElxO  ali model follow..  30  2.....KKNVLITGGFKGIGKQVALEFLKNDYHVCITSRYFEKEKRIPHLFSSYE---ENISFYQLDVTDEEQVNEIINKIVKKFGRLDVLVNNAGIS---LSDGLLTETKTTDFNKMINTNILGTYFCMKYALKHMQKVSGAIVNISSIT-GLSGFPYSILYGSTKHAVIGLTKGAAVEFADKGIKINAVAPGIIKTETLQKEIDSGE------FSEDSISSIHPMQKLGTTLDVAKGIYFLANED-NNFITGHVLSIDGGYLS.............. 247
33 -81.2001iy8_A mol:protein length:267 LEVODIONE REDUCTASE  ali model follow..  30  10..RFTDRVVLITGGGSGLGRATAVRLAAEGAKLSLVDVSSEGLEASKAAVLETA-PDAEVLTTVADVSDEAQVEAYVTATTERFGRIDGFFNNAGI---EGKQNPTESFTAAEFDKVVSINLRGVFLGLEKVLKIMREQGGMVVNTASVG-GIRGIGNQSGYAAAKHGVVGLTRNSAVEYGRYGIRINAIAPGAIWTPMVENS-MKQLDPENPRKAAEEFIQVNPSKRYGEAPEIAAVVAFLLSDD-ASYVNATVVPIDGGQSA.............. 265
34 -81.0003n74_A mol:protein length:261 3-ketoacyl-(acyl-carrier-protein) reductase  ali model follow..  31  6..SLEGKVALITGAGSGFGEGMAKRFAKGGAKVVIVDRDKAGAERVAGEI------GDAALAVAADISKEADVDAAVEAALSKFGKVDILVNNAGI---GHKPQNAELVEPEEFDRIVGVNVRGVYLMTSKLIPHFKENGCVILNVAST-GAGRPRPNLAWYNATKGWVVSVTKALAIELAPAKIRVVALNPVAGETPLLTTFMGEDS-----EEIRKKFRDSIPMGRLLKPDDLAEAAAFLCSPQ-ASMITGVALDVDGGRSI.............. 256
35 -80.8003svt_A mol:protein length:281 Short-chain type dehydrogenase/reductase  ali model follow..  26  8..SFQDRTYLVTGGGSGIGKGVAAGLVAAGASVMIVGRNPDKLAGAVQELEALGANGGAIRYEPTDITNEDETARAVDAVTAWHGRLHGVVHCAGG---SENIGPITQVDSEAWRRTVDLNVNGTMYVLKHAAREMVRGGGSFVGISSIA-ASNTHRWFGAYGVTKSAVDHLMQLAADELGASWVRVNSIRPGLIRTDLVAAITESAE-------LSSDYAMCTPLPRQGEVEDVANMAMFLLSDA-ASFVTGQVINVDGGQMLRRGPDFSAMLEPV. 271
36 -80.8004cql_A mol:protein length:261 ESTRADIOL 17-BETA-DEHYDROGENASE 8  ali model follow..  30  6QNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKRGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAGI----TQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGGSIINISSIV-GKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVP---------QKVVDKITEMIPMGHLGDPEDVADVVAFLASED-SGYITGTSVEVTGGLFM.............. 261
37 -80.5005jc8_A mol:protein length:276 Putative short-chain dehydrogenase/reductase  ali model follow..  30  7.GRLQGKVALVTGAGCGNGRAIAVRFAEEGAHVIAVDRDLASMDATLELVRAAG---GSVTPCLCDVTDSASVERLVADSVARCGRVDILVNNVGAPSPGG----PVALDEAQWAMQLELNLTTAFLMCKYVLPVMEQQGGAIVNIASTSGIRWTGAAQVGYAAAKAGMIQMGRVVAVEYAAKNVRVNSVVPGLLHTPMVDTKIAHNQAGGDVELLLRKRQARIPMPFMGDGRDTANAALFLASDE-ARFVTGTEIVVDGGMSARC............ 269
38 -80.4003tox_A mol:protein length:280 Short chain dehydrogenase  ali model follow..  32  3MSRLEGKIAIVTGASSGIGRAAALLFAREGAKVVVTARNGNALAELTDEIAGGG---GEAAALAGDVGDEALHEALVELAVRRFGGLDTAFNNAGAL---GAMGEISSLSVEGWRETLDTNLTSAFLAAKYQVPAIAALGGSLTFTSSFVGHTAGFAGVAPYAASKAGLIGLVQALAVELGARGIRVNALLPGGTDTPANFANLPGAA-----PETRGFVEGLHALKRIARPEEIAEAALYLASDG-ASFVTGAALLADGGASVT............. 256
39 -80.2004dqx_A mol:protein length:277 Probable oxidoreductase protein  ali model follow..  29  18..DLNQRVCIVTGGGSGIGRATAELFAKNGAYVVVADVNEDAAVRVANEI------GSKAFGVRVDVSSAKDAESMVEKTTAKWGRVDVLVNNAGFGTTGN----VVTIPEETWDRIMSVNVKGIFLCSKYVIPVMRRNGGSIINTTSYT-ATSAIADRTAYVASKGAISSLTRAMAMDHAKEGIRVNAVAPGTIDSPYFTKIFAEAKDPA---KLRSDFNARAVMDRMGTAEEIAEAMLFLASDR-SRFATGSILTVDGGSSI.............. 265
40 -80.1001rwb_A mol:protein length:261 Glucose 1-dehydrogenase  ali model follow..  30  3.KDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRKEDEANSVLEEIKKVG---GEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGL----ENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDGTVINMSSVH-EKIPWPLFVHYAASKGGMKLMTKTLALEYAPKGIRVNNIGPGAINTPINAEKFADPEQ-------RADVESMIPMGYIGEPEEIAAVAAWLASSE-ASYVTGITLFADGGMTL.............. 252
41 -80.1001k2w_A mol:protein length:256 SORBITOL DEHYDROGENASE  ali model follow..  30  2..RLDGKTALITGSARGIGRAFAEAYVREGARVAIADINLEAARATAAEI------GPAACAIALDVTDQASIDRCVAELLDRWGSIDILVNNAAL----FDLAPIVEITRESYDRLFAINVSGTLFMMQAVARAMIAGGGKIINMASQA-GRRGEALVGVYCATKAAVISLTQSAGLNLIRHGINVNAIAPGVVDGEHWDGVDAKFADYENLPEKKRQVGAAVPFGRMGRAEDLTGMAIFLATPE-ADYIVAQTYNVDGGNWMS............. 256
42 -80.1003edm_A mol:protein length:259 Short chain dehydrogenase  ali model follow..  29  3LQRFTNRTIVVAGAGRDIGRACAIRFAQEGANVVLTYNAAEGAATAVAEIEKLG---RSALAIKADLTNAAEVEAAISAAADKFGEIHGLVHVAGGL---IARKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAK-GGAIVTFSSQAGRDGGGPGALAYATSKGAVMTFTRGLAKEVGPK-IRVNAVCPGMISTTFHDTFTKP--------EVRERVAGATSLKREGSSEDVAGLVAFLASDD-AAYVTGACYDINGGVLFSEG........... 253
43 -80.0002pd6_A mol:protein length:264 Estradiol 17-beta-dehydrogenase 8  ali model follow..  30  2QNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKRGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAGI----TQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGGSIINISSIV-GKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVP---------QKVVDKITEMIPMGHLGDPEDVADVVAFLASED-SGYITGTSVEVTGGLFMA............. 258
44 -80.0004ure_A mol:protein length:248 CYCLOHEXANOL DEHYDROGENASE  ali model follow..  28  2..LLEGKTALVTGAGNGIGRTIALTYAAEGANVVVSDISDEWGRETLALIEGKG---GKAVFQHADTAHPEDHDELIAAAKRAFGRLDIACNNAGI---SGEFTPTAETTDAQWQRVIGINLSGVFYGVRAQIRAMLETGGAIVNISSIA-GQIGIEGITPYTAAKHGVVGLTKTVAWEYGSKGIRINSVGPAFINTTLVQNVP---------LETRRQLEQMHALRRLGETEEVANLVAWLSSDK-ASFVTGSYYAVDGGYLA.............. 247
45 -80.0001g6k_A mol:protein length:261 GLUCOSE 1-DEHYDROGENASE  ali model follow..  29  3.KDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRKEDEANSVLEEIKKVG---GEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGL----ANPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDGTVINMSSVH-EKIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKFADPEQ-------RADVESMIPMGYIGEPEEIAAVAAWLASSE-ASYVTGITLFADGGMTQ.............. 252
46 -79.9004weo_A mol:protein length:266 Putative acetoin(Diacetyl) reductase  ali model follow..  28  4TAPLEGQVAIVTGGARGIGRGIALTLAGAGANILLADLLDDALDATAREVRALG---RRAAIAKVDVTQAAQVDAMVAQALADLGGLDILVNCAGV----ISIHPVAELTERDWDFVMNVNAKGTFLGCRAALAHLKAQGGRIINVASIA-GKEGFPNLAHYSASKFAVVGFTNALAKELARDGVTVNAICPGIVRTYMWDRLSDEWKTDGESVEWQRHQLTLIPQGRAQTPEDMGRLALFFATMD---NVTGQAVNVDGGFTF.............. 259
47 -79.9003aus_A mol:protein length:269 Glucose 1-dehydrogenase 4  ali model follow..  30  4YTDLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNEEEALDAKKEVEEAG---GQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGV----ENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDGNVINMSSVH-EMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKFADPVQ-------RADVESMIPMGYIGKPEEVAAVAAFLASSQ-ASYVTGITLFADGGMTK.............. 254
48 -79.8003rih_A mol:protein length:293 short chain dehydrogenase or reductase  ali model follow..  30  30MFDLSARSVLVTGGTKGIGRGIATVFARAGANVAVAARSPRELSSVTAELGELG--AGNVIGVRLDVSDPGSCADAARTVVDAFGALDVVCANAGI----FPEARLDTMTPEQLSEVLDVNVKGTVYTVQACLAPLTASGGRVILTSSITGPVTGYPGWSHYGASKAAQLGFMRTAAIELAPRGVTVNAILPGNILTEGLVDMG---------EEYISGMARSIPMGMLGSPVDIGHLAAFLATDE-AGYITGQAIVVDGGQVL.............. 278
49 -79.8003lf1_A mol:protein length:265 Short Chain Oxidoreductase Q9HYA2  ali model follow..  28  5..DLSEAVAVVTGGSSGIGLATVELLLEAGAAVAFCARDGERLRAAESALRQRF-PGARLFASVCDVLDALQVRAFAEACERTLGCASILVNNAGQ----GRVSTFAETTDEAWSEELQLKFFSVIHPVRAFLPQLESRAAAIVCVNSLL-ASQPEPHMVATSAARAGVKNLVRSMAFEFAPKGVRVNGILIGLVESGQWRRRFEAREEREAQWTAQLARNKQIPLGRLGKPIEAARAILFLASP-LSAYTTGSHIDVSGGLSR.............. 263
50 -79.7004e6p_A mol:protein length:259 Probable sorbitol dehydrogenase (L-iditol 2-d  ali model follow..  31  3MKRLEGKSALITGSARGIGRAFAEAYVREGATVAIADIDIERARQAAAEI------GPAAYAVQMDVTRQDSIDAAIAATVEHAGGLDILVNNAAL----FDLAPIVEITRESYEKLFAINVAGTLFTLQAAARQMIAQGGKIINMASQA-GRRGEALVAIYCATKAAVISLTQSAGLDLIKHRINVNAIAPGVVDGEHWDGVDAARYENRPRGEKKRLVGEAVPFGRMGTAEDLTGMAIFLASAE-SDYIVSQTYNVDGGNWMS............. 259
51 -79.6003o38_A mol:protein length:266 Short chain dehydrogenase  ali model follow..  32  18.GLLKGKVVLVTAAATGIGSTTARRALLEGADVVISDYHERRLGETRDQLADLGL--GRVEAVVCDVTSTEAVDALITQTVEKAGRLDVLVNNAGL----GGQTPVVDMTDEEWDRVLNVTLTSVMRATRAALRYFRGVDGVIVNNASVL-GWRAQHSQSHYAAAKAGVMALTRCSAIEAVEFGVRINAVSPSIARHKFLEKTSSS--------ELLDRLASDEAFGRAAEPWEVAATIAFLASDY-SSYMTGEVVSVSSQRA............... 266
52 -79.6004e4y_A mol:protein length:244 Short chain dehydrogenase family protein  ali model follow..  28  1..SNAMANYLVTGGSKGIGKAVVELLLQNKNHTVINIDIQQSF------------SAENLKFIKADLTKQQDITNVLDII--KNVSFDGIFLNAGI----LIKGSIFDIDIESIKKVLDLNVWSSIYFIKGLENNL-KVGASIVFNGSDQ-CFIAKPNSFAYTLSKGAIAQMTKSLALDLAKYQIRVNTVCPGTVDTDLYRNLIQKNNVGISFDEAQKQEEKEFPLNRIAQPQEIAELVIFLLSDK-SKFMTGGLIPIDGGYTA.............. 243
53 -79.5003oic_A mol:protein length:258 Enoyl-[acyl-carrier-protein] reductase [NADPH  ali model follow..  29  2...EQNKCALVTGSSRGVGKAAAIRLAENGYNIVINYRSKKAALETAEEIEKLG---VKVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAAS----GVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKNGGHIVSISSLG-SIRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDALKHFPNRED-------LLEDARQNTPAGRMVEIKDMVDTVEFLVSSK-ADMIRGQTIIVDGGRSLL............. 249
54 -79.4004nbw_A mol:protein length:257 Short-chain dehydrogenase/reductase SDR  ali model follow..  32  2..STDKRVAIITGAANGIGRATALEFAQAGYHVVAWDLAEEAGAALIAEIADAG---GSADFARVDVSAAESVEAAVAEIIAEHGRVDVLVNNAGILHDGQLGEVVKKMAEAQFDAVISVNLKGVFLCTQAVAPHMIAAKGRILNASSVV-GLYGNFGQTNYVAAKSGVIGMTKVWARELGRYGITVNAIAPGFIATEMVQQMP---------ERVLEAMVARTPVGRIGDPVDIARAYLFLASEE-SGFISGTTLSVDGGMVV.............. 255
55 -79.4002zat_A mol:protein length:260 Dehydrogenase/reductase SDR family member 4  ali model follow..  30  9RKPLENKVALVTASTDGIGLAIARRLAQDGAHVVVSSRKQENVDRTVATLQGEG---LSVTGTVCHVGKAEDRERLVAMAVNLHGGVDILVSNAAV---NPFFGNIIDATEEVWDKILHVNVKATVLMTKAVVPEMEKRGGSVLIVSSVG-AYHPFPNLGPYNVSKTALLGLTKNLAVELAPRNIRVNCLAPGLIKTNFSQVLWMDK-------ARKEYMKESLRIRRLGNPEDCAGIVSFLCSED-ASYITGETVVVGGGTAS.............. 258
56 -79.2004nbu_A mol:protein length:250 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  34  2MSRLQDKVAIITGAANGIGLEAARVFMKEGAKVVIADFNEAAGKEAVEA-------NPGVVFIRVDVSDRESVHRLVENVAERFGKIDILINNAGI----TRDSMLSKMTVDQFQQVINVNLTGVFHCTQAVLPYMAEQGGKIINTSSVT-GTYGNVGQTNYAAAKAGVIGMTKTWAKELARKGINVNAVAPGFTETAMVAEVP---------EKVIEKMKAQVPMGRLGKPEDIANAYLFLASHE-SDYVNGHVLHVDGGIMM.............. 244
57 -79.1003gvc_A mol:protein length:277 Probable short-chain type dehydrogenase/reduc  ali model follow..  29  18HPDLAGKVAIVTGAGAGIGLAVARRLADEGCHVLCADIDGDAADAAATKI------GCGAAACRVDVSDEQQIIAMVDACVAAFGGVDKLVANAGVVHLAS----LIDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERGGAIVNLSSL-AGQVAVGGTGAYGMSKAGIIQLSRITAAELRSSGIRSNTLLPAFVDTPMQQTAMAMFD--GALGAGGARSMIARLQGRMAAPEEMAGIVVFLLSDD-ASMITGTTQIADGGTIA.............. 268
58 -79.0003o4r_A mol:protein length:261 Dehydrogenase/reductase SDR family member 4  ali model follow..  31  10RDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGL---SVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAV---NPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGSVVIVSSIA-AFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDK-------EKEESMKETLRIRRLGEPEDCAGIVSFLCSED-ASYITGETVVVGGGTPS.............. 259
59 -78.9001edo_A mol:protein length:244 BETA-KETO ACYL CARRIER PROTEIN REDUCTASE  ali model follow..  29  1.....SPVVVVTGASRGIGKAIALSLGKAGCKVLVNYASAKAAEEVSKQIEAYG---GQAITFGGDVSKEADVEAMMKTAIDAWGTIDVVVNNAGI----TRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATKIMMKKRGRIINIASVV-GLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDMTAKLG---------EDMEKKILGTIPLGRTGQPENVAGLVEFLALSPAASYITGQAFTIDGGIAI.............. 244
60 -78.9004nbr_A mol:protein length:273 Hypothetical 3-oxoacyl-(Acyl-carrier protein)  ali model follow..  25  16RPSHKERNVLITGAARGIGRAIAQAFVERSATVGICDLNLADVARTCEELNGLGL--GRAVPIACDVSDYDALVAAID---DTGLVFDTVVNNAGISPHNGVAHKVWEMAPDEWRRVVDVNLTGTFNTIRALTPGMVEARGWIVNTSSVAGKTYSPIVACHYAATKSAIIGFTKHLAAELGPYSIRVNAMAPGRIATPMVAGVA---------PEVNAEQVKLTPMARLGQPAEVADVALWLTSTE-SSFVTGQTVDVAGGLYMA............. 267
61 -78.8001bdb_A mol:protein length:277 CIS-BIPHENYL-2,3-DIHYDRODIOL-2,3-DEHYDROGENAS  ali model follow..  26  2..KLKGEAVLITGGASGLGRALVDRFVAEGAKVAVLDKSAERLAELETDH------GDNVLGIVGDVRSLEDQKQAASRCVARFGKIDTLIPNAGIWDYSTLVDLPEESLDAAFDEVFHINVKGYIHAVKACLPALVASRGNVIFTISNA-GFYPNGGGPLYTAAKHAIVGLVRELAFELAP-YVRVNGVGSGGINSDLRGPSSLGGSKAISTVPLADMLKSVLPIGRMPEVEEYTGAYVFFATRGDAAPATGALLNYDGGLGV.............. 257
62 -78.6005iz4_A mol:protein length:271 Putative short-chain dehydrogenase/reductase  ali model follow..  27  3MTQSSTPVCVITGSASGIGAATALRFAQAGWSVAIGNFDDSTRDAASTVEALCRDAGAQTLIFDADVGKDADCRHAVDMVASRWQRIDALINCAGTTRVIP-HNAFDQIDDFEFERVYRVNLIGLYQMTRAAVPLLRESSTSVVNVSSLA-GLNGTGSSIAYAASKGAVNTLTLSLARNLAPH-IRVNALAPGMVDDGLLLRVLDAAAY----DGVLSRMTESAPLKRVSRPAEIAELAWFLTAH--APAITGQVIAAENGLLL.............. 262
63 -78.4004yqy_A mol:protein length:270 Putative Dehydrogenase  ali model follow..  27  16SMDLKGKTAIVTGGRGDIGRACVLELAARGANVAINYMSSEGADSAVAEIKAAG---GNAFALQGDMTKEADVAALVEKTVKEFGQVDTLVHVTG-----IARVTMSEMTLDHWQSVMDVNLTSFVLMVRECLPHMTE-GSSIVGLASQAGRDGGGPGASAYGASKGALMTLTRGLAKELGPK-IRVNSLCPGMIDTDFHNIFTKP--------EVRTHVANVSPVKREGTSEDVAKLAVFLASDD-AAFITGANVDINGGMLFS............. 264
64 -78.2002y93_A mol:protein length:281 CIS-2,3-DIHYDROBIPHENYL-2,3-DIOL DEHYDROGENAS  ali model follow..  28  2..KLTGEVALITGGASGLGRALVDRFVAEGARVAVLDKSAERLRELEVAH------GGNAVGVVGDVRSLQDQKRAAERCLAAFGKIDTLIPNAGIWDYSTLADLPEDKIDAAFDDIFHVNVKGYIHAVKACLPALVSSRGSVVFTISNA-GFYPNGGGPLYTATKHAVVGLVRQMAFELAP-HVRVNGVAPGGMNTDLRGPSSLGSEQSISSVPLADMLKSVLPIGRMPALEEYTGAYVFFATRGDSLPATGALLNYDGGMGV.............. 257
65 -78.0001geg_A mol:protein length:256 ACETOIN REDUCTASE  ali model follow..  29  2.....KKVALVTGAGQGIGKAIALRLVKDGFAVAIADYNDATAKAVASEINQAG---GHAVAVKVDVSDRDQVFAAVEQARKTLGGFDVIVNNAGV----APSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKEGGKIINACSQA-GHVGNPELAVYSSSKFAVRGLTQTAARDLAPLGITVNGYCPGIVKTPMWAEIDRQEAAGKPLGYGTAEFAKRITLGRLSEPEDVAACVSYLASPD-SDYMTGQSLLIDGGMVF.............. 255
66 -78.0001uls_A mol:protein length:245 putative 3-oxoacyl-acyl carrier protein reduc  ali model follow..  30  2..RLKDKAVLITGAAHGIGRATLELFAKEGARLVACDIEEGPLREAAEAVGAHP--------VVMDVADPASVERGFAEALAHLGRLDGVVHYAGI----TRDNFHWKMPLEDWELVLRVNLTGSFLVAKAASEAMREKNGSIVLTASRVY--LGNLGQANYAASMAGVVGLTRTLALELGRWGIRVNTLAPGFIETRMTAKVP---------EKVREKAIAATPLGRAGKPLEVAYAALFLLSDE-SSFITGQVLFVDGGRTI.............. 240
67 -78.0002uvd_A mol:protein length:246 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE  ali model follow..  34  2...LKGKVALVTGASRGIGRAIAIDLAKQGANVVVNYANEQKANEVVDEIKKLG---SDAIAVRADVANAEDVTNMVKQTVDVFGQVDILVNNAGV----TKDNLLMRMKEEEWDTVINTNLKGVFLCTKAVSRFMMRQRGRIVNIASVV-GVTGNPGQANYVAAKAGVIGLTKTSAKELASRNITVNAIAPGFIATDMTDVLD---------ENIKAEMLKLIPAAQFGEAQDIANAVTFFASDQ-SKYITGQTLNVDGGMVM.............. 246
68 -77.9004mow_A mol:protein length:256 Glucose 1-dehydrogenase  ali model follow..  35  3MSKLAGKVAIVTGASKGIGAAIAKALADEGAAVVVNYASKAGADAVVSAITEAG---GRAVAVGGDVSKAADAQRIVDTAIETYGRLDVLVNNSGV----YEFAPIEAITEEHYRRQFDTNVFGVLLTTQAAVKHLGE-GASIINISSVVTSI-TPPASAVYSGTKGAVDAITGVLALELGPRKIRVNAINPGMIVTEGTHSAGIIGS------DLEAQVLGQTPLGRLGEPNDIASVAVFLASDD-ARWMTGEHLVVSGGL................ 249
69 -77.9003wtc_A mol:protein length:262 Putative oxidoreductase  ali model follow..  28  3HMSLSGKIAAVTGAAQGIGKAIALRLAKDGADVILLDVKQDTLAETAKEVEALG---RRAVALTADISNRDQFRSTLADAAKTLGGLDIMVNNAGI----CQVKPILDIEPAEIEKIFSINVQGVLWGMQAAATLFKEKGGKIINACSIA-GHEGYPLLGAYSATKFAVRALTQSAAKELASSGITVNSYCPGIVGTDMWVTIDKREITGTEIGATYKKYVEGIALGRVETADDVAGFVAYLSSSD-ADYMTGQSVLIDGGLVF.............. 261
70 -77.9003awd_A mol:protein length:260 Putative polyol dehydrogenase  ali model follow..  27  10..RLDNRVAIVTGGAQNIGLACVTALAEAGARVIIADLDEAMATKAVEDLRMEGH---DVSSVVMDVTNTESVQNAVRSVHEQEGRVDILVACAGICI---SEVKAEDMTDGQWLKQVDINLNGMFRSCQAVGRIMLEQKGVIVAIGSMSGLIVNRPQQAAYNASKAGVHQYIRSLAAEWAPHGIRANAVAPTYIETTLTRFGMEKPE-------LYDAWIAGTPMGRVGQPDEVASVVQFLASD-AASLMTGAIVNVDAGFTV.............. 259
71 -77.8002hq1_A mol:protein length:247 Glucose/ribitol dehydrogenase  ali model follow..  31  2..QLKGKTAIVTGSSRGLGKAIAWKLGNMGANIVLNGSASTSLDATAEEFKAAG---INVVVAKGDVKNPEDVENMVKTAMDAFGRIDILVNNAGI----TRDTLMLKMSEKDWDDVLNTNLKSAYLCTKAVSKIMLKQKGKIINITSIA-GIIGNAGQANYAASKAGLIGFTKSIAKEFAAKGIYCNAVAPGIIKTDMTDVLP---------DKVKEMYLNNIPLKRFGTPEEVANVVGFLASDD-SNYITGQVINIDGGLVM.............. 247
72 -77.7004npc_A mol:protein length:265 Sorbitol dehydrogenase  ali model follow..  29  15..PLSEKVAIVTGGASGIGAAISKAFIAKGAKVAVLDISADIAKAKAEEL------GENAKPFVCDVSSQQSVNDAITAVISQFGKIDIAVNSAGV----VYLAPAEDISLDYWDKTININLKGSFLVTQAVGRAMIAAGGKIINLASQA-GTVAIEEHVAYCASKFGVIGMSKTFAAEWGKYGICVNTLSPTIVLTELGKKAWAGEKG--------EAAKKRIPAGRFAYPEEIAAAAVFLASA-GADMITGADLLIDGGYTIL............. 259
73 -77.6004nbt_A mol:protein length:240 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  32  1MKKLEGKVAVITGGAKGLGQAIALAYAEEGAKVIAGDLGDLT------------YSHPNVEGMYLNVTDVTGVEKFYQSVIDKYGKIDILVNNAGI----TKDAMTRKMTEAQWDAVIDVNLKGVFNLTRLVGPQMQTNGGSIINISSVV-GVFGNIGQANYAATKAGVIGLTMTWAKEFALKGVRVNAIAPGYIMTDILKTVP---------QDLLDKFAALTMLNRLGQPEEIAKVALFLASDD-ASYVTGQTINVNGGMRL.............. 240
74 -77.5004rzh_A mol:protein length:247 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  34  1MTALTAQVALVTGASRGIGKATALALAATGMKVVVNYASSTAADAVVAEIIANG---GEAIAVQANVANADEVDQLIKTTLDKFSRIDVLVNNAGI----TRDTLLLRMKLEDWQAVIDLNLTGVFLCTKAVSKLMLKQKGRIINITSVA-GMMGNPGQANYSAAKAGVIGFTKTVAKELASRGVTVNAVAPGFIATDMTENLNA------------EPILQFIPLARYGQPEEVAGTIRFLATDPAAAYITGQTFNVDGGMVMF............. 247
75 -77.5003wye_A mol:protein length:256 Diacetyl reductase [(S)-acetoin forming], L-2  ali model follow..  28  2.....KKVALVTGAGQGIGKAIALRLVKDGFAVAIADYNDATAKAVASEINQAG---GHAVAVKVDVSDRDQVFAAVEQARKTLGGFDVIVNNAGI----AQIKPLLEVTEEDLKQIYSVNVFSVFFGIQAAVEAFKKEGGKIINAASIA-AIQGFPILSAYSTTKFAVRGLTQTAARDLAPLGITVNGYCPGIVGTGMWEQIDAEKINGKPIGENFKEYSSSIALGRPSVPEDVAGLVSFLASPD-SDYMTGQSLLIDGGMVF.............. 255

FFAS is supported by the NIH grant R01-GM087218-01
8 5 8 4 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zmasek CM, Zhang Q, Ye Y, Godzik A. Surprising complexity of the ancestral apoptosis network. Genome Biol. 2007 Oct 24;8(10):R226 [Epub ahead of print]