current user: public




Query: 1qhl_A mol:protein length:227 PROTEIN (CELL DIVISION PROTEIN MUKB), from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .
# Score Template Links and tools%idFirst MIERGKFRSLTLINWNGFFARTFDLDELVTTLSGGNGAGKSTTMAAFVTALIPDLTLLHFRNTTEAGATSGSRDKGLHGKLKAGVCYSMLDTINSRHQRVVVGVRLQQVAGRDRKVDIKPFAIQGLPMSVQPTQLVTETLNERQARVLPLNELKDKLEAMEGVQFKQFNSITDYHSLMFDLGIIARRLRSASDRSKFYRLIEASLYGGISSAITRSLRDYLLPENSGLast
1 -95.6001qhl_A mol:protein length:227 PROTEIN (CELL DIVISION PROTEIN MUKB)  ali model  100  1MIERGKFRSLTLINWNGFFARTFDLDELVTTLSGGNGAGKSTTMAAFVTALIPDLTLLHFRNTTEAGATSGSRDKGLHGKLKAGVCYSMLDTINSRHQRVVVGVRLQQVAGRDRKVDIKPFAIQGLPMSVQPTQLVTETLNERQARVLPLNELKDKLEAMEGVQFKQFNSITDYHSLMFDLGIIARRLRSASDRSKFYRLIEASLYGGISSAITRSLRDYLLPENSG 227
2 -64.9003euj_A mol:protein length:483 Chromosome partition protein mukB, Linker  ali model follow..  75  3MIARGKFRSLTLINWNGFFARTFDFDELVTTLSGGNGAGKSTTMAGFVTALIPDLTLLNFRNTTEAGSTSSSRDKGLYGKLKAGVCYAVLETVNSRAQRIITGVRLQQIAGRDKKVDIRPFSLQNVPMTDSVISLFTEQV-ANKARVLSLNDLKEKFEET-AVTFKPYHSITDYHSFMFDLGILPKRLRSSSDRNKFYKLIEASLYGGISSVITKSLRDYLLPENS. 226
3 -32.6003qkt_A mol:protein length:339 DNA double-strand break repair rad50 ATPase  ali model follow..  14  1....MKLERVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLLDAILVGLYWPLRIKDIKKDEFTKVGARDTYIDLIFEKDGTKYRITRRFLKGYSS................................................................................................................................. 94
4 -30.1003qku_A mol:protein length:359 DNA double-strand break repair rad50 ATPase  ali model follow..  14  1....MKLERVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLLDAILVGLYWPLRIKDIKKDEFTKVGARDTYIDLIFEKDGTKYRITRRFLKGYSS................................................................................................................................. 94
5 -28.2005f3w_B mol:protein length:372 DNA double-strand break repair Rad50 ATPase,D  ali model follow..  13  2...SMILKEIRMNNFKSHVNSRIKFEKGIVAIIGENGSGKSSIFEAVFFALFGAGSNFNYDTIITKGKKS---------------VYVELDFEVNGNNYKIIREYDSGRGGAKLYKNGKPY-------------------------ATTISAVNKAVNEILGVDRNMFLNSIYIKQ--------EIAKFLSLKPSEKLETVAKLLGIDEFEKCYQKMGEIVKEYEK. 177
6 -27.4003qkr_A mol:protein length:203 DNA double-strand break repair rad50 ATPase  ali model follow..  14  1....MKLERVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLLDAILVGLYWPLRIKDIKKDEFTKVGARDTYIDLIFEKDGTKYRITRRFLKGYSS................................................................................................................................. 94
7 -25.6005da9_A mol:protein length:449 Putative uncharacterized protein,Putative unc  ali model follow..  13  1MSKIEKLSILGVRSFGPHHPETIAFNTPLTLIVGYNGSGKTTVIECLKYATTGE-------LPPNSTRNGAFIHDPDLVGEKEVRAQVKLSFRSTIGESYVVTRNIQLLVQRN----------NKRTQKTLEGSLLLRNNGERTVISTRVAELDKLVSEKLGVPPAILDAVIFCHQDDSLWPMS--------EPAALKKRFDEIFEAQKYTKVIENIRL........ 194
8 -24.9003tho_A mol:protein length:382 Probable DNA double-strand break repair Rad50  ali model follow..  18  11...HMRPERLTVRNFLGLKNVDIEFQSGITVVEGPNGAGKSSLFEAISFALFGNG------------IRYPNSYDYVNRNAVDGTARLVFQFERGGKRYEI.............................................................................................................................. 96
9 -23.0004i99_A mol:protein length:354 Chromosome partition protein Smc  ali model follow..  13  1MP---YIEKLELKGFKSYGNKVIPFSKGFTAIVGANGSGKSNIGDAILFVL------GLSAKAMRASRISDLIFAGSKNEPPAKYAEVAIYFNNEDRDEVVIRRRVYPDGRSS-------YWLNGRRATRSEILDILTAISPDGYNIVLQGDITKFIKMSPLERRLLIDDISGIAE--YDSKKEKALEEEKEKKNVFMRTF------EAISRNFSEIFAKLSPGGSA 214
10 -21.2001e69_A mol:protein length:322 CHROMOSOME SEGREGATION SMC PROTEIN  ali model follow..  20  1....MRLKKLYLKGFKSFGRPSIGFSDRVTAIVGPNGSGKSNIIDAIKWVF-GEQS----KKELRASEKFDMIFAGSENLPPAGSAYVELVFEENGEEITVA............................................................................................................................. 94
11 -20.6004ux3_A mol:protein length:543 STRUCTURAL MAINTENANCE OF CHROMOSOMES PROTEIN  ali model follow..  20  1MA---YIKRVIIKGFKTYRNETINFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREERQG.................................................................................................................................................................. 64
12 -19.3002o5v_A mol:protein length:359 DNA replication and repair protein recF  ali model follow..  22  1.MGDVRLSALSTLNYRNLAPGTLNFPEGVTGIYGENGAGKTNLLEAAYLALTGQTDAPRIEQLIQAGETEAYVRADLQQGGSLSIQEVGLG........................................................................................................................................ 90
13 -19.2003zgx_A mol:protein length:426 CHROMOSOME PARTITION PROTEIN SMC  ali model follow..  16  1....MFLKRLDVIGFKSFAERIVDFVKGVTAVVGPNGSGKSNITDAIRWVL-GEQS----ARSLRGGKMEDIIFAGSDSRKRLNLAEVTLTLDNDDHHEVSVTRRVYRSGESEFLINNQPCRLKDIIDLFMDSGLGKEAF-----SIISQGKVEEILSSKAEDRRSIFEEAAGVLKYKTRKKKAENKLFETQDNLNRVEDILHELEGQPLKIQASIAKDYL...... 216
14 -18.6001w1w_A mol:protein length:430 STRUCTURAL MAINTENANCE OF CHROMOSOME 1  ali model follow..  25  3.....RLVGLELSNFKSYRGVTK-GESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKD.................................................................................................................................................................. 64
15 -15.4004ad8_A mol:protein length:517 DNA REPAIR PROTEIN RECN  ali model follow..  19  39.....RLSRLEIRNLATITQLELELGGGFCAFTGETGAGKSIIVDALGLLLGGRANHDLIRSGEKE................................................................................................................................................................. 99
16 -12.9001grq_A mol:protein length:178 CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE  ali model follow..  29  1........................MTTRMIILNGGSSAGKSGIVRCLQSVL................................................................................................................................................................................ 27
17 -12.1004g1u_C mol:protein length:266 Hemin import ATP-binding protein HmuV  ali model follow..  11  18........HYHVQQQALINDVSLHISGEMVAIIGPNGAGKSTLLRLLTGYLSPSHGECHLLGQNLNSWQPKALARTRAVMRQYS----ELAFPFSVSEVIQMGRAPYGGSQDRQALQQ---VMAQTDCLALAQRDYRVLSGGEQQRVQLARVLAQLWQPQPTPRWLFLDEPTSALDLYHQQHTLRLLRQLTRQEPLAVCCVLHDL------NLAALYADRIMLLAQG 224
18 -12.0002pjz_A mol:protein length:263 Hypothetical protein ST1066  ali model follow..  17  2....IQLKNVGITERFSLENINLEVNGEKVIILGPNGSGKTTLLRAISGLL................................................................................................................................................................................ 54
19 -12.0001sgw_A mol:protein length:214 putative ABC transporter  ali model follow..  18  3..SKLEIRDLSVYDKPVLERITMTIEGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPITKVKGK............................................................................................................................................................ 73
20 -11.8002vli_A mol:protein length:183 ANTIBIOTIC RESISTANCE PROTEIN  ali model follow..  21  2.......................PMRSPIIWINGPFGVGKTHTAHTLHERL................................................................................................................................................................................ 29
21 -11.7001zp6_A mol:protein length:191 hypothetical protein Atu3015  ali model follow..  37  2...................NMTDDLGGNILLLSGHPGSGKSTIAEALANLP................................................................................................................................................................................ 33
22 -11.5002bdt_A mol:protein length:189 BH3686  ali model follow..  32  2..........................KKLYIITGPAGVGKSTTCKRLAAQL................................................................................................................................................................................ 26
23 -11.4001kht_A mol:protein length:192 adenylate kinase  ali model follow..  22  1........................MKNKVVVVTGVPGVGSTTSSQLAMDNL................................................................................................................................................................................ 27
24 -11.3001g6h_A mol:protein length:257 HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID TRANS  ali model follow..  20  1MRDTMEILRTENIEFKALDGVSISVNGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEPAELYH........................................................................................................................................................ 81
25 -11.2001vpl_A mol:protein length:256 ABC transporter, ATP-binding protein  ali model follow..  18  6IMGAVVVKDLR--KKEILKGISFEIEGEIFGLIGPNGAGKTTTLRIISTLIKPSSGIVTVFGKNVVEEPHEVRKL........................................................................................................................................................ 83
26 -11.2003h86_B mol:protein length:192 Adenylate kinase  ali model follow..  17  1........................MKNKVVVVTGVPGVGGTTVTQKAMDILSEEGLNYKMVNFGS.................................................................................................................................................................. 41
27 -11.2001ki9_A mol:protein length:192 adenylate kinase  ali model follow..  18  1........................MKNKLVVVTGVPGVGGTTITQKAMEKL................................................................................................................................................................................ 27
28 -10.9001l7v_C mol:protein length:249 Vitamin B12 transport ATP-binding protein btu  ali model follow..  22  1MSIVMQLQDVAEST---LGPLSGEVRGEILHLVGPNGAGKSTLLARMAGMT................................................................................................................................................................................ 50
29 -10.8004fi3_C mol:protein length:249 Vitamin B12 import ATP-binding protein BtuD  ali model follow..  22  1MSIVMQLQDVAEST---LGPLSGEVRGEILHLVGPNGAGKSTLLARMAGMT................................................................................................................................................................................ 50
30 -10.8001nks_A mol:protein length:194 ADENYLATE KINASE  ali model follow..  33  2...........................KIGIVTGIPGVGKSTVLAKVKEIL................................................................................................................................................................................ 25
31 -10.6002axp_A mol:protein length:173 hypothetical protein BSU20280  ali model follow..  30  3............................LIILEGPDCCFKSTVAAKLSKEL................................................................................................................................................................................ 25
32 -10.6002nq2_C mol:protein length:253 Hypothetical ABC transporter ATP-binding prot  ali model follow..  22  1MNKALSVENLGF-----FQQLNFDLNGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKIEVYQS.................................................................................................................................................................... 67
33 -10.3004wia_A mol:protein length:233 Putative flagella-related protein H  ali model follow..  1.MGIMELARIDL----SRDDLDKRIGGSLIIIEGEESTGKSVL--CQRLAYGFLQNRYSVTYVSTQLTTLEFIKQMNSNKKLLSGALLYIPVYPLIADNKKKDGFLKKVMETRAFYEKDVIIFDSISALIANDA--------SEVNVDDLMAFFKRITALKKIIICTVNPKELPESVLTIIRTSAIRTELFTFGGDLKNLA-KILKYNMAPGSYQKNIVFRVEPKIG 224
34 -10.2002i3b_A mol:protein length:189 Human Cancer-Related NTPase  ali model follow..  33  5..............................FLTGPPGVGKTTLIHKASEVL................................................................................................................................................................................ 25
35 -10.2004a2i_V mol:protein length:277 PUTATIVE RIBOSOME BIOGENESIS GTPASE RSGA  ali model follow..  18  138....YRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALL................................................................................................................................................................................... 181
36 -10.1002rhm_A mol:protein length:193 Putative kinase  ali model follow..  15  4.........................TPALIIVTGHPATGKTTLSDAFKEVMFDGLGWSDREWSRRVGATAIMMLYHTAATILQSGQSLIME........................................................................................................................................ 83
37 -10.1004mde_A mol:protein length:171 Metallophosphoesterase  ali model follow..  20  8.........................ELSLVVLIGSSGSGKSTFANFCRGLVSDDENDQTVTGAA................................................................................................................................................................... 58
38 -10.0001rz3_A mol:protein length:201 hypothetical protein RBSTP0775  ali model follow..  21  1MELRDRIDFLCKTILAIKTAGRLVLG-----IDGLSRSGKTTLANQLSQTL................................................................................................................................................................................ 46
39 -9.9904gp7_A mol:protein length:171 Metallophosphoesterase  ali model follow..  20  8.........................ELSLVVLIGSSGSGKSTFADFCRGLMSDDENDQTVTGAA................................................................................................................................................................... 58
40 -9.9704rvc_A mol:protein length:245 ABC transporter ATP-binding protein  ali model follow..  24  1.MTLLEVKDLS--AQNVLEDVTFVVDGEMVALIGLNGAGKSTTIKHIIGLMEPRRGAISINGYRLADGPETYRRQ........................................................................................................................................................ 77
41 -9.9604gp6_A mol:protein length:171 Metallophosphoesterase  ali model follow..  20  8.........................ELSLVVLIGSSGSGKSTFADFCRGLVSDDENDQTVTGAA................................................................................................................................................................... 58
42 -9.6802pcj_A mol:protein length:224 Lipoprotein-releasing system ATP-binding prot  ali model follow..  12  1MAEILRAENIKKVGYEILKGISLSVKGEFVSIIGASGSGKSTLLYILGLLDAPTEGKVFLEGKEVDYTNEKELSL........................................................................................................................................................ 78
43 -9.6304xrp_A mol:protein length:312 Pnkp1  ali model follow..  16  11..........................PKLLILVGAPGSGKSTFADDFRLMQFGDSLMSPFYEERITKMVEASVIALLKNRTNVIIDATNSSLRSLQD.................................................................................................................................. 96
44 -9.5201ji0_A mol:protein length:240 ABC transporter  ali model follow..  17  1MVSDIVLEHVYYGAIHAIKGIDLKVPGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDITNKPAHVI.......................................................................................................................................................... 78
45 -9.4704r2h_A mol:protein length:210 STIV B204 ATPase  ali model follow..  12  3.........................PDDIVVIIGRKRSGKSYLIKHYFIPVLKAHK........................................................................................................................................................................... 33
46 -9.4501ltq_A mol:protein length:301 POLYNUCLEOTIDE KINASE  ali model follow..  13  2..........................KKIILTIGCPGSGKSTWADDYRQSIMAHEERDEYKTKKKEGIVTGMQFDTAKSILYGGDSVKGVIISDTNLNPERRLAWETFAKEYGWKVEHKVFDV--------PWTELVKRNSKRGTKAVPIDVLRSMYKS.................................................................... 142
47 -9.2701yqt_A mol:protein length:538 RNase l inhibitor  ali model follow..  20  1.MGSSSSGLVPRSHMEQLEEDCV--EGMVVGIVGPNGTGKSTAVKILAGQLIPN............................................................................................................................................................................. 68
48 -9.2301ye8_A mol:protein length:178 Hypothetical UPF0334 kinase-like protein AQ_1  ali model follow..  33  4..............................IITGEPGVGKTTLVKKIVERL................................................................................................................................................................................ 24
49 -9.2302w0m_A mol:protein length:235 SSO2452  ali model follow..  1MVSRLSILDFDKLIQGGIPQ------GFFIALTGEPGTGKTIF--SLHFIAKGLRDGDPCIYVTTEESRDSIIRQDFEEYIEKKLIIIDALMKEKEDQWSLVNLTPEEEAKQKLGYGKARLVIDSVSALFLDKPAMARKISYYLKRVLNKWNFTIYATSQYAITTSQAFGFG--VEHVADGIIRFRRMIRNGELHRYILIEKM-------TDHDKHVWEIDIVNGKG 226
50 -9.1101u0l_A mol:protein length:301 Probable GTPase engC  ali model follow..  13  147....YPIVKTSAKTGMGIEELKEYLKGKISTMAGLSGVGKSSLLNAINLKLRVSEVSEKLQRGRHTTTTAQLLKFDFGGYVVDTPGFANLEINDIEPEEL............................................................................................................................... 244
51 -9.0601dek_A mol:protein length:241 DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE  ali model follow..  40  1.........MKLIF-----------------LSGVKRSGKDTTADFIM................................................................................................................................................................................... 22
52 -9.0404yer_A mol:protein length:328 ABC transporter ATP-binding protein  ali model follow..  18  2MEDIIVVENLV--DFEAVKGVSFSVKGEIFAFLGPNGAGKTTTIHMLTTLLKPTS-----GKAWVAGHDVLKEPREVRRKIGIVFQDQSLDRELTAYENMYIHGKIYGYGGEKLKKRILELL......................................................................................................... 121
53 -9.0302ykr_W mol:protein length:350 PUTATIVE RIBOSOME BIOGENESIS GTPASE RSGA  ali model follow..  18  185....YRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNAL.................................................................................................................................................................................... 227

FFAS is supported by the NIH grant R01-GM087218-01
8 2 7 9 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Godzik A. Fragnostic: walking through protein structure space. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W249-51.