current user: public




Query: 1ri7_A mol:protein length:171 Putative transcriptional regulator, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .
# Score Template Links and tools%idFirst MGSSSSGLVPRGSHMRVPLDEIDKKIIKILQNDGKAPLREISKITGLAESTIHERIRKLRESGVIKKFTAIIDPEALGYSMLAFILVKVKAGKYSEVASNLAKYPEIVEVYETTGDYDMVVKIRTKNSEELNNFLDLIGSIPGVEGTHTMIVLKTHKETTELPIKLast
1 -85.4001ri7_A mol:protein length:171 Putative transcriptional regulator  ali model  100  1MGSSSSGLVPRGSHMRVPLDEIDKKIIKILQNDGKAPLREISKITGLAESTIHERIRKLRESGVIKKFTAIIDPEALGYSMLAFILVKVKAGKYSEVASNLAKYPEIVEVYETTGDYDMVVKIRTKNSEELNNFLDLIGSIPGVEGTHTMIVLKTHKETTELPIK 165
2 -75.3002gqq_A mol:protein length:163 Leucine-responsive regulatory protein  ali model follow..  31  1........VDSKKRPGKDLDRIDRNILNELQKDGRISNVELSKRVGLSPTPCLERVRRLERQGFIQGYTALLNPHYLDASLLVFVEITLNRGAFEQFNTAVQKLEEIQECHLVSGDFDYLLKTRVPDMSAYRKLLETLLRLPGVNDTRTYVVMEEVKQSNRLVIK 161
3 -73.8002cg4_A mol:protein length:152 REGULATORY PROTEIN ASNC  ali model follow..  28  1.............MENYLIDNLDRGILEALMGNARTAYAELAKQFGVSPETIHVRVEKMKQAGIITGARIDVSPKQLGYDVGCFIGIILKSAKYPSALAKLESLDEVTEAYYTTGHYSIFIKVMCRSIDALQHVLNKIQTIDEIQSTETLIVLQNPIMRTIKP.. 152
4 -70.8002qz8_A mol:protein length:149 Probable transcriptional regulatory protein  ali model follow..  26  3.................ALDDIDRILVRELAADGRVTLSELATRAGLSVSAVQSRVRRLESRGVVQGYSARINPEAVGHLLSAFVAITPDPSQPDDAPARLEHIEEVESCYSVAGEESYVMLVRVASARALEDLLQRIRTTANV-RTRSTIILNTFYSDRQHI.. 148
5 -70.4002w25_A mol:protein length:150 PROBABLE TRANSCRIPTIONAL REGULATORY PROTEIN  ali model follow..  27  1..............MNEALDDIDRILVRELAADGRATLSELATRAGLSVSAVQSRVRRLESRGVVQGYSARINPEAVGHLLSAFVAITPDPSQPDDAPARLEHIEEVESCYSVAGEASYVLLVRVASARALEDLLQRIRTTANV-RTRSTIILNTFYSDRQH... 148
6 -70.4002ivm_A mol:protein length:150 TRANSCRIPTIONAL REGULATORY PROTEIN  ali model follow..  27  1..............MNEALDDIDRILVRELAADGRGTLSELATRAGLSVSAVQSRVRRLESRGVVQGYSARINPEAVGHLLSAFVAITPDPSQPDDAPARLEHIEEVESCYSVAGEESYVLLVRVASARALEDLLQRIRTTANV-RTRSTIILNTFYSDRQH... 148
7 -70.4002e7w_A mol:protein length:150 150aa long hypothetical transcriptional regul  ali model follow..  39  1..................MDEIDLRILKILQYNAKYSLDEIAREIRIPKSTLSYRIKKLEKDGVIKGYYAYINPASLNLDYIVITSVKAKYGKHVELGNKLAQIPGVWGVYFVLGDNDFIVMARYKTREEFMEKFERVMSIPEVERTSTQVVVKIIKESPNIVI. 149
8 -70.3002w29_A mol:protein length:150 PROBABLE TRANSCRIPTIONAL REGULATORY PROTEIN  ali model follow..  27  1..............MNEALDDIDRILVRELAADGRATLSELATRAGLSVSAVQSRVRRLESRGVVQGYSARINPEAVGHLLSAFVAITPDPSQPDDAPARLEHIEEVESCYSVATEESYVLLVRVASARALEDLLQRIRTTANV-RTRSTIILNTFYSDRQH... 148
9 -70.2001i1g_A mol:protein length:141 TRANSCRIPTIONAL REGULATOR LRPA  ali model follow..  35  2..................IDERDKIILEILEKDARTPFTEIAKKLGISETAVRKRVKALEEKGIIEGYTIKINPKKLGYSLVTITGVDTKPEKLFEVAEKLKEYDFVKELYLSSGDHMIMAVIWAKDGEDLAEIINKIGKIEGVTKVCPAIILEKLK........ 141
10 -70.0002p5v_A mol:protein length:162 Transcriptional regulator, LRP/AsnC family  ali model follow..  28  1...........GPMPQLTLDKTDIKILQVLQENGRLTNVELSERVALSPSPCLRRLKQLEDAGIVRQYAALLSPESVNLGLQAFIRVSIRKAKREDFAASVRKWPEVLSCFALTGETDYLLQAFFTDMNAFSHFVDTLLSHHGVQDAQSSFVLKEIKHTTSLPLN 157
11 -67.2003i4p_A mol:protein length:162 Transcriptional regulator, AsnC family  ali model follow..  25  1..................MDRLDRKILRILQEDSTLAVADLAKKVGLSTTPCWRRIQKMEEDGVIRRRVALLDPVKVNTKVTVFVSIRTASHSLKRFSEVVSEFPEVVEFYRMSGDVDYLLRVVVPDIAAYDAFYKRMIAKIEIRDVSSAFAMEQIKYTTELPLD 150
12 -65.2004pcq_A mol:protein length:190 Possible transcriptional regulatory protein (  ali model follow..  23  16..HKTRRAASSKDVRPAELDEVDRRILSLLHGDARMPNNALADTVGIAPSTCHGRVRRLVDLGVIRGFYTDIDPVAVGLPLQAMISVNLQSSAIRSFIQQIRRKRQVMDVYFLAGADDFILHVAARDTEDLRSFVENLNADADVAGTQTSLIFEHLRGAAPIAAA 182
13 -64.2002cfx_A mol:protein length:144 HTH-TYPE TRANSCRIPTIONAL REGULATOR LRPC  ali model follow..  25  1................MKLDQIDLNIIEELKKDSRLSMRELGRKIKLSPPSVTERVRQLESFGIIKQYTLEVDQKKLGLPVSCIVEATVKNADYERFKSYIQTLPNIEFCYRIAGAACYMLKINAESLEAVEDFINKTSP---YAQTVTHVIFSEIDTKNGR... 143
14 -63.2002dbb_A mol:protein length:151 Putative HTH-type transcriptional regulator P  ali model follow..  24  6.................KLDRVDMQLVKILSENSRLTYRELADILNTTRQRIARRIDKLKKLGIIRKFTIIPDIDKLGYMYAIVLIKSKVPSDADKVISEISDIEYVKSVEKGVGRYNIIVRLLLKDIKDAENLIEFLQRIKNAENVEVILISEVRKFEI..... 150
15 -58.2002ia0_A mol:protein length:171 Putative HTH-type transcriptional regulator P  ali model follow..  26  1..........MAGSSEIHLDDLDRNILRLLKKDARLTISELSEQLKKPESTIHFRIKKLQERGVIERYTIILGEQLLALIVLEVGKPVIEERYISYISSTLSALPGVLFVA-KSGEDKIIALVGKNNKDELVKFIENITSIPNLKHIQI-FPITEIKKGEDLTG. 160
16 -35.1002l4a_A mol:protein length:66 Leucine responsive regulatory protein  ali model follow..  34  1.......MVDSKKRPGKDLDRIDRNILNELQKDGRISNVELSKRVGLSPTPCLERVRRLERQGFIQGYTALLN............................................................................................ 66
17 -33.9004czd_B mol:protein length:179 PUTATIVE TRANSCRIPTIONAL REGULATOR, ASNC FAMI  ali model follow..  27  1MGSSSSGLVPRGSHMSHQFSPEEQAVLRIVQANSLTPYADLAEQAGMTEAQVLELLGRLKASGAIRRFGASIKHQKTGWTHNAMVAWKVTPDQVDDCGRKAAEHSHISHVYY---PYEMYTMIHGRSEAECLGVVEDVKRTTSLKEHAILRSLKELKKT...... 167
18 -33.8004ch7_A mol:protein length:342 NIRD-LIKE PROTEIN  ali model follow..  20  159.........DTKVYTYTPLTEEEKRIVSITQGSFPLPFLEYAKRLRMSEEELLEKLSALKERGVLRRISAVLYHRRAGYVANAMSVWEVPEDAIEEVGRYIAGFKGVSHCYQEKFRYNLFAMMHGKGQEEIKLLAETISREKALSKYALLFSTREFKK....... 314
19 -29.9004czd_A mol:protein length:173 PUTATIVE TRANSCRIPTIONAL REGULATOR, ASNC FAMI  ali model follow..  19  6.SAATGSPTQQNNAALADMDSMDRQLLDIIQTGSPRPYAELGQRLGLDEQEVLDRVRGLKARKIIRRLGANFQSAKLGFV-STLCAAKVPQDKMDAFVAEVNAKPGVTHNYLREHDYNIWFTLISPSREETQAILDGITQATGV-PILNLPATKLFKIRVDFRMD 170
20 -29.3002djw_A mol:protein length:92 probable transcriptional regulator, AsnC fami  ali model follow..  31  2................................................................................ITAFVLIRPRGNRVQALGEAIAELPQVAEVYSVTGPYDLVALVRLKDVEELDDVVQGILSLEGVERTETLLAFRAYPRR...... 81
21 -28.0004lb5_A mol:protein length:72 Protein kinase containing Z-DNA binding domai  ali model follow..  20  2...........SHMASSAENEIEMRICDYLRRHGRSTVQDIFKELKLEKSTVNRHLYSLQASKQVFKTVEDNKR........................................................................................... 64
22 -27.1002cvi_A mol:protein length:83 75aa long hypothetical regulatory protein Asn  ali model follow..  37  2................................................................................VTAFILMVTAAGKEREVMEKLLAMPEVKEAYVVYGEYDLIVKVETDTLKDLDQFIEKIRKMPEIQMTSTMIAILE.......... 77
23 -26.8002zbc_A mol:protein length:83 83aa long hypothetical transcriptional regula  ali model follow..  33  2................................................................................ASAIVLINTDAGGEDEVFERLKSMSEVTEVHVVYGVYDIVVKVEADSMDKLKDFVNTIRKLPKVRSTLTMIIVEG.......... 77
24 -23.9004wcg_A mol:protein length:98 ORF112  ali model follow..  18  21VKTTASEAIPALPRLNPISEEMNLKILAYLGTKQGAKAVHIAQSLGAQRSEVNRHLYRMSEDGRVR................................................................................................... 86
25 -20.3003b73_A mol:protein length:111 PhiH1 repressor-like protein  ali model follow..  14  11..................MTIWDDRILEIIHEEGNGSPKELEDRDEISKSSVSRRLKKLADHDLLQPLANGV---VITEEGEAYLNGEYDAGKERYINRGNSTDEENGADAPDGPGIN............................................... 110
26 -16.1002htj_A mol:protein length:81 P fimbrial regulatory protein KS71A  ali model follow..  13  1.....................MKNEILEFLNRHNGGKTAEIAEALAVTDYQARYYLLLLEKAGMVQ................................................................................................... 45
27 -15.3004asn_A mol:protein length:101 TUBR  ali model follow..  14  6............EEVMRKLTIEDVSILGWLFQNEAIKKSSIADELEYSTANFRKTLNKLEAIHFIGT.................................................................................................. 66
28 -14.7003r0a_A mol:protein length:123 Putative transcriptional regulator  ali model follow..  19  24..................LTKADLNVMKSFLNDRWIDTDALSKSLKLDVSTVQRSVKKLHEKEILQRSQQNLDGGGYVYIYKIYSKNQIRNIIQKIVQSWADRLGQELKEWENGGE................................................. 123
29 -14.7003bdd_A mol:protein length:142 Regulatory protein MarR  ali model follow..  12  14...VADETISNLFEKQLGISLTRYSILQTLLKDAPLHQLALQERLQIDRAAVTRHLKLLEESGYIIRKRNPDNQRE--------VLVWPTEQAREALITNPSAHHQAIKTSMNQI-------LTVEESEQFLATLDKLLI......................... 135
30 -14.5002d1h_A mol:protein length:109 109aa long hypothetical transcriptional regul  ali model follow..  14  1MMKEKLESKKDEIRCCYKITDTDVAVLLKMEIEKPITSEELADIFKLSKTTVENSLKKLIELGLVVR.................................................................................................. 68
31 -14.3002rvc_A mol:protein length:64 Interferon-inducible and double-stranded-depe  ali model follow..  29  5...................TQMERKIIDFLRQNGKSIALTIAKEIGLDKSTVNRHLYNLQRSNQVF................................................................................................... 51
32 -14.2003vod_A mol:protein length:144 Multiple antibiotic resistance protein marR  ali model follow..  34..............SPLDITAAQFKVLCSIRCAACITPVELKKVLSVDLGALTRMLDRLVSKGWVERLPNPNDKRGVLVKLT---------------TGGAAICEQCHQLVGQDLHQELTKNLTADEVATLEYLLKKVLP......................... 144
33 -14.2002wte_A mol:protein length:244 CSA3  ali model follow..  18  143.................DYSREEMKLLNVLYETKGTGITELAKMLDKSEKTLINKIAELKKFGILTGKDRKVELNELGLNVIKLNKSVIESSKSSEELVKENKGKEVNIPY...................................................... 238
34 -14.0001sfu_A mol:protein length:75 34L protein  ali model follow..  15  9..............NDAEIFSLVKKEVLSLNTNDYTTAISLSNRLKINKKKINQQLYKLQKEDTVK................................................................................................... 60
35 -13.9003vb2_A mol:protein length:144 Multiple antibiotic resistance protein marR  ali model follow..  34..............SPLDITAAQFKVLSSIRSAASITPVELKKVLSVDLGALTRMLDRLVSKGWVERLPNPNDKRGVLVKLT---------------TGGAAISEQSHQLVGQDLHQELTKNLTADEVATLEYLLKKVLP......................... 144
36 -13.9004hob_A mol:protein length:69 Putative uncharacterized protein  ali model follow..  22  11...................EEMNLKILAYLGTKQGAKAVHIAQSLGAQRSEVNRHLYRMSEDGRVRK.................................................................................................. 58
37 -13.8002fbi_A mol:protein length:142 probable transcriptional regulator  ali model follow..  13  34..................LTEQQWRVIRILRQQGEMESYQLANQACILRPSMTGVLARLERDGIVRRWKAPKDQRR--------VYVNLTEKGQQCFVSMSGDMEKNYQ--------RIQERFGEEKLAQLLELLNELKKIK....................... 141
38 -13.6002fa5_A mol:protein length:162 transcriptional regulator marR/emrR family  ali model follow..  16  29LSNRISGNIAKVYGDRYGMAIPEWRVITILALYPGSSASEVSDRTAMDKVAVSRAVARLLERGFIRRETHGDDRRRSMLALSP-------RQVYETVAPLVNEMEQ-----------RLMSVFSAEEQQTLERLIDRLAK......................... 152
39 -13.5004xrf_A mol:protein length:142 Transcriptional regulator, MarR family  ali model follow..  14  23..........LEQMQATGLTPPQFYILKILDHYGASRATTLAKKMYVKPSAITVMIDRLIDQELVERYHDKDDRRV--------VIIELTKKGKARVEEAMTARNEHIA--------KYFSHLELQEREDLLRLFEKLETI........................ 137
40 -13.5002rdp_A mol:protein length:150 putative transcriptional regulator MarR  ali model follow..  11  37...............NYPITPPQFVALQWLLEEGDLTVGELSNKMYLACSTTTDLVDRMERNGLVARVRDEHDRRV--------VRIRLLEKGERIIEEVIEKRQRDLA--------NVLESFSDEEIVVFERCLRKLHQ......................... 145
41 -13.5003nrv_A mol:protein length:148 Putative transcriptional regulator (MarR/EmrR  ali model follow..  12  20LANKLMLKSSTAYTQKFGIGMTEWRIISVLSSASDCSVQKISDILGLDKAAVSRTVKKLEEKKYIEVNGHSEDKRTYAINLT----------------EMGQELYEVASDFAIEREKQLLEEFEEAEKDQLFILLKKLRN......................... 143
42 -13.4003cdh_A mol:protein length:155 Transcriptional regulator, MarR family  ali model follow..  41..................LRVPEWRVLACLVDNDAMMITRLAKLSLMEQSRMTRIVDQMDARGLVTRVADAKDKRRVRVRLT---------DDGRALAESLVASARAHETRLLSA-------LADTDAARIKGVLRTLLD......................... 146
43 -13.1001s3j_A mol:protein length:155 YusO protein  ali model follow..  11  27..........LESMEKQGVTPAQLFVLASLKKHGSLKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRV--------IDLSLTDEGDIKFEEVLAGRKAIMA--------RYLSFLTEEEMLQAAHITAKLAQ......................... 140
44 -13.1003bja_A mol:protein length:139 Transcriptional regulator, MarR family, putat  ali model follow..  12  27..............EQYDISYVQFGVIQVLAKSGKVSMSKLIENMGCVPSNMTTMIQRMKRDGYVMTEKNPNDQRE--------TLVYLTKKGEETKKQVDVQYSDFLK--------ENCGCFTKEEEGILEDLLLKWKK......................... 136
45 -13.0002lnb_A mol:protein length:80 Z-DNA-binding protein 1  ali model follow..  1........MGSHMADPGREGHLEQRILQVLTEAGSVKLAQLVKECQAPKRELNQVLYRMKKELKVS................................................................................................... 59
46 -12.9002k02_A mol:protein length:87 Ferrous iron transport protein C  ali model follow..  11  6........................EVRDMLALQGRMEAKQLSARLQTPQPLIDAMLERMEAMGKVVR.................................................................................................. 48
47 -12.9003tgn_A mol:protein length:146 Adc operon repressor AdcR  ali model follow..  15  33...............EVALTNTQEHILMLLSEES-LTNSELARRLNVSQAAVTKAIKSLVKEGMLETSKDSKDARVI------FYQLTDLARPIAEEEHTLLTYEQVAT------------QFTPNEQKVIQRFLTALVG......................... 138
48 -12.9001xn7_A mol:protein length:78 Hypothetical protein yhgG  ali model follow..  16  6........................QVRDLLALRGRMEAAQISQTLNTPQPMINAMLQQLESMGKAVR.................................................................................................. 48
49 -12.9002eth_A mol:protein length:154 transcriptional regulator, putative, Mar fami  ali model follow..  35.................DMKTTELYAFLYVALFGPKKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRT--------YRVVLTEKGKEIFGEILSNFESLLK--------SVLEKFSEEDFKVVSEGFNRMVE......................... 141
50 -12.9002nyx_A mol:protein length:168 Probable transcriptional regulatory protein,  ali model follow..  13  37............AQVDENITIPQFRTLVILSNHGPINLATLATLLGVQPSATGRMVDRLVGAELIDRLPHPTSRRE--------LLAALTKRGRDVVRQVTEHRRTEIA--------RIVEQMAPAERHGLVRALTAFTEAGG...................... 151
51 -12.8002nnn_A mol:protein length:140 Probable transcriptional regulator  ali model follow..  18  29...........ANGIGNGLTPTQWAALVRLGETGPCPQNQLGRLTAMDAATIKGVVERLDKRGLIQRSADPDDGRRL---------VSLSPAGRAELEAGLAAAREINR--------QALAPLSLQEQETLRGLLARL........................... 139
52 -12.8002a61_A mol:protein length:145 transcriptional regulator Tm0710  ali model follow..  14  31..................ITPAQFDILQKIYFEGPKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRA--------YFLVITRKGEEVIEKVIERRENFIE--------KITSDLGKEKSSKILDYLKEL........................... 134
53 -12.7001lnw_A mol:protein length:147 Multidrug resistance operon repressor  ali model follow..  11  17FQHVRTRIQSELDCQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLT---------DEGLAIHQHAEAIMSRVHDELFAP-------LTPVEQATLVHLLDQCLAAQPLEDI.................. 147
54 -12.6001j75_A mol:protein length:67 Tumor Stroma and Activated Macrophage Protein  ali model follow..  19  9...................DNLEQKILQVLSDDGGVKIGQLVKKCQVPKKTLNQVLYRLKKEDRVS................................................................................................... 56
55 -12.5002heo_A mol:protein length:67 Z-DNA binding protein 1  ali model follow..  17  10....................NLEQKILQVLSDDGGVAIFQLVKKCQVPKKTLNQVLYRLKKEDRVS................................................................................................... 56
56 -12.5003e6m_A mol:protein length:161 MarR family Transcriptional regulator  ali model follow..  12  51..................LPTPKLRLLSSLSAYGELTVGQLATLGVMEQSTTSRTVDQLVDEGLAARSISDADQRK--------RTVVLTRKGKKKLAEISPLINDFHA--------ELVGNVDPDKLQTCIEVLGEILK......................... 156
57 -12.5005aip_A mol:protein length:146 TRANSCRIPTIONAL REGULATOR, MARR FAMILY  ali model follow..  13  31...............QANITDQQWRIIRLLAENGTLDFQDLANQACILRPSLTGILTRLEKAGLVVRLKPSNDQRRVFLKLTA-IEEVLGREKMLLLKDLLAELAKIED........................................................ 142
58 -12.4002fxa_A mol:protein length:207 Protease production regulatory protein hpr  ali model follow..  14  42..............KPYDLNINEHHILWIAYQLNGASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSKRLNDKRNTYVQLTTRNAVFKGSQPLYHLFGKFPEVAEMMCMIRHIYGDDFM-------ETSLTNIDNDFESVNGKLKKKAKDSAADEPAEELEPVN 204
59 -12.3001sfx_A mol:protein length:109 Conserved hypothetical protein AF2008  ali model follow..  20  18..................FKPSDVRIYSLLLERGGMRVSEIARELDLSARFVRDRLKVLLKRGFVR................................................................................................... 65
60 -12.3004awx_B mol:protein length:84 FERROUS IRON TRANSPORT PROTEIN C  ali model follow..  11  10........................EVRDMLALQGRMEAKQLSARLQTPQPLIDAMLERMEAMGKVVR.................................................................................................. 52
61 -12.3002obp_A mol:protein length:96 Putative DNA-binding protein  ali model follow..  16  6..........GNEQNGDGIDPAIVEVLLVLREATPWSLPKIAKRAQLPMSVLRRVLTQLQAAGLAD................................................................................................... 67
62 -12.3003ech_A mol:protein length:142 Multidrug resistance operon repressor  ali model follow..  11  17FQHVRTRIQSELDCQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLT---------DEGLAIHLHAELIMSRVHDELFAP-------LTPVEQATLVHLLDQCLA......................... 140
63 -12.2002p4w_A mol:protein length:202 Transcriptional regulatory protein arsR famil  ali model follow..  25  14...................NETRRRILFLLTK-RPYFVSELSRELGVGQKAVLEHLRILEEAGLIES.................................................................................................. 60
64 -12.1004ka4_A mol:protein length:70 Z-DNA-binding protein 1  ali model follow..  10  12...................QQREEDIYRFLKDNGPQRALVIAQALGMRTADVNRDLYRMKSRHLLD................................................................................................... 59
65 -12.1001uly_A mol:protein length:192 hypothetical protein PH1932  ali model follow..  25  2..AKKVKVITDPEVIKVMLEDTRRKILKLL-RNKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVE................................................................................................... 64
66 -12.1003cjn_A mol:protein length:162 Transcriptional regulator, MarR family  ali model follow..  13  42..........RKEMTALGLSTAKMRALAILSAKDGLPIGTLGIFAVVEQSTLSRALDGLQADGLVRREVDSDDQRSSRVYLT---------PAGRAVYDRLWPHMRASHDRMFQG-------ITPQERQAFLATLNKMLA......................... 155
67 -12.1004em0_B mol:protein length:178 Uncharacterized HTH-type transcriptional regu  ali model follow..  14  59...............KHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLT-----PKGHELYEIVCLDVQKLQQ-------------VVAKTNISQDQMQETINVMNQI........................ 167
68 -12.0005duk_A mol:protein length:77 putative DNA binding protein  ali model follow..  16  8...................LDTRREIYKHIVKSPGLHERQLAKELDVPLSTLVYHLHYLERRELIMM.................................................................................................. 55
69 -12.0004fht_A mol:protein length:157 PcaV transcriptional regulator  ali model follow..  10  29...........NTMVSEETTSPQYAVLNALVAEPGLDQRTVGERVGLDRSTIAEVVSRLGRRGLLDKVRDPQDGRR----------LRLTDEGLRVHRRLGVRIARMNQ--------VFLAPLAADEQAVFFDLIRRVAD......................... 141
70 -12.0003u1d_A mol:protein length:151 uncharacterized protein  ali model follow..  15  10.GERPNGFGDELERRRFVLHETRLDVLHQIQPDGVLSVEELLYRNDETEANLRYHVDELVDRGIVEKIPVPRAKSVDDPPTTFY................................................................................. 95
71 -11.8003k0l_A mol:protein length:162 Repressor protein  ali model follow..  36..........TEHLSALEISLPQFTALSVLAAKPNLSNAKLAERSFIKPQSANKILQDLLANGWIEKAPDPTHGRRILVTVT---------PSGLDKLNQCNQVVQQLEAQMLQG-------VDINLAFLIRNNLELMVK......................... 149
72 -11.8002qlz_A mol:protein length:232 Transcription Factor PF0095  ali model follow..  11...................NKVRRDLLSHLTC-MECYFSLLSSKVSVSSTAVAKHLKIMEREGVLQSYE................................................................................................ 59
73 -11.7003bj6_A mol:protein length:152 Transcriptional regulator, MarR family  ali model follow..  38..................VTVGQRAILEGLSLTPGATAPQLGAALQMKRQYISRILQEVQRAGLIERRTNPEHARSHRYWLT---------PRGEAIITAIRADEMAKLALFSEG-------FSSVELTAYHKVQLALTR......................... 143
74 -11.7001y0u_A mol:protein length:96 arsenical resistance operon repressor, putati  ali model follow..  17  30...................NPVRRKILRMLDKGRSEE--EIMQTLSLSKKQLDYHLKVLEAGFCIE................................................................................................... 74
75 -11.6002eb7_A mol:protein length:146 146aa long hypothetical transcriptional regul  ali model follow..  13  32...............ELNLSYLDFLVLRATS-DGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRK--------ILIEITEKGLETFNKGIEIYKKLAN--------EVTGDLSEDEVILVLDKISKILK......................... 139

FFAS is supported by the NIH grant R01-GM087218-01
8 5 8 8 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.