current user: public




1qhlA
Query: 1qhl_A mol:protein length:227 PROTEIN (CELL DIVISION PROTEIN MUKB), from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .
# Score Template Links and tools%idFirst MIERGKFRSLTLINWNGFFARTFDLDELVTTLSGGNGAGKSTTMAAFVTALIPDLTLLHFRNTTEAGATSGSRDKGLHGKLKAGVCYSMLDTINSRHQRVVVGVRLQQVAGRDRKVDIKPFAIQGLPMSVQPTQLVTETLNERQARVLPLNELKDKLEAMEGVQFKQFNSITDYHSLMFDLGIIARRLRSASDRSKFYRLIEASLYGGISSAITRSLRDYLLPENSGLast
1 -93.6001qhl_A mol:protein length:227 PROTEIN (CELL DIVISION PROTEIN MUKB)  ali model  100  1MIERGKFRSLTLINWNGFFARTFDLDELVTTLSGGNGAGKSTTMAAFVTALIPDLTLLHFRNTTEAGATSGSRDKGLHGKLKAGVCYSMLDTINSRHQRVVVGVRLQQVAGRDRKVDIKPFAIQGLPMSVQPTQLVTETLNERQARVLPLNELKDKLEAMEGVQFKQFNSITDYHSLMFDLGIIARRLRSASDRSKFYRLIEASLYGGISSAITRSLRDYLLPENSG 227
2 -61.3003euj_A mol:protein length:483 Chromosome partition protein mukB, Linker  ali model follow..  75  3MIARGKFRSLTLINWNGFFARTFDFDELVTTLSGGNGAGKSTTMAGFVTALIPDLTLLNFRNTTEAGSTSSSRDKGLYGKLKAGVCYAVLETVNSRAQRIITGVRLQQIAGRDKKVDIRPFSLQNVPMTDSVISLFTEQ-VANKARVLSLNDLKEKFEET-AVTFKPYHSITDYHSFMFDLGILPKRLRSSSDRNKFYKLIEASLYGGISSVITKSLRDYLLPENS. 226
3 -32.6003aux_A mol:protein length:371 DNA double-strand break repair rad50 ATPase  ali model follow..  17  2...SMILKEIRMNNFKSHVNSRIKFEKGIVAIIGENGSGKSSIFEAVFFALFGAGSNFNYDTIITKGKKS............................................................................................................................................................. 68
4 -32.1003qku_A mol:protein length:359 DNA double-strand break repair rad50 ATPase  ali model follow..  12  1....MKLERVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLLDAILVGLYWPLRIKDIKKDEFTKVGARDTYIDLIFEKDGTKYRITRRFLKGYSSGEIHAMKRLVGNEWKHVTEPSSKAISAFMEKLIPYNIFLNAIYIRQGQIDAILESDEAREKVVREVLNLDKFETAYKKLSELKKTINNRIKEYGGSGGIKDLEKAKDFTEELIEKVKKYKALAREA... 220
5 -31.9003qkt_A mol:protein length:339 DNA double-strand break repair rad50 ATPase  ali model follow..  12  1....MKLERVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLLDAILVGLYWPLRIKDIKKDEFTKVGARDTYIDLIFEKDGTKYRITRRFLKGYSSGEIHAMKRLVGNEWKHVTEPSSKAISAFMEKLIPYNIFLNAIYIRQGQIDAILESDEAREKVVREVLNLDKFETAYKKLSELKGGSGGTEELIEKVKKYKALAREAALSKIGELASEIFAEFTEGK... 220
6 -30.9003qkr_A mol:protein length:203 DNA double-strand break repair rad50 ATPase  ali model follow..  14  1....MKLERVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLLDAILVGLYWPLR-------------IKDIKKDEFTKVGARDTYIDLIFEKDGTKYRITRRFLKGYSSGEIHAMKRLVGNEWKHVTEPSSKAISAF-----EKLIPYNIFLNAIYIRQGQIDAILESDEAREKVVREVLNLDKFETAYKKLSELKKTINNRI---------KEYRDILARTEGG 197
7 -28.3003tho_A mol:protein length:382 Probable DNA double-strand break repair Rad50  ali model follow..  26  8FQGHMRPERLTVRNFLGLKNVDIEFQSGITVVEGPNGAGKSSLFEAISFALFGNGIR.......................................................................................................................................................................... 64
8 -25.5001xew_X mol:protein length:182 SMC protein  ali model follow..  11  2....PYIEKLELKGFKSYGNKKIPFSKGFTAIVGANGSGKSNIGDAILFVLGGLSAKAMRASRISDLIFAGSKN-----EPPAKYAEVAIYFNNEDRDEVVIRRRVYPDGRSSYWLNGRRATRSEILDILTAAMIIVLQGDITKFIKMSPLERRLLIDDISGIAEYDSKKEKALEE................................................... 182
9 -24.1001e69_A mol:protein length:322 CHROMOSOME SEGREGATION SMC PROTEIN  ali model follow..  15  1....MRLKKLYLKGFKSFGRPSIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEQSKKELRASEKFDMIFAGSENLPPAGSAYVELVF------EENGEEITVARELKRTGENTYYLNGSPVRLKDIRDRFAGT.............................................................................................. 124
10 -23.6002o5v_A mol:protein length:359 DNA replication and repair protein recF  ali model follow..  15  1.MGDVRLSALSTLNYRNLAPGTLNFPEGVTGIYGENGAGKTNLLEAAYLALTGQ----TDAPRIEQLIQAGETEAYVRADLQQGGSLSIQEVGLGRGRRQLKVDGVRARTGDLPRGGAVWIRPEDSE------------------LVFGPPSGRRAYLDSLLSRLSYGEQLSRYERTVSQRNAALRG--GEEWAMHVWDDVLLKLGTEIMLFRRRALTRL....... 197
11 -23.5001w1w_A mol:protein length:430 STRUCTURAL MAINTENANCE OF CHROMOSOME 1  ali model follow..  14  2....GRLVGLELSNFKSYRGVTK-GESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLIYRGVLNDENSDDYDNEGAASSNPQSAYVGNKLVELMRIISRNGDTSYKIDGKTVSYKDYSIFLENENILIKAKNFLVFQ--DVEQIAAQSPVELSRMFEEVSGSIQYKKEYEELKEKIEKLSKSATE................................. 198
12 -13.5001grq_A mol:protein length:178 CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE  ali model follow..  29  1........................MTTRMIILNGGSSAGKSGIVRCLQSVL................................................................................................................................................................................ 27
13 -12.2002bdt_A mol:protein length:189 BH3686  ali model follow..  32  2..........................KKLYIITGPAGVGKSTTCKRLAAQL................................................................................................................................................................................ 26
14 -12.1001sgw_A mol:protein length:214 putative ABC transporter  ali model follow..  17  3..SKLEIRDLS-YDKPVLERITMTIEKGNVVFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPITKVKGK............................................................................................................................................................ 73
15 -12.1002vli_A mol:protein length:183 ANTIBIOTIC RESISTANCE PROTEIN  ali model follow..  21  2.......................PMRSPIIWINGPFGVGKTHTAHTLHERL................................................................................................................................................................................ 29
16 -12.0002nq2_C mol:protein length:253 Hypothetical ABC transporter ATP-binding prot  ali model follow..  22  1MNKALSVENLGF-YYQAFQQLNFDLNKGILAVLGQNGCGKSTLLDLLLGIHRPIQGKIEVYQS.................................................................................................................................................................... 67
17 -11.9001g6h_A mol:protein length:257 HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID TRANS  ali model follow..  21  1MRDTMEILRTE--EFKALDGVSISVNKGVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKD................................................................................................................................................................... 70
18 -11.6002i3b_A mol:protein length:189 Human Cancer-Related NTPase  ali model follow..  33  5..............................FLTGPPGVGKTTLIHKASEVL................................................................................................................................................................................ 25
19 -11.3002axp_A mol:protein length:173 hypothetical protein BSU20280  ali model follow..  33  5..............................ILEGPDCCFKSTVAAKLSKEL................................................................................................................................................................................ 25
20 -11.2001nks_A mol:protein length:194 ADENYLATE KINASE  ali model follow..  33  2...........................KIGIVTGIPGVGKSTVLAKVKEIL................................................................................................................................................................................ 25
21 -11.1001zp6_A mol:protein length:191 hypothetical protein Atu3015  ali model follow..  41  2...................NMTDDLGGNILLLSGHPGSGKSTIAEALA................................................................................................................................................................................... 30
22 -11.1001ki9_A mol:protein length:192 adenylate kinase  ali model follow..  18  1........................MKNKLVVVTGVPGVGGTTITQKAMEKL................................................................................................................................................................................ 27
23 -10.9001l7v_C mol:protein length:249 Vitamin B12 transport ATP-binding protein btu  ali model follow..  22  1MSIVMQLQDVA------LGPLSGEVRAGILHLVGPNGAGKSTLLARMAGMT................................................................................................................................................................................ 50
24 -10.8002ihy_A mol:protein length:279 ABC transporter, ATP-binding protein  ali model follow..  10  16....IQLDQIGRMGKTILKKISWQIAKG--ILYGLNGAGKTTLLNILNAYEPATSGTVNLFGKMPGKVGYSAETVRQHIGFVSHSLLEKFQEGERVIDVVISGAFYQDIDDEIRNEAHQLLKLVGMSAKAQQYIGYLSTGEKQRRALMGQPQVLILDEPAAGLDFIARESLLSILDSLSDSYPTLAMIYVTHFIEEITANFSKILLLKDGQSIQQGAVEDILTSEN. 249
25 -10.6001ye8_A mol:protein length:178 Hypothetical UPF0334 kinase-like protein AQ_1  ali model follow..  33  4..............................IITGEPGVGKTTLVKKIVERL................................................................................................................................................................................ 24
26 -10.5003h86_B mol:protein length:192 Adenylate kinase  ali model follow..  22  1........................MKNKVVVVTGVPGVGGTTVTQKAMDIL................................................................................................................................................................................ 27
27 -10.4002pjz_A mol:protein length:263 Hypothetical protein ST1066  ali model follow..  17  2....IQLKNVGITERFSLENINLEVNGEKVIILGPNGSGKTTLLRAISGLL................................................................................................................................................................................ 54
28 -10.4001vpl_A mol:protein length:256 ABC transporter, ATP-binding protein  ali model follow..  22  1MGSDKIMGAVVVKDLEILKGISFEIEEGEIFLIGPNGAGKTTTLRIISTLIKPSSGIVTVFG..................................................................................................................................................................... 70
29 -10.3001kht_A mol:protein length:192 adenylate kinase  ali model follow..  22  1........................MKNKVVVVTGVPGVGSTTSSQLAMDNL................................................................................................................................................................................ 27
30 -10.3002rhm_A mol:protein length:193 Putative kinase  ali model follow..  11  5..........................PALIIVTGHPATGKTTLSQALATGL--RLPLLSKDAFKEVMFDGLGWSDREWSRRVGATAIMMLYHTAATILQSGQSLIMESNFRVDLDTERMQNLHTIAPFTPIQIRC------------ASGDVLVERILSRIAQGARHPGHCDDRSPADLELVRSRGDIPPLPLGGPLLTVDTTFPEQIDMNAIVQWVRQHLQSGTA. 191
31 -10.2002zu0_C mol:protein length:267 Probable ATP-dependent transporter sufC  ali model follow..  22  12GSHMLSIKDLSVEDKAILRGLSLDVHPGVHAIMGPNGSGKSTLSATLA................................................................................................................................................................................... 62
32 -10.2001y63_A mol:protein length:184 Lmaj004144AAA protein  ali model follow..  21  14..............................LITGTPGTGKTSMAEMIAAELDG.............................................................................................................................................................................. 36
33 -10.1002d2e_A mol:protein length:250 SufC protein  ali model follow..  26  1......MSQLEIRDLWALKGVNLVVPKGVHALMGPNGAGKSTLGKILA................................................................................................................................................................................... 50
34 -10.0001gvn_B mol:protein length:287 ZETA  ali model follow..  12  1MANIVNFTDKQFEN-ELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFIVIDNDTFKQQHPNFDELVKLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVI............................................................................................................................. 115
35 -9.8503ch4_B mol:protein length:202 Phosphomevalonate kinase  ali model follow..  30  13............................VLLFSGKRKSGKDFVTEALQ................................................................................................................................................................................... 32
36 -9.8203tqf_A mol:protein length:181 Hpr(Ser) kinase  ali model follow..  20  6................TWHANFLVIDKMGVLITGEANIGKSEL--SLALILVCDDV........................................................................................................................................................................... 48
37 -9.8001dek_A mol:protein length:241 DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE  ali model follow..  40  1.........MKLIF-----------------LSGVKRSGKDTTADFIM................................................................................................................................................................................... 22
38 -9.7704a2i_V mol:protein length:277 PUTATIVE RIBOSOME BIOGENESIS GTPASE RSGA  ali model follow..  18  138....YRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALL................................................................................................................................................................................... 181
39 -9.7301jb1_A mol:protein length:205 HPRK PROTEIN  ali model follow..  30  18................SMHGVLVDIYGLGVLITGDSGVGKSET--ALELVLIADDR........................................................................................................................................................................... 60
40 -9.6101knq_A mol:protein length:175 Gluconate kinase  ali model follow..  30  7.........................DHHIYVLMGVSGSGKSAVASEVAHQL................................................................................................................................................................................ 32
41 -9.5502pcj_A mol:protein length:224 Lipoprotein-releasing system ATP-binding prot  ali model follow..  12  1MAEILRAENIKIRGYEILKGISLSVKKGFVSIIGASGSGKSTLLYILGLLDAPTEGKVFLEGKEVDYTNEKELSL........................................................................................................................................................ 78
42 -9.5002r2a_A mol:protein length:199 Uncharacterized protein  ali model follow..  19  7............................ICLITGTPGSGKTLK--MVSMMA................................................................................................................................................................................ 27
43 -9.4701s9h_A mol:protein length:268 Rep 40 protein  ali model follow..  13  105..........................RNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNEN.................................................................................................................................................................... 141
44 -9.4502kjq_A mol:protein length:149 DnaA-related protein  ali model follow..  14  6.......DYPSFDKFLGTENAELHKHGQFIYVWGEEGAGKSHLLQAWVAQALEAGKNAAYIDAASMPLTDAAFEAEY...................................................................................................................................................... 80
45 -9.4202f1r_A mol:protein length:171 molybdopterin-guanine dinucleotide biosynthes  ali model follow..  21  7...............................IVGTSDSGKTTLITRMMPILRER............................................................................................................................................................................. 29
46 -9.4101svl_A mol:protein length:377 large T antigen  ali model follow..  15  169..........................KRYWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRLN................................................................................................................................................................. 208
47 -9.3701np6_A mol:protein length:174 Molybdopterin-guanine dinucleotide biosynthes  ali model follow..  17  8............................LLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHDMDVDKPGKDSYELRKAGAAQTIV......................................................................................................................................... 69
48 -9.3303iij_A mol:protein length:180 Coilin-interacting nuclear ATPase protein  ali model follow..  33  15..............................LLTGTPGVGKTTLGKELA................................................................................................................................................................................... 32
49 -9.2902cbz_A mol:protein length:237 MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1  ali model follow..  21  1......MNSITVRNATTLNGITFSIPEGALVVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGS.................................................................................................................................................................... 67
50 -9.2701ji0_A mol:protein length:240 ABC transporter  ali model follow..  20  1MVSDIVLEHVYYGAIHAIKGIDLKVPRGIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQD................................................................................................................................................................... 69
51 -9.2501rz3_A mol:protein length:201 hypothetical protein RBSTP0775  ali model follow..  21  1MELRDRIDFLCKTILAIKTAGRL-----VLGIDGLSRSGKTTLANQLSQTL................................................................................................................................................................................ 46
52 -9.2303t61_A mol:protein length:202 Gluconokinase  ali model follow..  33  22..............................VVMGVSGSGKSSVGEAIAEAC................................................................................................................................................................................ 42
53 -9.2201tue_A mol:protein length:212 Replication protein E1  ali model follow..  20  58..........................KNCLVFCGPANTGKSYFGMSFIHFI................................................................................................................................................................................ 82
54 -9.2102no0_A mol:protein length:280 Deoxycytidine kinase  ali model follow..  34.........................RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNVQSTQDEFEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGYLQA--TPETCLHRIYLRGRNEE------QGIPLEYLEKLHYKHESWLLHRTL. 235
55 -9.2102v9p_A mol:protein length:305 REPLICATION PROTEIN E1  ali model follow..  20  126..........................KNCLAFIGPPNTGKSMLCNSLIHFL................................................................................................................................................................................ 150
56 -9.1902jas_A mol:protein length:206 DEOXYGUANOSINE KINASE  ali model follow..  44  5..............................AIFGTVGAGKSTISAEIS................................................................................................................................................................................... 22
57 -9.1102a2z_A mol:protein length:248 Deoxycytidine kinase  ali model follow..  28  28..............................SIEGNIAAGKSTFVNILKQLC................................................................................................................................................................................ 48
58 -9.0502p5t_B mol:protein length:253 PezT  ali model follow..  15  31.........................QPIAILLGGQSGAGKTTIHRIKQVIIDGDSFRSQHPHYLELQQEYGKDSVEYTKDFAGKMVESLVTKLSSLGYNLLI............................................................................................................................. 114
59 -9.0402ga8_A mol:protein length:359 Hypothetical 39.9 kDa protein  ali model follow..  15  1MVDTHKLADLQLLDNRIEDNYRV-----CVILVGSPGSGKSTIAEELCQIINEKYHTFLSEHPNVIEVNDRL........................................................................................................................................................... 69
60 -9.0302qrn_A mol:protein length:280 Deoxycytidine kinase  ali model follow..  34.........................RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTQDEFEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGYLQA--TPETCLHRIYLRGRNEE------QGIPLEYLEKLHYKHESWLLHRTL. 235

FFAS is supported by the NIH grant R01-GM087218-01
5 9 7 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. Flexible structure alignment by chaining aligned fragment pairs allowing twists. Bioinformatics. 2003 Oct;19 Suppl 2:II246-II255.