current user: public




1spxA
Query: 1spx_A mol:protein length:278 short-chain reductase family member (5L265), from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .
# Score Template Links and tools%idFirst MTRFAEKVAIITGSSNGIGRATAVLFAREGAKVTITGRHAERLEETRQQILAAGVSEQNVNSVVADVTTDAGQDEILSTTLGKFGKLDILVNNAGAAIPDSQSKTGTAQSIESYDATLNLNLRSVIALTKKAVPHLSSTKGEIVNISSIASGLHATPDFPYYSIAKAAIDQYTRNTAIDLIQHGIRVNSISPGLVATGFGSAMGMPEETSKKFYSTMATMKECVPAGVMGQPQDIAEVIAFLADRKTSSYIIGHQLVVDGGSSLIMGLHCQDFAKLLHLast
1 -102.0001spx_A mol:protein length:278 short-chain reductase family member (5L265)  ali model  100  1MTRFAEKVAIITGSSNGIGRATAVLFAREGAKVTITGRHAERLEETRQQILAAGVSEQNVNSVVADVTTDAGQDEILSTTLGKFGKLDILVNNAGAAIPDSQSKTGTAQSIESYDATLNLNLRSVIALTKKAVPHLSSTKGEIVNISSIASGLHATPDFPYYSIAKAAIDQYTRNTAIDLIQHGIRVNSISPGLVATGFGSAMGMPEETSKKFYSTMATMKECVPAGVMGQPQDIAEVIAFLADRKTSSYIIGHQLVVDGGSSLIMGLHCQDFAKLLH 278
2 -99.0001xkq_A mol:protein length:280 short-chain reductase family member (5D234)  ali model follow..  63  1MPRFSNKTVIITGSSNGIGRTTAILFAQEGANVTITGRSSERLEETRQIILKSGVSEKQVNSVVADVTTEDGQDQIINSTLKQFGKIDVLVNNAGAAIPDAFGTTGTDQGIDIYHKTLKLNLQAVIEMTKKVKPHLVASKGEIVNVSSIVAGPQAQPDFLYYAIAKAALDQYTRSTAIDLAKFGIRVNSVSPGMVETGFTNAMGMPDQASQKFYNFMASHKECIPIGAAGKPEHIANIILFLADRNLSFYILGQSIVADGGTSLVMGTQAHDVMSIMS 278
3 -95.6001xhl_A mol:protein length:297 Short-chain dehydrogenase/reductase family me  ali model follow..  59  15MARFSGKSVIITGSSNGIGRSAAVIFAKEGAQVTITGRNEDRLEETKQQILKAGVPAEKINAVVADVTEASGQDDIINTTLAKFGKIDILVNNAGANL--ADGTANTDQPVELYQKTFKLNFQAVIEMTQKTKEHLIKTKGEIVNVSSIVAGPQAHSGYPYYACAKAALDQYTRCTAIDLIQHGVRVNSVSPGAVATGFMGAMGLPETASDKLYSFIGSRKECIPVGHCGKPEEIANIIVFLADRNLSSYIIGQSIVADGGSTLVMGMQTHDLMSVLS 290
4 -84.2003tox_A mol:protein length:280 Short chain dehydrogenase  ali model follow..  32  3MSRLEGKIAIVTGASSGIGRAAALLFAREGAKVVVTARNGNALAELTDEIAGGGG---EAAALAGDVGDEALHEALVELAVRRFGGLDTAFNNAGAL---GAMGEISSLSVEGWRETLDTNLTSAFLAAKYQVPAIALGGGSLTFTSSFVGHTAGFAGVAPYAASKAGLIGLVQALAVELGARGIRVNALLPGGTDTPANFANLPGAA-----PETRGFVEGLHALKRIARPEEIAEAALYLASDG-ASFVTGAALLADGGASV.............. 255
5 -84.2001yde_A mol:protein length:270 Retinal dehydrogenase/reductase 3  ali model follow..  30  4GTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQE-------LPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHH---PPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLV-GAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPR---ASIREGMLAQPLGRMGQPAEVGAAAVFLASE--ANFCTGIELLVTGGAELGYGCKA........ 257
6 -83.9001iy8_A mol:protein length:267 LEVODIONE REDUCTASE  ali model follow..  30  8TTRFTDRVVLITGGGSGLGRATAVRLAAEGAKLSLVDVSSEGLEASKAAVLETAPDA-EVLTTVADVSDEAQVEAYVTATTERFGRIDGFFNNAGIE---GKQNPTESFTAAEFDKVVSINLRGVFLGLEKVLKIMEQGSGMVVNTASVG-GIRGIGNQSGYAAAKHGVVGLTRNSAVEYGRYGIRINAIAPGAIWTPMVENS-MKQLDPENPRKAAEEFIQVNPSKRYGEAPEIAAVVAFLLSDD-ASYVNATVVPIDGGQSA.............. 265
7 -83.8003ucx_A mol:protein length:264 Short chain dehydrogenase  ali model follow..  25  6GGLLTDKVVVISGVGPALGTTLARRCAEQGADLVLAARTVERLEDVAKQVTDTGR---RALSVGTDITDDAQVAHLVDETMKAYGRVDVVINNAFRV---PSMKPFANTTFEHMRDAIELTVFGALRLIQGFTPALEESKGAVVNVNSMV-VRHSQAKYGAYKMAKSALLAMSQTLATELGEKGIRVNSVLPGYIWGGTLKSYHQAGKYGTSVEDIYNAAAAGSDLKRLPTEDEVASAILFMASDL-ASGITGQALDVNCGEYK.............. 263
8 -83.3003v8b_A mol:protein length:283 Putative dehydrogenase, possibly 3-oxoacyl-[a  ali model follow..  30  17MMNQPSPVALITGAGSGIGRATALALAADGVTVGALGRTRTEVEEVADEIVGAGG---QAIALEADVSDELQMRNAVRDLVLKFGHLDIVVANAGIN---GVWAPIDDLKPFEWDETIAVNLRGTFLTLHLTVPYLKQRGGAIVVVSSINGRTFTTPGATAYTATKAAQVAIVQQLALELGKHHIRVNAVCPGAIETNISDNTKLRHEEETAIPVEWPKGQVPITDGQPGRSEDVAELIRFLVSER-ARHVTGSPVWIDGGQGLL............. 276
9 -83.2002cfc_A mol:protein length:250 2-(R)-HYDROXYPROPYL-COM DEHYDROGENASE  ali model follow..  32  2.....SRVAIVTGASSGNGLAIATRFLARGDRVAALDLSAETLEETARTHWHA--YADKVLRVRADVADEGDVNAAIAATMEQFGAIDVLVNNAGIT-GNSEAGVLHTTPVEQFDKVMAVNVRGIFLGCRAVLPHMLQGAGVIVNIASVA-SLVAFPGRSAYTTSKGAVLQLTKSVAVDYAGSGIRCNAVCPGMIETPMTQWRLDQPE-------LRDQVLARIPQKEIGTAAQVADAVMFLAGED-ATYVNGAALVMDGAYTAI............. 250
10 -83.1004dqx_A mol:protein length:277 Probable oxidoreductase protein  ali model follow..  29  16SMDLNQRVCIVTGGGSGIGRATAELFAKNGAYVVVADVNEDAAVRVANEI------GSKAFGVRVDVSSAKDAESMVEKTTAKWGRVDVLVNNAGF----GTTGNVVTIPEETWDRIMSVNVKGIFLCSKYVIPVMRRNGGSIINTTSYT-ATSAIADRTAYVASKGAISSLTRAMAMDHAKEGIRVNAVAPGTIDSPYFTKIFAEAKDPA---KLRSDFNARAVMDRMGTAEEIAEAMLFLASDR-SRFATGSILTVDGGSSI.............. 265
11 -83.0003vc7_A mol:protein length:254 Putative oxidoreductase  ali model follow..  27  2VGNYQGKKAIVIGGTHGMGLATVRRLVEGGAEVLLTGRNESNIARIREEF------GPRVHALRSDIADLNEIAVLGAAAGQTLGAIDLLHINAGV----SELEPFDQVSEASYDRQFAVNTKGAFFTVQRLTPLI-REGGSIVFTSSVA-DEGGHPGMSVYSASKAALVSFASVLAAELLPRGIRVNSVSPGFIDTPTKGVAGITEAERA---EFKTLGDNITPMKRNGTADEVARAVLFLAFE--ATFTTGAKLAVDGGLGQ.............. 248
12 -82.8001zem_A mol:protein length:262 xylitol dehydrogenase  ali model follow..  29  4..KFNGKVCLVTGAGGNIGLATALRLAEEGTAIALLDMNREALEKAEASVREKGV---EARSYVCDVTSEEAVIGTVDSVVRDFGKIDFLFNNAGYQ---GAFAPVQDYPSDDFARVLTINVTGAFHVLKAVSRQMTQNYGRIVNTASMA-GVKGPPNMAAYGTSKGAIIALTETAALDLAPYNIRVNAISPGYMGPGFMWERQVELQAKTDPKVVAQQMIGSVPMRRYGDINEIPGVVAFLLGDD-SSFMTGVNLPIAGG................. 262
13 -82.7002d1y_A mol:protein length:256 hypothetical protein TT0321  ali model follow..  29  1MGLFAGKGVLVTGGARGIGRAIAQAFAREGALVALCDLRPEGKEVA---------EAIGGAFFQVDLEDERERVRFVEEAAYALGRVDVLVNNAAI----AAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMKVGGGAIVNVASVQ-GLFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAIALSPDPE---RTRRDWEDLHALRRLGKPEEVAEAVLFLASEK-ASFITGAILPVDGGMTA.............. 247
14 -82.7003afm_A mol:protein length:258 Carbonyl reductase  ali model follow..  32  2FPDLKGKRVLITGSSQGIGLATARLFARAGAKVGLHGRKAPAIDETIASMRADGG---DAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGGL---VGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAQTSAVISTGSIAGHTGGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDTAFHADKT---------QDVRDRISNGIPMGRFGTAEEMAPAFLFFASHLASGYITGQVLDINGGQYK.............. 257
15 -82.6003gvc_A mol:protein length:277 Probable short-chain type dehydrogenase/reduc  ali model follow..  29  18HPDLAGKVAIVTGAGAGIGLAVARRLADEGCHVLCADIDGDAADAAATKI------GCGAAACRVDVSDEQQIIAMVDACVAAFGGVDKLVANAGV----VHLASLIDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERGGAIVNLSSLA-GQVAVGGTGAYGMSKAGIIQLSRITAAELRSSGIRSNTLLPAFVDTPMQQTA--MAMFDGALGAGGARSMIARLQGRMAAPEEMAGIVVFLLSDD-ASMITGTTQIADGGTIA.............. 268
16 -82.6003pk0_A mol:protein length:262 Short-chain dehydrogenase/reductase SDR  ali model follow..  30  5MFDLQGRSVVVTGGTKGIGRGIATVFARAGANVAVAGRSTADIDACVADLDQLG--SGKVIGVQTDVSDRAQCDALAGRAVEEFGGIDVVCANAGV----FPDAPLATMTPEQLNGIFAVNVNGTFYAVQACLDALASGSGRVVLTSSITGPITGYPGWSHYGATKAAQLGFMRTAAIELAPHKITVNAIMPGNIMTEGLLENG---------EEYIASMARSIPAGALGTPEDIGHLAAFLATKE-AGYITGQAIAVDGGQVL.............. 253
17 -82.5001ahh_A mol:protein length:255 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  31  6NLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGG---QAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPK-----PFDMPMADFRRAYELNVFSFFHLSQLVAPEMKNGGGVILTITSMA-AENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPE--------IEQKMLQHTPIRRLGQPQDIANAALFLCSPA-ASWVSGQILTVSGGGVQ.............. 252
18 -82.3003gaf_A mol:protein length:256 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  35  7PFHLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDLKSEGAEAVAAAIRQAGG---KAIGLECNVTDEQHREAVIKAALDQFGKITVLVNNAGGGGPK-----PFDMPMSDFEWAFKLNLFSLFRLSQLAAPHMKAGGGAILNISSMA-GENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDALATVLTPE--------IERAMLKHTPLGRLGEAQDIANAALFLCSPA-AAWISGQVLTVSGGGVQ.............. 253
19 -82.2002zat_A mol:protein length:260 Dehydrogenase/reductase SDR family member 4  ali model follow..  30  9RKPLENKVALVTASTDGIGLAIARRLAQDGAHVVVSSRKQENVDRTVATLQGEGL---SVTGTVCHVGKAEDRERLVAMAVNLHGGVDILVSNAAV---NPFFGNIIDATEEVWDKILHVNVKATVLMTKAVVPEMKRGGGSVLIVSSVG-AYHPFPNLGPYNVSKTALLGLTKNLAVELAPRNIRVNCLAPGLIKTNFSQVLWMDKA-------RKEYMKESLRIRRLGNPEDCAGIVSFLCSED-ASYITGETVVVGGGTAS.............. 258
20 -82.0003o4r_A mol:protein length:261 Dehydrogenase/reductase SDR family member 4  ali model follow..  32  10RDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGL---SVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAV---NPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGSVVIVSSIA-AFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKE-------KEESMKETLRIRRLGEPEDCAGIVSFLCSED-ASYITGETVVVGGGTPS.............. 259
21 -81.9003n74_A mol:protein length:261 3-ketoacyl-(acyl-carrier-protein) reductase  ali model follow..  31  4SMSLEGKVALITGAGSGFGEGMAKRFAKGGAKVVIVDRDKAGAERVAGEI------GDAALAVAADISKEADVDAAVEAALSKFGKVDILVNNAGIG---HKPQNAELVEPEEFDRIVGVNVRGVYLMTSKLIPHFKENGCVILNVASTG-AGRPRPNLAWYNATKGWVVSVTKALAIELAPAKIRVVALNPVAGETPLLTTFMGEDS-----EEIRKKFRDSIPMGRLLKPDDLAEAAAFLCSPQ-ASMITGVALDVDGGRSI.............. 256
22 -81.8002ag5_A mol:protein length:246 dehydrogenase/reductase (SDR family) member 6  ali model follow..  32  1MGRLDGKVIILTAAAQGIGQAAALAFAREGAKVIATDINESKLQELEKYP--------GIQTRVLDVTKKKQIDQFA----NEVERLDVLFNVAGF----VHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMAQKSGNIINMSSVASSVKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQER----QARGNPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDE-SAYVTGNPVIIDGGWSL.............. 245
23 -81.8003lf1_A mol:protein length:265 Short Chain Oxidoreductase Q9HYA2  ali model follow..  28  3PYDLSEAVAVVTGGSSGIGLATVELLLEAGAAVAFCARDGERLRAAESALRQRF-PGARLFASVCDVLDALQVRAFAEACERTLGCASILVNNAGQ----GRVSTFAETTDEAWSEELQLKFFSVIHPVRAFLPQLESRAAAIVCVNSLL-ASQPEPHMVATSAARAGVKNLVRSMAFEFAPKGVRVNGILIGLVESGQWRRRFEAREEREAQWTAQLARNKQIPLGRLGKPIEAARAILFLASPL-SAYTTGSHIDVSGGLSR.............. 263
24 -81.7004DBZ Entity 1(prereleased)  ali follow..  26  15MATQDSEVALVTGATSGIGLEIARRLGKEGLRVFVCARGEEGLRTTLKELREAGV---EADGRTCDVRSVPEIEALVAAVVERYGPVDVLVNNAGR----PGGGATAELADELWLDVVETNLTGVFRVTKQVLKMLERGTGRIVNIASTG-GKQGLVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVHYSDIWEVSTEEAFDRITARVPIGRYVQPSEVAEMVAYLIGPG-AAAVTAQALNVCGGLGN.............. 274
25 -81.7001w4z_A mol:protein length:281 KETOACYL REDUCTASE  ali model follow..  26  15MATQDSEVALVTGATSGIGLEIARRLGKEGLRVFVCARGEEGLRTTLKELREAGV---EADGRTCDVRSVPEIEALVAAVVERYGPVDVLVNNAGR----PGGGATAELADELWLDVVETNLTGVFRVTKQVLKMLERGTGRIVNIASTG-GKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHDIWEVSTEEAFDRITARVPIGRYVQPSEVAEMVAYLIGPG-AAAVTAQALNVCGGLGN.............. 274
26 -81.6001nxq_A mol:protein length:251 R-alcohol dehydrogenase  ali model follow..  31  2.NRLDGKVAIITGGTLGIGLAIATKFVEEGAKVMITGRHSDVGEKAAKSVGTPD----QIQFFQHDSSDEDGWTKLFDATEKAFGPVSTLVNNAGI----AVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGASIINMSSIE-GFVGDPSLGAYNASKGAVRIMSKSAALDCALKDVRVNTVHPGYIKTPLVDDLPGAEE--------AMSQRTKTPMGHIGEPNDIAYICVYLASNE-SKFATGSEFVVDGGYTA.............. 250
27 -81.6003uxy_A mol:protein length:266 Short-chain dehydrogenase/reductase SDR  ali model follow..  28  17MQGFEGKVALVTGAAGGIGGAVVTALRAAGARVAVADRAVAGIAA--------------DLHLPGDLREAAYADGLPGAVAAGLGRLDIVVNNAGV----ISRGRITETTDADWSLSLGVNVEAPFRICRAAIPLMAAAGGAIVNVASCW-GLRPGPGHALYCLTKAALASLTQCMGMDHAPQGIRINAVCPNEVNTPMLRTG---AKRGFDPDRAVAELGRTVPLGRIAEPEDIADVVLFLASDA-ARYLCGSLVEVNGGKAVA............. 260
28 -81.4001k2w_A mol:protein length:256 SORBITOL DEHYDROGENASE  ali model follow..  30  2..RLDGKTALITGSARGIGRAFAEAYVREGARVAIADINLEAARATAAEI------GPAACAIALDVTDQASIDRCVAELLDRWGSIDILVNNAAL----FDLAPIVEITRESYDRLFAINVSGTLFMMQAVARAMIAGGGKIINMASQA-GRRGEALVGVYCATKAAVISLTQSAGLNLIRHGINVNAIAPGVVDGEHWDGVDAKDYENLPRGEKKRQVGAAVPFGRMGRAEDLTGMAIFLATPE-ADYIVAQTYNVDGGNWM.............. 255
29 -81.4001hxh_A mol:protein length:253 3BETA/17BETA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  26  2.NRLQGKVALVTGGASGVGLEVVKLLLGEGAKVAFSDINEAAGQQLAAEL------GERSMFVRHDVSSEADWTLVMAAVQRRLGTLNVLVNNAGI----LLPGDMETGRLEDFSRLLKINTESVFIGCQQGIAAMKETGGSIINMASVS-SWLPIEQYAGYSASKAAVSALTRAAALSCRKQGIRVNSIHPDGIYTPMMQASLPKGVS----KEMVLHDPKLNRAGRAYMPERIAQLVLFLASDE-SSVMSGSELHADNSILGM............. 251
30 -81.3003AY6 Entity 1(prereleased)  ali follow..  30  4YTDLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNEEEALDAKKEVEEAGG---QAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGV----ENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENKGNVINMSSVH-EMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKFADPVQ-------RADVESMIPMGYIGKPEEVAAVAAFLASSQ-ASYVTGITLFADGGMTKYPSFQ......... 259
31 -81.3001rwb_A mol:protein length:261 Glucose 1-dehydrogenase  ali model follow..  29  2YKDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRKEDEANSVLEEIKKVGG---EAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGL----ENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENKGTVINMSSVH-EKIPWPLFVHYAASKGGMKLMTKTLALEYAPKGIRVNNIGPGAINTPINAEKFADPE-------QRADVESMIPMGYIGEPEEIAAVAAWLASSE-ASYVTGITLFADGGMTLYPSFQA........ 258
32 -81.3001g6k_A mol:protein length:261 GLUCOSE 1-DEHYDROGENASE  ali model follow..  29  2YKDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRKEDEANSVLEEIKKVGG---EAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGL----ANPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENKGTVINMSSVH-EKIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKFADPE-------QRADVESMIPMGYIGEPEEIAAVAAWLASSE-ASYVTGITLFADGGMTQYPSFQ......... 257
33 -81.3003aus_A mol:protein length:269 Glucose 1-dehydrogenase 4  ali model follow..  29  4YTDLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNEEEALDAKKEVEEAGG---QAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGV----ENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENKGNVINMSSVH-EMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKFADPVQ-------RADVESMIPMGYIGKPEEVAAVAAFLASSQ-ASYVTGITLFADGGMTKYPSFQA........ 260
34 -81.2003ak4_A mol:protein length:263 NADH-dependent quinuclidinone reductase  ali model follow..  27  7IFDLSGRKAIVTGGSKGIGAAIARALDKAGATVAIADLDVMAAQAVVAGLENGG------FAVEVDVTKRASVDAAMQKAIDALGGFDLLCANAGV----STMRPAVDITDEEWDFNFDVNARGVFLANQIACRHFLASNGVIVNTASLA-AKVGAPLLAHYSASKFAVFGWTQALAREMAPKNIRVNCVCPGFVKTAMQEREIIWEAELRGMEAVRAEYVSLTPLGRIEEPEDVADVVVFLASDA-ARFMTGQGINVTGGVRM.............. 262
35 -81.1002ae1_A mol:protein length:260 TROPINONE REDUCTASE-II  ali model follow..  30  4RWNLEGCTALVTGGSRGIGYGIVEELASLGASVYTCSRNQKELNDCLTQWRSKGF---KVEASVCDLSSRSERQELMNTVANHFGKLNILVNNAGI----VIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASEGNVVFISSVS-GALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSLVEMTIQDPEQ----KENLNKLIDRCALRRMGEPKELAAMVAFLCFP-AASYVTGQIIYVDGGLMANCGF.......... 260
36 -81.0003o38_A mol:protein length:266 Short chain dehydrogenase  ali model follow..  33  17HGLLKGKVVLVTAAATGIGSTTARRALLEGADVVISDYHERRLGETRDQLADLG--LGRVEAVVCDVTSTEAVDALITQTVEKAGRLDVLVNNAGL----GGQTPVVDMTDEEWDRVLNVTLTSVMRATRAALRYFRGVDGVIVNNASVL-GWRAQHSQSHYAAAKAGVMALTRCSAIEAVEFGVRINAVSPSIARHKFLEKTSSSE--------LLDRLASDEAFGRAAEPWEVAATIAFLASDY-SSYMTGEVVSVSSQRA............... 266
37 -81.0003ndr_A mol:protein length:247 3-oxoacyl-(Acyl-carrier protein) reductase  ali model follow..  26  2.ERLAGKTALVTGAAQGIGKAIAARLAADGATVIVSDINAEGAKAAAASI------GKKARAIAADISDPGSVKALFAEIQALTGGIDILVNNASI----VPFVAWDDVDLDHWRKIIDVNLTGTFIVTRAGTDQMRAAGGRVISIASNT-FFAGTPNMAAYVAAKGGVIGFTRALATELGKYNITANAVTPGLIESDGVKASPHNEAF--------GFVEMLQAMKGKGQPEHIADVVSFLASDD-ARWITGQTLNVDAGMVR.............. 246
38 -81.0002fwm_X mol:protein length:250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogena  ali model follow..  28  2HMDFSGKNVWVTGAGKGIGYATALAFVEAGAKVTGFDQAFTQ-------------EQYPFATEVMDVADAAQVAQVCQRLLAETERLDALVNAAGI----LRMGATDQLSKEDWQQTFAVNVGGAFNLFQQTMNQFRQRGGAIVTVASDA-AHTPRIGMSAYGASKAALKSLALSVGLELAGSGVRCNVVSPGSTDTDMQRTLWVSDDAEEQIRGFGEQFKLGIPLGKIARPQEIANTILFLASDL-ASHITLQDIVVDGGSTL.............. 248
39 -80.8002ew8_A mol:protein length:249 (S)-1-Phenylethanol dehydrogenase  ali model follow..  32  2TQRLKDKLAVITGGANGIGRAIAERFAVEGADIAIADLVPA--PEAEAAIRNLGR---RVLTVKCDVSQPGDVEAFGKQVISTFGRCDILVNNAGI----YPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGGRIINLTSTT-YWLKIEAYTHYISTKAANIGFTRALASDLGKDGITVNAIAPSLVRTATTEASALSAMFDVLPNMLQ-------AIPRLQVPLDLTGAAAFLASDD-ASFITGQTLAVDGGMVR.............. 248
40 -80.8002a4k_A mol:protein length:263 3-oxoacyl-[acyl carrier protein] reductase  ali model follow..  30  1MGRLSGKTILVTGAASGIGRAALDLFAREGASLVAVDREERLLAEAVAAL------EAEAIAVVADVSDPKAVEAVFAEALEEFGRLHGVAHFAGV----AHSALSWNLPLEAWEKVLRVNLTGSFLVARKAGEVL-EEGGSLVLTGSVAG--LGAFGLAHYAAGKLGVVGLARTLALELARKGVRVNVLLPGLIQTPMTAGLP---------PWAWEQEVGASPLGRAGRPEEVAQAALFLLSEE-SAYITGQALYVDGGRSIV............. 242
41 -80.8001geg_A mol:protein length:256 ACETOIN REDUCTASE  ali model follow..  29  2.....KKVALVTGAGQGIGKAIALRLVKDGFAVAIADYNDATAKAVASEINQAGG---HAVAVKVDVSDRDQVFAAVEQARKTLGGFDVIVNNAGV----APSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKEGGKIINACSQA-GHVGNPELAVYSSSKFAVRGLTQTAARDLAPLGITVNGYCPGIVKTPMWAEIDRQEAAGKPLGYGTAEFAKRITLGRLSEPEDVAACVSYLASPD-SDYMTGQSLLIDGGMVF.............. 255
42 -80.6004dml_A mol:protein length:269 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  32  17ALPLTDRIALVTGASRGIGRAIALELAAAGAKVAVNYASAGAADEVVAAIAAAGG---EAFAVKADVSQESEVEALFAAVIERWGRLDVLVNNAGI----TRDTLLLRMKRDDWQSVLDLNLGGVFLCSRAAAKMLKQRSGRIINIASVV-GEMGNPGQANYSAAKAGVIGLTKTVAKELASRGITVNAVAPGFIATDMTSELAA------------EKLLEVIPLGRYGEAAEVAGVVRFLAADPAAAYITGQVINIDGGLVM.............. 262
43 -80.5003qiv_A mol:protein length:253 short-chain dehydrogenase or 3-oxoacyl-[acyl-  ali model follow..  32  4SMRFENKVGIVTGSGGGIGQAYAEALAREGAAVVVADINAEAAEAVAKQIVADGG---TAISVAVDVSDPESAKAMADRTLAEFGGIDYLVNNAAIF-GGMKLDFLLTIDPEYYKKFMSVNLDGALWCTRAVYKKMKRGGGAIVNQSSTA----AWLYSNYYGLAKVGINGLTQQLSRELGGRNIRINAIAPGPIDTEANRTT----------KEMVDDIVKGLPLSRMGTPDDLVGMCLFLLSDE-ASWITGQIFNVDGGQII.............. 251
44 -80.5003sju_A mol:protein length:279 Keto reductase  ali model follow..  24  13SHMSRPQTAFVTGVSSGIGLAVARTLAARGIAVYGCARDAKNVSAAVDGLRAAGH---DVDGSSCDVTSTDEVHAAVAAAVERFGPIGILVNSAGR----NGGGETADLDDALWADVLDTNLTGVFRVTREVLRMREAGWGRIVNIASTG-GKQGVMYAAPYTASKHGVVGFTKSVGFELAKTGITVNAVCPGYVETPMAERVREGYARHWGVQEVHERFNAKIPLGRYSTPEEVAGLVGYLVTDA-AASITAQALNVCGGLGN.............. 272
45 -80.3003lyl_A mol:protein length:247 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  28  2..SLNEKVALVTGASRGIGFEVAHALASKGATVVGTATSQASAEKFENSMKEKGF---KARGLVLNISDIESIQNFFAEIKAENLAIDILVNNAGI----TRDNLMMRMSEDEWQSVINTNLSSIFRMSKECVRMMKKRWGRIISIGSVV-GSAGNPGQTNYCAAKAGVIGFSKSLAYEVASRNITVNVVAPGFIATDMTDKLT---------DEQKSFIATKIPSGQIGEPKDIAAAVAFLASEE-AKYITGQTLHVNGGMYM.............. 246
46 -80.3003VM3 Entity 1(prereleased)  ali follow..  32  8RWRLDGQTALITGASAGIGLAIAHELAGFGADLMIVGRDIDMLETARDELLDVY-PQMQVHALAADVSDDEDRRQILDWVEDHSDGLHILVNNAGG----NVTKAATEYSEDEWRKIFETNLFSAFELSRYAHPLLARHASSIVNVGSVS-GLTHVRSGVVYGMSKAAMHQMTRNLAVEWAEDGIRVNAVAPWYIRTRRTSGPLSDPD-------YYEEVINRTPMRRIGEPEEVAAAVGFLCLP-AASYVTGECIAVDGGFLR.............. 258
47 -80.3001ae1_A mol:protein length:273 TROPINONE REDUCTASE-I  ali model follow..  32  18..SLKGTTALVTGGSKGIGYAIVEELAGLGARVYTCSRNEKELDECLEIWREKGL---NVEGSVCDLLSRTERDKLMQTVAHVFGKLNILVNNAGV----VIHKEAKDFTEKDYNIIMGTNFEAAYHLSQIAYPLLKASQGNVIFLSSIA-GFSALPSVSLYSASKGAINQMTKSLACEWAKDNIRVNSVAPGVILTPLVETAIKKNPHQK---EEIDNFIVKTPMGRAGKPQEVSALIAFLCFP-AASYITGQIIWADGGFTA.............. 269
48 -80.2003rro_A mol:protein length:251 3-ketoacyl-(acyl-carrier-protein) reductase  ali model follow..  31  7FMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYL------GDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGI----TRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRMMKKRQGRIINVGSVV-GTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALN---------DEQRTATLAQVPAGRLGDPREIASAVAFLASPE-AAYITGETLHVNGGMYMI............. 251
49 -80.2003enn_A mol:protein length:249 GLUCOSE/RIBITOL DEHYDROGENASE  ali model follow..  27  5MFDLTGRKALVTGATGGLGEAIARALHAQGAIVGLHGTREEKLKELAAEL------GERIFVFPANLSDREAVKALGQKAEEEMGGVDILVNNAGI----TRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHMMRRRNGRIINITSIV-GVTGNPGQANYCASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIESAMTGKLN---------EKQKDAIMGNIPMKRMGVGADIAAAVVYLASDE-AAYVTGQTLHVNGGMAMI............. 249
50 -80.2001uls_A mol:protein length:245 putative 3-oxoacyl-acyl carrier protein reduc  ali model follow..  30  2..RLKDKAVLITGAAHGIGRATLELFAKEGARLVACDIEEGPLREAAEAVGAHP--------VVMDVADPASVERGFAEALAHLGRLDGVVHYAGI----TRDNFHWKMPLEDWELVLRVNLTGSFLVAKAASEAMEKNPGSIVLTASRVY--LGNLGQANYAASMAGVVGLTRTLALELGRWGIRVNTLAPGFIETRMTAKVP---------EKVREKAIAATPLGRAGKPLEVAYAALFLLSDE-SSFITGQVLFVDGGRTI.............. 240
51 -80.2003svt_A mol:protein length:281 Short-chain type dehydrogenase/reductase  ali model follow..  27  6QLSFQDRTYLVTGGGSGIGKGVAAGLVAAGASVMIVGRNPDKLAGAVQELEALGANGGAIRYEPTDITNEDETARAVDAVTAWHGRLHGVVHCAGGS---ENIGPITQVDSEAWRRTVDLNVNGTMYVLKHAAREMRGGGGSFVGISSIA-ASNTHRWFGAYGVTKSAVDHLMQLAADELGASWVRVNSIRPGLIRTDLVAAITESAE-------LSSDYAMCTPLPRQGEVEDVANMAMFLLSDA-ASFVTGQVINVDGGQMLRRG........... 261
52 -80.1002zk7_A mol:protein length:257 Glucose 1-dehydrogenase related protein  ali model follow..  29  4FSDLRDKVVIVTGASMGIGRAIAERFVDEGSKVIDLSIHDPG--------------EAKYDHIECDVTNPDQVKASIDHIFKEYGSISVLVNNAGI----ESYGKIESMSMGEWRRIIDVNLFGYYYASKFAIPYMRSRDPSIVNISSVQ-ASIITKNASAYVTSKHAVIGLTKSIALDYA-PLLRCNAVCPATIDTPLVRKAAELESDPMRIEKKISEWGHEHPMQRIGKPQEVASAVAFLASRE-ASFITGTCLYVDGGLSI.............. 249
53 -80.0003oic_A mol:protein length:258 Enoyl-[acyl-carrier-protein] reductase [NADPH  ali model follow..  29  2...EQNKCALVTGSSRGVGKAAAIRLAENGYNIVINYRSKKAALETAEEIEKLGV---KVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAAS----GVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMKNGGGHIVSISSLG-SIRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDALKHFPNRED-------LLEDARQNTPAGRMVEIKDMVDTVEFLVSSK-ADMIRGQTIIVDGGRSLLV............ 250
54 -80.0001i01_A mol:protein length:244 BETA-KETOACYL [ACP] REDUCTASE  ali model follow..  32  2..NFEGKIALVTGASRGIGRAIAETLAARGAKVIGTATSENGAQAISDYL------GANGKGLMLNVTDPASIESVLEKIRAEFGEVDILVNNAGI----TRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRMMKKRHGRIITIGSVV-GTMGNGGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALS---------DDQRAGILAQVPAGRLGGAQEIANAVAFLASDE-AAYITGETLHVNGGMYMV............. 244
55 -79.9001hdc_A mol:protein length:254 3-ALPHA, 20 BETA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  29  1.NDLSGKTVIITGGARGLGAEAARQAVAAGARVVLADVLDEEGAATAREL------GDAARYQHLDVTIEEDWQRVVAYAREEFGSVDGLVNNAGI----STGMFLETESVERFRKVVEINLTGVFIGMKTVIPAMKDAGGSIVNISSAA-GLMGLALTSSYGASKWGVRGLSKLAAVELGTDRIRVNSVHPGMTYTPMTAETG---------IRQGEGNYPNTPMGRVGEPGEIAGAVVKLLSDT-SSYVTGAELAVDGGWTT.............. 244
56 -79.8001bdb_A mol:protein length:277 CIS-BIPHENYL-2,3-DIHYDRODIOL-2,3-DEHYDROGENAS  ali model follow..  26  2..KLKGEAVLITGGASGLGRALVDRFVAEGAKVAVLDKSAERLAELETDH------GDNVLGIVGDVRSLEDQKQAASRCVARFGKIDTLIPNAGIWDYSTLVDLPEESLDAAFDEVFHINVKGYIHAVKACLPALVASRGNVIFTISNA-GFYPNGGGPLYTAAKHAIVGLVRELAFELAP-YVRVNGVGSGGINSDLRGPSSLGGSKAISTVPLADMLKSVLPIGRMPEVEEYTGAYVFFATRGDAAPATGALLNYDGGLGV.............. 257
57 -79.8001nff_A mol:protein length:260 Putative oxidoreductase Rv2002  ali model follow..  31  2SGRLTGKVALVSGGARGMGASHVRAMVAEGAKVVFGDILDEEGKAMAAEL------ADAARYVHLDVTQPAQWKAAVDTAVTAFGGLHVLVNNAGI----LNIGTIEDYALTEWQRILDVNLTGVFLGIRAVVKPMKEAGGSIINISSIE-GLAGTVACHGYTATKFAVRGLTKSTALELGPSGIRVNSIHPGLVKTPMTDWVPED--------------IFQTALGRAAEPVEVSNLVVYLASDE-SSYSTGAEFVVDGGTVA.............. 240
58 -79.7003edm_A mol:protein length:259 Short chain dehydrogenase  ali model follow..  29  3LQRFTNRTIVVAGAGRDIGRACAIRFAQEGANVVLTYNAAEGAATAVAEIEKLGR---SALAIKADLTNAAEVEAAISAAADKFGEIHGLVHVAGGL---IARKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAK-GGAIVTFSSQAGRDGGGPGALAYATSKGAVMTFTRGLAKEVGPK-IRVNAVCPGMISTTFHDTFTKPE--------VRERVAGATSLKREGSSEDVAGLVAFLASDD-AAYVTGACYDINGGVLFSEG........... 253
59 -79.6001doh_A mol:protein length:283 TRIHYDROXYNAPHTHALENE REDUCTASE  ali model follow..  28  24SASLEGKVALVTGAGRGIGREMAMELGRRGCKVIVNANSTESAEEVVAAIKKNGS---DAACVKANVGVVEDIVRMFEEAVKIFGKLDIVCSNSGV----VSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHL-EIGGRLILMGSITGQAKAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYHAVCREGENLSNEEVDEYAAVQWSPLRRVGLPIDIARVVCFLASND-GGWVTGKVIGIDGGACM.............. 283
60 -79.5002dtd_A mol:protein length:264 Glucose 1-dehydrogenase related protein  ali model follow..  28  3FSDLRDKVVIVTGASMGIGRAIAERFVDEGSKVIDLSIHDPG--------------EAKYDHIECDVTNPDQVKASIDHIFKEYGSISVLVNNAGI----ESYGKIESMSMGEWRRIIDVNLFGYYYASKFAIPYMRSRDPSIVNISSVQ-ASIITKNASAYVTSKHAVIGLTKSIALDYA-PLLRCNAVCPATIDTPLVRKAAELEVGSDRIEKKISEWGHEHPMQRIGKPQEVASAVAFLASRE-ASFITGTCLYVDGGLSIRAPISTPELE.... 258
61 -79.4003rih_A mol:protein length:293 short chain dehydrogenase or reductase  ali model follow..  30  30MFDLSARSVLVTGGTKGIGRGIATVFARAGANVAVAARSPRELSSVTAELGELG--AGNVIGVRLDVSDPGSCADAARTVVDAFGALDVVCANAGI----FPEARLDTMTPEQLSEVLDVNVKGTVYTVQACLAPLASGRGRVILTSSITGPVTGYPGWSHYGASKAAQLGFMRTAAIELAPRGVTVNAILPGNILTEGLVDMG---------EEYISGMARSIPMGMLGSPVDIGHLAAFLATDE-AGYITGQAIVVDGGQVL.............. 278
62 -79.4003awd_A mol:protein length:260 Putative polyol dehydrogenase  ali model follow..  26  8KLRLDNRVAIVTGGAQNIGLACVTALAEAGARVIIADLDEAMATKAVEDLRMEGH---DVSSVVMDVTNTESVQNAVRSVHEQEGRVDILVACAGICI---SEVKAEDMTDGQWLKQVDINLNGMFRSCQAVGRIMEQKQGVIVAIGSMSGLIVNRPQQAAYNASKAGVHQYIRSLAAEWAPHGIRANAVAPTYIETTLTRFGMEKPE-------LYDAWIAGTPMGRVGQPDEVASVVQFLASD-AASLMTGAIVNVDAGFTV.............. 259
63 -79.3003grp_A mol:protein length:266 3-oxoacyl-(Acyl carrierprotein) reductase  ali model follow..  26  16MFKLTGRKALVTGATGGIGEAIARCFHAQGAIVGLHGTREDKLKEIAADL------GKDVFVFSANLSDRKSIKQLAEVAEREMEGIDILVNNAGI----TRDGLFVRMQDQDWDDVLAVNLTAASTLTRELIHMMRRRYGRIINITSIV-GVVGNPGQTNYCAAKAGLIGFSKALAQEIASRNITVNCIAPGFIKSAMTDKLN---------EKQKEAIMAMIPMKRMGIGEEIAFATVYLASDE-AAYLTGQTLHINGGMAMI............. 260
64 -79.2003ai1_A mol:protein length:263 NADPH-sorbose reductase  ali model follow..  29  4..GISGKVAVITGSSSGIGLAIAEGFAKEGAHIVLVARQVDRLHEAARSLKEK--FGVRVLEVAVDVATPEGVDAVVESVRSSFGGADILVNNAGT----GSNETIMEAADEKWQFYWELHVMAAVRLARGLVPGMRARGGAIIHNASI-CAVQPLWYEPIYNVTKAALMMFSKTLATEVIKDNIRVNCINPGLILTPDWIKTAKEDNGGDWKGYLQSVADEHAPIKRFASPEELANFFVFLCSER-ATYSVGSAYFVDGGMLK.............. 261
65 -79.0003a28_C mol:protein length:258 L-2.3-butanediol dehydrogenase  ali model follow..  30  2.....SKVAMVTGGAQGIGRGISEKLAADGFDIAVADQQEEQAAETIKLIEAAD---QKAVFVGLDVTDKANFDSAIDEAAEKLGGFDVLVNNAGI----AQIKPLLEVTEEDLKQIYSVNVFSVFFGIQAASRKFDELGGKIINAASIA-AIQGFPILSAYSTTKFAVRGLTQAAAQELAPKGHTVNAYAPGIVGTGMWEQIDAEKINGKPIGENFKEYSSSIALGRPSVPEDVAGLVSFLASEN-SNYVTGQVMLVDGGMLY.............. 257
66 -79.0001xq1_A mol:protein length:266 PUTATIVE TROPINONE REDUCATSE  ali model follow..  31  9RWSLKAKTVLVTGGTKGIGHAIVEEFAGFGAVIHTCARNEYELNECLSKWQKKGF---QVTGSVCDASLRPEREKLMQTVSSMFGKLDILINNLGA----IRSKPTLDYTAEDFSFHISTNLESAYHLSQLAHPLLKASGGNIIFMSSIA-GVVSASVGSIYSATKGALNQLARNLACEWASDGIRANAVAPAVIATPLAEAVYDDE--------FKKVVISRKPLGRFGEPEEVSSLVAFLCMP-AASYITGQTICVDGGLTV.............. 257
67 -78.9002y93_A mol:protein length:281 CIS-2,3-DIHYDROBIPHENYL-2,3-DIOL DEHYDROGENAS  ali model follow..  28  2..KLTGEVALITGGASGLGRALVDRFVAEGARVAVLDKSAERLRELEVAH------GGNAVGVVGDVRSLQDQKRAAERCLAAFGKIDTLIPNAGIWDYSTLADLPEDKIDAAFDDIFHVNVKGYIHAVKACLPALVSSRGSVVFTISNA-GFYPNGGGPLYTATKHAVVGLVRQMAFELA-PHVRVNGVAPGGMNTDLRGPSSLGSEQSISSVPLADMLKSVLPIGRMPALEEYTGAYVFFATRGDSLPATGALLNYDGGMGV.............. 257
68 -78.8003ftp_A mol:protein length:270 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  33  17DKTLDKQVAIVTGASRGIGRAIALELARRGAMVIGTATTEAGAEGIGAAFKQAGL---EGRGAVLNVNDATAVDALVESTLKEFGALNVLVNNAGI----TQDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLRMMKARGGRIVNITSVV-GSAGNPGQVNYAAAKAGVAGMTRALAREIGSRGITVNCVAPGFIDTDMTKGLP---------QEQQTALKTQIPLGRLGSPEDIAHAVAFLASPQ-AGYITGTTLHVNGGMFM.............. 263
69 -78.6002q2q_A mol:protein length:255 Beta-D-hydroxybutyrate dehydrogenase  ali model follow..  27  1..TLKGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDP--APALAEIARHGV---KAVHHPADLSDVAQIEALFALAEREFGGVDILVNNAGI----QHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNGRIINIASVH-GLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDRAANGGDQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEA-GSQVRGAAWNVDGGWLA.............. 254
70 -78.6001edo_A mol:protein length:244 BETA-KETO ACYL CARRIER PROTEIN REDUCTASE  ali model follow..  30  1.....SPVVVVTGASRGIGKAIALSLGKAGCKVLVNYRSAKAAEEVSKQIEAYGG---QAITFGGDVSKEADVEAMMKTAIDAWGTIDVVVNNAGI----TRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATKMMKKRKGRIINIASVV-GLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDMTAKLG---------EDMEKKILGTIPLGRTGQPENVAGLVEFLALSPAASYITGQAFTIDGGIAI.............. 244
71 -78.5002p68_A mol:protein length:248 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  29  2EIKLQGKVSLVTGSTRGIGRAIAEKLASAGSTVIITGTSGERAKAVAEEIANK--YGVKAHGVEMNLLSEESINKAFEEIYNLVDGIDILVNNAGI----TRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRMIKQRWGRIVNISSVV-GFTGNVGQVNYSTTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDMTAVLS---------EEIKQKYKEQIPLGRFGSPEEVANVVLFLCSEL-ASYITGEVIHVNGGM................ 247
72 -78.4003tzq_B mol:protein length:271 Short-chain type dehydrogenase/reductase  ali model follow..  32  6TAELENKVAIITGACGGIGLETSRVLARAGARVVLADLPETDLAGAAASV------GRGAVHHVVDLTNEVSVRALIDFTIDTFGRLDIVDNNAAHS--DPADMLVTQMTVDVWDDTFTVNARGTMLMCKYAIPRLSAGGGAIVNISSAT-AHAAYDMSTAYACTKAAIETLTRYVATQYGRHGVRCNAIAPGLVRTPRLEVG----------QPIVDIFATHHLAGRIGEPHEIAELVCFLASDR-AAFITGQVIAADSGLLA.............. 252
73 -78.3001pwx_A mol:protein length:254 halohydrin dehalogenase  ali model follow..  19  2......STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDEL---------EAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFA---PEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKGHIIFITSAT-PFGPWKELSTYTSARAGACTLANALSKELGEYNIPVFAIGPNYLHSEDSPYF-YPTEPWKTNPEHVAHVKKVTALQRLGTQKELGELVAFLASGS-CDYLTGQVFWLAGGFPMIERWP......... 250
74 -78.1003ksu_A mol:protein length:262 3-oxoacyl-acyl carrier protein reductase  ali model follow..  24  6YHDLKNKVIVIAGGIKNLGALTAKTFALESVNLVLHYHQAKDSDTANKLKDELEDQGAKVALYQSDLSNEEEVAKLFDFAEKEFGKVDIAINTVGK----VLKKPIVETSEAEFDAMDTINNKVAYFFIKQAAKHMNP-NGHIITIATSL-LAAYTGFYSTYAGNKAPVEHYTRAASKELMKQQISVNAIAPGPMDTSFFYGQETKEST--------AFHKSQAMGNQLTKIEDIAPIIKFLTTD--GWWINGQTIFANGGYTTREG........... 256
75 -78.1003i4f_A mol:protein length:264 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  24  4..GRFVRHALITAGTKGLGKQVTEKLLAKGYSVTVTYHDTTAMETMKETYKDVEE---RLQFVQADVTKKEDLHKIVEEAMSHFGKIDFLINNAGPYV--FERKKLVDYEEDEWNEMIQGNLTAVFHLLKLVVPVMRKQNGRIINYGQGADSAPGWIYRSAFAAAKVGLVSLTKTVAYEEAEYGITANMVCPGDIIGEMKEATI---------QEARQLKEHNTPIGRSGTGEDIARTISFLCEDD-SDMITGTIIEVTGAVDVI............. 254

FFAS is supported by the NIH grant R01-GM087218-01
6 1 9 8 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.