current user: public




Query: 1ri7_A mol:protein length:171 Putative transcriptional regulator, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .
# Score Template Links and tools%idFirst MGSSSSGLVPRGSHMRVPLDEIDKKIIKILQNDGKAPLREISKITGLAESTIHERIRKLRESGVIKKFTAIIDPEALGYSMLAFILVKVKAGKYSEVASNLAKYPEIVEVYETTGDYDMVVKIRTKNSEELNNFLDLIGSIPGVEGTHTMIVLKTHKETTELPIKLast
1 -84.3001ri7_A mol:protein length:171 Putative transcriptional regulator  ali model  100  1MGSSSSGLVPRGSHMRVPLDEIDKKIIKILQNDGKAPLREISKITGLAESTIHERIRKLRESGVIKKFTAIIDPEALGYSMLAFILVKVKAGKYSEVASNLAKYPEIVEVYETTGDYDMVVKIRTKNSEELNNFLDLIGSIPGVEGTHTMIVLKTHKETTELPIK 165
2 -75.8002gqq_A mol:protein length:163 Leucine-responsive regulatory protein  ali model follow..  31  1........VDSKKRPGKDLDRIDRNILNELQKDGRISNVELSKRVGLSPTPCLERVRRLERQGFIQGYTALLNPHYLDASLLVFVEITLNRGAFEQFNTAVQKLEEIQECHLVSGDFDYLLKTRVPDMSAYRKLLETLLRLPGVNDTRTYVVMEEVKQSNRLVIK 161
3 -74.7003i4p_A mol:protein length:162 Transcriptional regulator, AsnC family  ali model follow..  25  1..................MDRLDRKILRILQEDSTLAVADLAKKVGLSTTPCWRRIQKMEEDGVIRRRVALLDPVKVNTKVTVFVSIRTASHSLKRFSEVVSEFPEVVEFYRMSGDVDYLLRVVVPDIAAYDAFYKRMIAKIEIRDVSSAFAMEQIKYTTELPLD 150
4 -73.5002cg4_A mol:protein length:152 REGULATORY PROTEIN ASNC  ali model follow..  28  1.............MENYLIDNLDRGILEALMGNARTAYAELAKQFGVSPETIHVRVEKMKQAGIITGARIDVSPKQLGYDVGCFIGIILKSAKYPSALAKLESLDEVTEAYYTTGHYSIFIKVMCRSIDALQHVLNKIQTIDEIQSTETLIVLQNPIMRTIKP.. 152
5 -73.2002p5v_A mol:protein length:162 Transcriptional regulator, LRP/AsnC family  ali model follow..  28  1...........GPMPQLTLDKTDIKILQVLQENGRLTNVELSERVALSPSPCLRRLKQLEDAGIVRQYAALLSPESVNLGLQAFIRVSIRKAKREDFAASVRKWPEVLSCFALTGETDYLLQAFFTDMNAFSHFVDTLLSHHGVQDAQSSFVLKEIKHTTSLPLN 157
6 -71.9002e7w_A mol:protein length:150 150aa long hypothetical transcriptional regul  ali model follow..  39  1..................MDEIDLRILKILQYNAKYSLDEIAREIRIPKSTLSYRIKKLEKDGVIKGYYAYINPASLNLDYIVITSVKAKYGKHVELGNKLAQIPGVWGVYFVLGDNDFIVMARYKTREEFMEKFERVMSIPEVERTSTQVVVKIIKESPNIVI. 149
7 -71.9002cfx_A mol:protein length:144 HTH-TYPE TRANSCRIPTIONAL REGULATOR LRPC  ali model follow..  25  1................MKLDQIDLNIIEELKKDSRLSMRELGRKIKLSPPSVTERVRQLESFGIIKQYTLEVDQKKLGLPVSCIVEATVKNADYERFKSYIQTLPNIEFCYRIAGAACYMLKINAESLEAVEDFINKT---SPYAQTVTHVIFSEIDTKNGR... 143
8 -71.4002ivm_A mol:protein length:150 TRANSCRIPTIONAL REGULATORY PROTEIN  ali model follow..  26  1..............MNEALDDIDRILVRELAADGRGTLSELATRAGLSVSAVQSRVRRLESRGVVQGYSARINPEAVGHLLSAFVAITPDPSQPDDAPARLEHIEEVESCYSVAGEESYVLLVRVASARALEDLLQRIRTTANVRTRSTIILNTFYSDRQHIP.. 150
9 -71.3002w25_A mol:protein length:150 PROBABLE TRANSCRIPTIONAL REGULATORY PROTEIN  ali model follow..  26  1..............MNEALDDIDRILVRELAADGRATLSELATRAGLSVSAVQSRVRRLESRGVVQGYSARINPEAVGHLLSAFVAITPDPSQPDDAPARLEHIEEVESCYSVAGEASYVLLVRVASARALEDLLQRIRTTANVRTRSTIILNTFYSDRQHIP.. 150
10 -71.2002w29_A mol:protein length:150 PROBABLE TRANSCRIPTIONAL REGULATORY PROTEIN  ali model follow..  26  1..............MNEALDDIDRILVRELAADGRATLSELATRAGLSVSAVQSRVRRLESRGVVQGYSARINPEAVGHLLSAFVAITPDPSQPDDAPARLEHIEEVESCYSVATEESYVLLVRVASARALEDLLQRIRTTANVRTRSTIILNTFYSDRQHIP.. 150
11 -70.8002qz8_A mol:protein length:149 Probable transcriptional regulatory protein  ali model follow..  25  1...............NEALDDIDRILVRELAADGRVTLSELATRAGLSVSAVQSRVRRLESRGVVQGYSARINPEAVGHLLSAFVAITPDPSQPDDAPARLEHIEEVESCYSVAGEESYVMLVRVASARALEDLLQRIRTTANVRTRSTIILNTFYSDRQHIP.. 149
12 -70.6001i1g_A mol:protein length:141 TRANSCRIPTIONAL REGULATOR LRPA  ali model follow..  35  2..................IDERDKIILEILEKDARTPFTEIAKKLGISETAVRKRVKALEEKGIIEGYTIKINPKKLGYSLVTITGVDTKPEKLFEVAEKLKEYDFVKELYLSSGDHMIMAVIWAKDGEDLAEIINKIGKIEGVTKVCPAIILEKLK........ 141
13 -63.9002dbb_A mol:protein length:151 Putative HTH-type transcriptional regulator P  ali model follow..  24  6.................KLDRVDMQLVKILSENSRLTYRELADILNTTRQRIARRIDKLKKLGIIRKFTIIPDIDKLGYMYAIVLIKSKVPSDADKVISEISDIEYVKSVEKGVGRYNIIVRLLLKDIKDAENLIEFLQRIKNAENVEVILISEVRKFEI..... 150
14 -59.0002ia0_A mol:protein length:171 Putative HTH-type transcriptional regulator P  ali model follow..  26  2...........AGSSEIHLDDLDRNILRLLKKDARLTISELSEQLKKPESTIHFRIKKLQERGVIERYTIILGEQLLALIVLEVGKPVIEDFLISYISSTLSALPGVLFVA-KSGEDKIIALVGKNNKDELVKFIENITSIPNLKHIQI-FPITEIKKGEDLTG. 160
15 -37.2002l4a_A mol:protein length:66 Leucine responsive regulatory protein  ali model follow..  34  1.......MVDSKKRPGKDLDRIDRNILNELQKDGRISNVELSKRVGLSPTPCLERVRRLERQGFIQGYTALLN............................................................................................ 66
16 -32.8002djw_A mol:protein length:92 probable transcriptional regulator, AsnC fami  ali model follow..  31  2................................................................................ITAFVLIRPRGNRVQALGEAIAELPQVAEVYSVTGPYDLVALVRLKDVEELDDVVQGILSLEGVERTETLLAFRAYPRR...... 81
17 -31.3002zbc_A mol:protein length:83 83aa long hypothetical transcriptional regula  ali model follow..  30  2................................................................................ASAIVLINTDAGGEDEVFERLKSMSEVTEVHVVYGVYDIVVKVEADSMDKLKDFVNTIRKLPKVRSTLTMIIVEGKSLVKK.... 83
18 -30.8002cvi_A mol:protein length:83 75aa long hypothetical regulatory protein Asn  ali model follow..  37  2................................................................................VTAFILMVTAAGKEREVMEKLLAMPEVKEAYVVYGEYDLIVKVETDTLKDLDQFIEKIRKMPEIQMTSTMIAILE.......... 77
19 -24.8001sfx_A mol:protein length:109 Conserved hypothetical protein AF2008  ali model follow..  16  14..............EKLSFKPSDVRIYSLLLERGGMRVSEIARELDLSARFVRDRLKVLLKRGFVRREIV--EKGWVGYIYSAEKPEKVLKEFKSSILGEIERIEKMFTDG...................................................... 108
20 -22.3003b73_A mol:protein length:111 PhiH1 repressor-like protein  ali model follow..  18  11..................MTIWDDRILEIIHEEGNGSPKELEDRIRISKSSVSRRLKKLADHDLLQPL................................................................................................. 62
21 -18.5001sfu_A mol:protein length:75 34L protein  ali model follow..  14  5..........SCTVNDAEIFSLVKKEVLSLNTNDYTTAISLSNRLKINKKKINQQLYKLQKEDTVKM.................................................................................................. 61
22 -17.7002htj_A mol:protein length:81 P fimbrial regulatory protein KS71A  ali model follow..  13  1.....................MKNEILEFLNRHNGGKTAEIAEALAVTDYQARYYLLLLEKAGMVQR.................................................................................................. 46
23 -16.7002jsx_A mol:protein length:95 Protein napD  ali model follow..  15  7.................................................................................VCSLVVQAKSERISDISTQLNAFPGCEVAVSDAPSGQLIVVVEAEDSETLIQTIESVRNVEGVLAVSLVY.............. 76
24 -16.3001ub9_A mol:protein length:100 Hypothetical protein PH1061  ali model follow..  21  15...................NPVRLGIMIFLLPRRKAPFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYKVIADRPR--------TVVEITDFGMEEAKRFLSSLKAVID........................................................ 96
25 -16.2003r0a_A mol:protein length:123 Putative transcriptional regulator  ali model follow..  19  24..................LTKADLNVMKSFLNDRWIDTDALSKSLKLDVSTVQRSVKKLHEKEILQRSQQNLDGGGYVYIYKIYSKNQIRNIIQKIVQSWADRLGQELKEWENGGE................................................. 123
26 -15.1002wte_A mol:protein length:244 CSA3  ali model follow..  17  140..............LMRDYSREEMKLLNVLYETKGTGITELAKMLDKSEKTLINKIAELKKFGILTGKDRKVELNELGLNVIKLNKSVIESSKSSEELVKENKGKEVNIPY...................................................... 238
27 -15.1002lnb_A mol:protein length:80 Z-DNA-binding protein 1  ali model follow..  10  12...................GHLEQRILQVLTEAGSVKLAQLVKECQAPKRELNQVLYRMKKELKVS................................................................................................... 59
28 -15.0001j75_A mol:protein length:67 Tumor Stroma and Activated Macrophage Protein  ali model follow..  23  1...........GSHMLSTGDNLEQKILQVLSDDGGVKIGQLVKKCQVPKKTLNQVLYRLKKEDRVSS.................................................................................................. 57
29 -14.9003bdd_A mol:protein length:142 Regulatory protein MarR  ali model follow..  13  26...............QLGISLTRYSILQTLLKDAPLHQLALQERLQIDRAAVTRHLKLLEESGYIIRKRNPDNQRE--------VLVWPTEQAREALITNPSAHHQAIKTSMNQI-------LTVEESEQFLATLDKLLI......................... 135
30 -14.6002nyx_A mol:protein length:168 Probable transcriptional regulatory protein,  ali model follow..  12  37............AQVDENITIPQFRTLVILSNHGPINLATLATLLGVQPSATGRMVDRLVGAELIDRLPHPTSRRE--------LLAALTKRGRDVVRQVTEHRRTEIA--------RIVEQMAPAERHGLVRALTAFTE......................... 148
31 -14.5002fbi_A mol:protein length:142 probable transcriptional regulator  ali model follow..  14  26..........RPSLNQHGLTEQQWRVIRILRQQGEMESYQLANQACILRPSMTGVLARLERDGIVRRWKAPKDQRR--------VYVNLTEKGQQCFVSMSGDMEKNYQ--------RIQERFGEEKLAQLLELLNELKKIK....................... 141
32 -14.5002heo_A mol:protein length:67 Z-DNA binding protein 1  ali model follow..  18  9...................DNLEQKILQVLSDDGGVAIFQLVKKCQVPKKTLNQVLYRLKKEDRVSS.................................................................................................. 57
33 -14.4002pq4_A mol:protein length:90 Protein napD  ali model follow..  16  10.................................................................................VCSLVVQAKSERISDISTQLNAFPGCEVAVSDAPSGQLIVVVEAEDSETLIQTIESVRNVEGVLAV-SLVYHQQEEQGEETP.. 90
34 -14.2002d1h_A mol:protein length:109 109aa long hypothetical transcriptional regul  ali model follow..  18  19..................ITDTDVAVLLKMEIEKPITSEELADIFKLSKTTVENSLKKLIELGLVV................................................................................................... 67
35 -14.1003irq_D mol:protein length:67 Double-stranded RNA-specific adenosine deamin  ali model follow..  14  3.................HMEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQ................................................................................................... 51
36 -14.1001xn7_A mol:protein length:78 Hypothetical protein yhgG  ali model follow..  16  6........................QVRDLLALRGRMEAAQISQTLNTPQPMINAMLQQLESMGKAVR.................................................................................................. 48
37 -14.0001jgs_A mol:protein length:138 MULTIPLE ANTIBIOTIC RESISTANCE PROTEIN MARR  ali model follow..  11  24..........NEYLSPLDITAAQFKVLCSIRCAACITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRG--------VLVKLTTGGAAICEQCHQLVGQDLHQELTKN-------LTADEVATLEYLLKKVLP......................... 138
38 -13.9002fa5_A mol:protein length:162 transcriptional regulator marR/emrR family  ali model follow..  16  44...............RYGMAIPEWRVITILALYPGSSASEVSDRTAMDKVAVSRAVARLLERGFIRRETHGDDRRRSMLALS---------PAGRQVYETVAPLVNEMEQRLMSV-------FSAEEQQTLERLIDRLAK......................... 152
39 -13.9001s3j_A mol:protein length:155 YusO protein  ali model follow..  11  32...............KQGVTPAQLFVLASLKKHGSLKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRV--------IDLSLTDEGDIKFEEVLAGRKAIMA--------RYLSFLTEEEMLQAAHITAKLAQ......................... 140
40 -13.9002a61_A mol:protein length:145 transcriptional regulator Tm0710  ali model follow..  14  23..........RKVLRDFGITPAQFDILQKIYFEGPKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRA--------YFLVITRKGEEVIEKVIERRENFIE--------KITSDLGKEKSSKILDYLKELKG......................... 136
41 -13.8003bja_A mol:protein length:139 Transcriptional regulator, MarR family, putat  ali model follow..  12  23..........DKAIEQYDISYVQFGVIQVLAKSGKVSMSKLIENMGCVPSNMTTMIQRMKRDGYVMTEKNPNDQRE--------TLVYLTKKGEETKKQVDVQYSDFLK--------ENCGCFTKEEEGILEDLLLKWKK......................... 136
42 -13.7002k02_A mol:protein length:87 Ferrous iron transport protein C  ali model follow..  11  6........................EVRDMLALQGRMEAKQLSARLQTPQPLIDAMLERMEAMGKVVR.................................................................................................. 48
43 -13.7003k0l_A mol:protein length:162 Repressor protein  ali model follow..  36..........TEHLSALEISLPQFTALSVLAAKPNLSNAKLAERSFIKPQSANKILQDLLANGWIEKAPDPTHGRRILVTVT---------PSGLDKLNQCNQVVQQLEAQMLQG-------VDINLAFLIRNNLELMVK......................... 149
44 -13.7002eth_A mol:protein length:154 transcriptional regulator, putative, Mar fami  ali model follow..  35.................DMKTTELYAFLYVALFGPKKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRT--------YRVVLTEKGKEIFGEILSNFESLLK--------SVLEKFSEEDFKVVSEGFNRMVE......................... 141
45 -13.6003e6m_A mol:protein length:161 MarR family Transcriptional regulator  ali model follow..  43..........NQALASEKLPTPKLRLLSSLSAYGELTVGQLATLGVMEQSTTSRTVDQLVDEGLAARSISDADQRKRTVVLT---------RKGKKKLAEISPLINDFHAELVGN-------VDPDKLQTCIEVLGEILK......................... 156
46 -13.5002rdp_A mol:protein length:150 putative transcriptional regulator MarR  ali model follow..  11  37...............NYPITPPQFVALQWLLEEGDLTVGELSNKMYLACSTTTDLVDRMERNGLVARVRDEHDRRV--------VRIRLLEKGERIIEEVIEKRQRDLA--------NVLESFSDEEIVVFERCLRKLHQ......................... 145
47 -13.3002nnn_A mol:protein length:140 Probable transcriptional regulator  ali model follow..  18  29...........ANGIGNGLTPTQWAALVRLGETGPCPQNQLGRLTAMDAATIKGVVERLDKRGLIQRSADPDDGRR--------LLVSLSPAGRAELEAGLAAAREINR--------QALAPLSLQEQETLRGLLARL........................... 139
48 -13.3001xmk_A mol:protein length:79 Double-stranded RNA-specific adenosine deamin  ali model follow..  20  2...........SHMASLDMAEIKEKICDYLFNVSDSSALNLAKNIGLKARDINAVLIDMERQGDVY................................................................................................... 57
49 -13.2003cdh_A mol:protein length:155 Transcriptional regulator, MarR family  ali model follow..  41..................LRVPEWRVLACLVDNDAMMITRLAKLSLMEQSRMTRIVDQMDARGLVTRVADAKDKRRVRVRLT---------DDGRALAESLVASARAHETRLLSA-------LADTDAARIKGVLRTLLD......................... 146
50 -13.2001ku9_A mol:protein length:152 hypothetical protein MJ223  ali model follow..  12  24..................LNKSVGAVYAILLSDKPLTISDIMEELKISKGNVSMSLKKLEELGFVRKVWIKGERKNYYEAVDGFSSIDIAKRKHDLIAKTYEDLKKLEE----KEFIKQKIKGIERMKKISEKILEALNDLDN...................... 152
51 -13.2002jt1_A mol:protein length:77 PefI protein  ali model follow..  27  2..................SESIVTKIISIVQERQ--KTRDIADAAGLSIYQVRLYLEQLHDVGVLE................................................................................................... 55
52 -13.2003nrv_A mol:protein length:148 Putative transcriptional regulator (MarR/EmrR  ali model follow..  15  35...............KFGIGMTEWRIISVLSSASDCSVQKISDILGLDKAAVSRTVKKLEEKKYIEVNGHSEDKRTYAINLT---------EMGQELYEVASDFAIEREKQLLEE-------FEEAEKDQLFILLKKLRN......................... 143
53 -13.1002qlz_A mol:protein length:232 Transcription Factor PF0095  ali model follow..  11...................NKVRRDLLSHLTC-MECYFSLLSSKVSVSSTAVAKHLKIMEREGVLQ................................................................................................... 56
54 -13.1003oop_A mol:protein length:143 Lin2960 protein  ali model follow..  14  27..........MRSIASYDVTPEQWSVLEGIEANEPISQKEIALWTKKDTPTVNRIVDVLLRKELIVREISTEDRRISLLSLT---------DKGRKETTELRDIVEASCEKMFAG-------VTRTDLEQFTAILKNIST......................... 140
55 -13.1003cjn_A mol:protein length:162 Transcriptional regulator, MarR family  ali model follow..  13  42..........RKEMTALGLSTAKMRALAILSAKDGLPIGTLGIFAVVEQSTLSRALDGLQADGLVRREVDSDDQRSSRVYLT---------PAGRAVYDRLWPHMRASHDRMFQG-------ITPQERQAFLATLNKMLA......................... 155
56 -13.0001lj9_A mol:protein length:144 transcriptional regulator SlyA  ali model follow..  11  19..........NIEFKELSLTRGQYLYLVRVCENPGIIQEKIAELIKVDRTTAARAIKRLEEQGFIYRQEDASNKKIKRIYAT---------EKGKNVYPIIVRENQHSNQVALQG-------LSEVEISQLADYLVRMRK......................... 132
57 -12.9003tgn_A mol:protein length:146 Adc operon repressor AdcR  ali model follow..  15  33...............EVALTNTQEHILMLLSEES-LTNSELARRLNVSQAAVTKAIKSLVKEGMLETSKDSKDARVI------FYQLTDLARPIAEEEHTLLTYEQVAT------------QFTPNEQKVIQRFLTALVG......................... 138
58 -12.9001lnw_A mol:protein length:147 Multidrug resistance operon repressor  ali model follow..  12  32...............RLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRS--------FQLFLTDEGLAIHQHAEAIMSRVHD--------ELFAPLTPVEQATLVHLLDQCLAAQPLEDI.................. 147
59 -12.8001qbj_A mol:protein length:81 PROTEIN (DOUBLE-STRANDED RNA SPECIFIC ADENOSI  ali model follow..  12  2.........SHMLSIYQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQ................................................................................................... 58
60 -12.8003u1d_A mol:protein length:151 uncharacterized protein  ali model follow..  14  10.GERPNGFGDELERRRFVLHETRLDVLHQILADGVLSVEELLYRNDETEANLRYHVDELVDRGIVEKIPVPRAKSVDDPPTTFY................................................................................. 95
61 -12.8003ech_A mol:protein length:142 Multidrug resistance operon repressor  ali model follow..  11  32...............RLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRS--------FQLFLTDEGLAIHLHAELIMSRVHD--------ELFAPLTPVEQATLVHLLDQCLA......................... 140
62 -12.8003s2w_A mol:protein length:159 Transcriptional regulator, MarR family  ali model follow..  11  40..........GKKIEPYGIGSGQFPFLMRLYREDGINQESLSDYLKIDKGTTARAIQKLVDEGYVFRQRDEKDRRSYRVFLT---------EKGKKLEPDMKKIASEWGEILFSS-------FDDRQRREITNSLEIMFE......................... 153
63 -12.8003bj6_A mol:protein length:152 Transcriptional regulator, MarR family  ali model follow..  30..........ERGTLREGVTVGQRAILEGLSLTPGATAPQLGAALQMKRQYISRILQEVQRAGLIERRTNPEHARSHRYWLT---------PRGEAIITAIRADEMAKLALFSEG-------FSSVELTAYHKVQLALTR......................... 143
64 -12.7001uly_A mol:protein length:192 hypothetical protein PH1932  ali model follow..  30  19...................EDTRRKILKLLR-NKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVE................................................................................................... 64
65 -12.6003bpx_A mol:protein length:148 Transcriptional regulator  ali model follow..  12  26..........GRELGHLNLTDAQVACLLRIHREPGIKQDELATFFHVDKGTIARTLRRLEESGFIEREQDPENRRRYILEVT---------RRGEEIIPLILKVEERWEDLLFRD-------FTEDERKLFRKMCRRLAE......................... 139
66 -12.6003eyi_A mol:protein length:72 Z-DNA-binding protein 1  ali model follow..  10  8..................SQQREEDIYRFLKDNGPQRALVIAQALGMTAKDVNRDLYRMKSRHLLD................................................................................................... 56
67 -12.5001oyi_A mol:protein length:82 double-stranded RNA-binding protein  ali model follow..  10................IDERSNAEIVCEAIKTIEGATAAQLTRQLNMEKREVNKALYDLQRSAMVYS.................................................................................................. 62
68 -12.5003g3z_A mol:protein length:145 Transcriptional regulator, MarR family  ali model follow..  11  26...............QQDLNYNLFAVLYTLATEGSRTQKHIGEKWSLPKQTVSGVCKTLAGQGLIEWQEGEQDRRKRLLSLT-----ETGKAYAAPLTESAQEFSDKVFATFGDKRTTRLFADLDALAEVMEKTISE............................ 142
69 -12.4002dk5_A mol:protein length:91 DNA-directed RNA polymerase III 39 kDa polype  ali model follow..  18  1.GSSGSSGDSQNAGKMKGSDNQEKLVYQIIEDAGNIWSRDVRYKSNLPLTEINKILKNLESKKLIKAVKSVAASKKKVYMLYNL................................................................................. 85
70 -12.4002fbk_A mol:protein length:181 transcriptional regulator, MarR family  ali model follow..  11  59..........ERTYAASGLNAAGWDLLLTLYRSAGLRPTELSALAAISGPSTSNRIVRLLEKGLIERREDERDRRS--------ASIRLTPQGRALVTHLLPAHLATTQ--------RVLAPLSAQEQRTLEELAGRMLA......................... 175
71 -12.4002fxa_A mol:protein length:207 Protease production regulatory protein hpr  ali model follow..  20  43...............PYDLNINEHHILWIAYQLNGASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSKRLNDKRNTYVQLT................................................................................... 109
72 -12.4003f72_A mol:protein length:122 Cadmium efflux system accessory protein  ali model follow..  27  41...................DENRAKITYALCQDEELCVCDIANILGVTIANASHHLRTLYKQGVVN................................................................................................... 87
73 -12.4003boq_A mol:protein length:160 Transcriptional regulator, MarR family  ali model follow..  11  35........LNRQLLDETGLSLAKFDAMAQLRNPDGLSMGKLSGALKVTNGNVSGLVNRLIKDGMVVKAMSADDRRS--------FSAKLTDAGLTTFKQASEAHNRILA--------ELLRAVSDQDMVEASAALRGILE......................... 151
74 -12.4002hr3_A mol:protein length:147 Probable transcriptional regulator  ali model follow..  14  25..........RREAQADPVQFSQLVVLGAIRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRR--------TRVSLSSEGRRNLYGNRAKREEWLVRAMHAC-------LDESERALLAAAGPLLTRL........................ 141
75 -12.2002l54_A mol:protein length:63 Double-stranded RNA-specific adenosine deamin  ali model follow..  14  3.................DQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEIARVLASLAKKGKLQ................................................................................................... 51

FFAS is supported by the NIH grant R01-GM087218-01
5 7 1 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. FATCAT: a web server for flexible structure comparison and structure similarity searching. Nucleic Acids Res. 2004 Jul 1;32(Web Server issue):W582-5.