current user: public




Query: 1nxq_A mol:protein length:251 R-alcohol dehydrogenase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst SNRLDGKVAIITGGTLGIGLAIATKFVEEGAKVMITGRHSDVGEKAAKSVGTPDQIQFFQHDSSDEDGWTKLFDATEKAFGPVSTLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPSLGAYNASKGAVRIMSKSAALDCALKDYDVRVNTVHPGYIKTPLVDDLPGAEEAMSQRTKTPMGHIGEPNDIAYICVYLASNESKFATGSEFVVDGGYTAQLast
1 -118.0001nxq_A mol:protein length:251 R-alcohol dehydrogenase  ali model  100  1SNRLDGKVAIITGGTLGIGLAIATKFVEEGAKVMITGRHSDVGEKAAKSVGTPDQIQFFQHDSSDEDGWTKLFDATEKAFGPVSTLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPSLGAYNASKGAVRIMSKSAALDCALKDYDVRVNTVHPGYIKTPLVDDLPGAEEAMSQRTKTPMGHIGEPNDIAYICVYLASNESKFATGSEFVVDGGYTAQ 251
2 -115.0004rf2_A mol:protein length:272 NADPH dependent R-specific alcohol dehydrogen  ali model follow..  88  14TDRLKGKVAIVTGGTLGIGLAIADKFVEEGAKVVITGRHADVGEKAAKSIGGTDVIRFVQHDASDEAGWTKLFDTTEEAFGPVTTVVNNAGIAVSKSVEDTTTEEWRKLLSVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPTLGAYNASKGAVRIMSKSAALDCALKDYDVRVNTVHPGYIKTPLVDDLEGAEEMMSQRTKTPMGHIGEPNDIAWICVYLASDESKFATGAEFVVDGGYTAQ 264
3 -103.0001hxh_A mol:protein length:253 3BETA/17BETA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  35  1TNRLQGKVALVTGGASGVGLEVVKLLLGEGAKVAFSDINEAAGQQLAAELG--ERSMFVRHDVSSEADWTLVMAAVQRRLGTLNVLVNNAGILLPGDMETGRLEDFSRLLKINTESVFIGCQQGIAAMKET--GGSIINMASVSSWLPIEQYAGYSASKAAVSALTRAAALSCRKQGYAIRVNSIHPDGIYTPMMQASLPKEMVLHDPKLNRAGRAYMPERIAQLVLFLASDESSVMSGSELHADNSILG. 250
4 -95.3001hdc_A mol:protein length:254 3-ALPHA, 20 BETA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  38  1.NDLSGKTVIITGGARGLGAEAARQAVAAGARVVLADVLDEEGAATARELG--DAARYQHLDVTIEEDWQRVVAYAREEFGSVDGLVNNAGISTGMFLETESVERFRKVVEINLTGVFIGMKTVIPAMKDAG-GGSIVNISSAAGLMGLALTSSYGASKWGVRGLSKLAAVELGT--DRIRVNSVHPGMTYTPMTAET-GIRQGEGNYPNTPMGRVGEPGEIAGAVVKLLSDTSSYVTGAELAVDGGWTT. 244
5 -94.3001nff_A mol:protein length:260 Putative oxidoreductase Rv2002  ali model follow..  41  2SGRLTGKVALVSGGARGMGASHVRAMVAEGAKVVFGDILDEEGKAMAAELA--DAARYVHLDVTQPAQWKAAVDTAVTAFGGLHVLVNNAGILNIGTIEDYALTEWQRILDVNLTGVFLGIRAVVKPMKEAG-RGSIINISSIEGLAGTVACHGYTATKFAVRGLTKSTALELGP--SGIRVNSIHPGLVKTPMTDWVPED------IFQTALGRAAEPVEVSNLVVYLASDESSYSTGAEFVVDGGTVA. 240
6 -92.5001yde_A mol:protein length:270 Retinal dehydrogenase/reductase 3  ali model follow..  34  4GTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELP---GAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKS--QGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESP--YGVRVNCISPGNIWTPLWEELAARASIREGMLAQPLGRMGQPAEVGAAAVFLASE-ANFCTGIELLVTGGAEL. 251
7 -91.5005HS6 Entity 1(prereleased)  ali follow..  34  6GTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELP---GAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKS--QGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPY--GVRVNCISPGNIWTPLWEELAARATIREGMLAQPLGRMGQPAEVGAAAVFLASE-ANFCTGIELLVTGGAEL. 253
8 -90.3003n74_A mol:protein length:261 3-ketoacyl-(acyl-carrier-protein) reductase  ali model follow..  33  4SMSLEGKVALITGAGSGFGEGMAKRFAKGGAKVVIVDRDKAGAERVAGEIG--DAALAVAADISKEADVDAAVEAALSKFGKVDILVNNAGIGKPQNAELVEPEEFDRIVGVNVRGVYLMTSKLIPHFKENGAKCVILNVASTGAGRPRPNLAWYNATKGWVVSVTKALAIELAPA--KIRVVALNPVAGETPLLTTFMGEEIRKKFRDSIPMGRLLKPDDLAEAAAFLCSPQASMITGVALDVDGGRSI. 256
9 -89.7004gh5_A mol:protein length:269 Short-chain dehydrogenase/reductase SDR  ali model follow..  35  10SNRLKNEVIAITGGGAGIGLAIASAALREGAKVALIDLDQGLAERSAAMLTGGAVAKGFGADVTKAADITAAITSAEQTIGSLTGLVNNAGIAGFGSVHDADAAAWDRIMAVNVTGTFLASKAALAGMLERH-KGTIVNFGSVAGLVGIPTMAAYCAAKGAIVNLTRQMAADYSGR--GVRVNAVCPGTVTSTGMGQQLSPEVQARRLAKYPIGRFGTPEDIAEAVIFLLSDQAAFVTGAAFAVDGGMTA. 262
10 -89.5004dqx_A mol:protein length:277 Probable oxidoreductase protein  ali model follow..  32  18..DLNQRVCIVTGGGSGIGRATAELFAKNGAYVVVADVNEDAAVRVANEIG--SKAFGVRVDVSSAKDAESMVEKTTAKWGRVDVLVNNAGFGTTGNVVTIPEETWDRIMSVNVKGIFLCSKYVIPVMRRNG-GGSIINTTSYTATSAIADRTAYVASKGAISSLTRAMAMDHAKE--GIRVNAVAPGTIDSPYFTKIFAAKLRSDFNARAVMDRMGTAEEIAEAMLFLASDRSRFATGSILTVDGGSSI. 265
11 -88.5003gvc_A mol:protein length:277 Probable short-chain type dehydrogenase/reduc  ali model follow..  32  19.PDLAGKVAIVTGAGAGIGLAVARRLADEGCHVLCADIDGDAADAAATKIG--CGAAACRVDVSDEQQIIAMVDACVAAFGGVDKLVANAGVVHLASLIDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERG-GGAIVNLSSLAGQVAVGGTGAYGMSKAGIIQLSRITAAELRSS--GIRSNTLLPAFVDTPMQQTAMAGAGGARSMIARLQGRMAAPEEMAGIVVFLLSDDASMITGTTQIADGGTIA. 268
12 -88.3002cfc_A mol:protein length:250 2-(R)-HYDROXYPROPYL-COM DEHYDROGENASE  ali model follow..  33  2.....SRVAIVTGASSGNGLAIATRFLARGDRVAALDLSAETLEETARTHAYADKVLRVRADVADEGDVNAAIAATMEQFGAIDVLVNNAGITGAGVLHTTPVEQFDKVMAVNVRGIFLGCRAVLPHMLLQG-AGVIVNIASVASLVAFPGRSAYTTSKGAVLQLTKSVAVDYAGS--GIRCNAVCPGMIETPMTQWRLDQELRDQVLARIPQKEIGTAAQVADAVMFLAGEDATYVNGAALVMDGAYTA. 249
13 -87.9004ni5_A mol:protein length:254 Oxidoreductase, short-chain dehydrogenase/red  ali model follow..  36  4..RFKDKVVIVTGGASGIGEATARAFIREGAKVVIADFSDHGQQLADERAGAHEQALFIKTDVADTRAVQALIARTVENYGRLDIMFANAGIAADAPIDELDEAAWQKTIDINLTGVYLCDKYAIDQMRSQG-GGVIVNCGSIHSHVGKSGVTAYAAAKGGVKLLTQTLAIDYGPQ--NIRVNAVCPGYIDTPLLKNI-PDDKKQALVALHPMGRLGRAEEVANAVLFLASDEASFVNGASLLVDGGYTAQ 248
14 -86.8005epo_A mol:protein length:262 7-alpha-hydroxysteroid deydrogenase  ali model follow..  31  2.KRLEGKVAIVTSSTRGIGRASAEALAKEGALVYLAARSEELANEVIADIKKGGVAKFVYFNAREEETYTSMVEKVAEAEGRIDILVNNYGGTNVNNLTAGDTDEFFRILKDNVQSVYLPAKAAIPHMEKVG-GGSIVNISTIGSVVPDISRIAYCVSKSAINSLTQNIALQYARK--NIRCNAVLPGLIGTRAALENMTDEFRDSFLGHVPLNRVGRPEDIANAVLYYASDDSGYVTGMIHEVAGGFAL. 251
15 -86.2004e4y_A mol:protein length:244 Short chain dehydrogenase family protein  ali model follow..  29  2...NAMANYLVTGGSKGIGKAVVELLLQNKNHTVINIDIQQS--------FSAENLKFIKADLTKQQDITNVLDII--KNVSFDGIFLNAGILIKGSIFDIDIESIKKVLDLNVWSSIYFIKGLENNLKV---GASIVFNGSDQCFIAKPNSFAYTLSKGAIAQMTKSLALDLAKY--QIRVNTVCPGTVDTDLYRNLIQDEAQKQEEKEFPLNRIAQPQEIAELVIFLLSDKSKFMTGGLIPIDGGYTAQ 244
16 -86.0002zk7_A mol:protein length:257 Glucose 1-dehydrogenase related protein  ali model follow..  34  4FSDLRDKVVIVTGASMGIGRAIAERFVDEGSKVIDLSIHDPGE----------AKYDHIECDVTNPDQVKASIDHIFKEYGSISVLVNNAGIESYGKIESMSMGEWRRIIDVNLFGYYYASKFAIPYMIRSR-DPSIVNISSVQASIITKNASAYVTSKHAVIGLTKSIALDYAP---LLRCNAVCPATIDTPLVRKAAEEKKISEWGHEHPMQRIGKPQEVASAVAFLASREASFITGTCLYVDGGLSIR 250
17 -85.9002d1y_A mol:protein length:256 hypothetical protein TT0321  ali model follow..  34  2.GLFAGKGVLVTGGARGIGRAIAQAFAREGALVALCDLRPE-----GKEVAEAIGGAFFQVDLEDERERVRFVEEAAYALGRVDVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVG-GGAIVNVASVQGLFAEQENAAYNASKGGLVNLTRSLALDLAPL--RIRVNAVAPGAIATEAVLEAIAERTRRDWEDLHALRRLGKPEEVAEAVLFLASEKASFITGAILPVDGGMTAS 248
18 -85.7005jc8_A mol:protein length:276 Putative short-chain dehydrogenase/reductase  ali model follow..  32  6AGRLQGKVALVTGAGCGNGRAIAVRFAEEGAHVIAVDRDLASMDATLELVAAGGSVTPCLCDVTDSASVERLVADSVARCGRVDILVNNVGAPSPGGPVALDEAQWAMQLELNLTTAFLMCKYVLPVMEQQG-GGAIVNIASTSGIRWTGAQVGYAAAKAGMIQMGRVVAVEYAAK--NVRVNSVVPGLLHTPMVDTKIAELLLRKRQARIPMPFMGDGRDTANAALFLASDEARFVTGTEIVVDGGMSAR 268
19 -85.2003vtz_A mol:protein length:269 Glucose 1-dehydrogenase  ali model follow..  32  4.EEFTDKVAIVTGGSSGIGLAVVDALVRYGAKVVSVSLDEKSDVNVSD---------HFKIDVTNEEEVKEAVEKTTKKYGRIDILVNNAGIEQYSPLHLTPTEIWRRIIDVNVNGSYLMAKYTIPVMLAIG-HGSIINIASVQSYAATKNAAAYVTSKHALLGLTRSVAIDYAP---KIRCNAVCPGTIMTPMVIKAAKERKIEEWGRQHPMGRIGRPEEVAEVVAFLASDRSSFITGACLTVDGGLLSK 250
20 -85.1003tzq_B mol:protein length:271 Short-chain type dehydrogenase/reductase  ali model follow..  29  6TAELENKVAIITGACGGIGLETSRVLARAGARVVLADLPETDLAGAAASVG--RGAVHHVVDLTNEVSVRALIDFTIDTFGRLDIVDNNAAHSDPALVTQMTVDVWDDTFTVNARGTMLMCKYAIPRLISAG-GGAIVNISSATAHAAYDMSTAYACTKAAIETLTRYVATQYGRH--GVRCNAIAPGLVRTPRLEVGLPQPIVDIFATHHLAGRIGEPHEIAELVCFLASDRAAFITGQVIAADSGLLAH 253
21 -84.7002dtd_A mol:protein length:264 Glucose 1-dehydrogenase related protein  ali model follow..  34  4.SDLRDKVVIVTGASMGIGRAIAERFVDEGSKVIDLSIHDPGE----------AKYDHIECDVTNPDQVKASIDHIFKEYGSISVLVNNAGIESYGKIESMSMGEWRRIIDVNLFGYYYASKFAIPYMIRSR-DPSIVNISSVQASIITKNASAYVTSKHAVIGLTKSIALDYAP---LLRCNAVCPATIDTPLVRKAAEEKKISEWGHEHPMQRIGKPQEVASAVAFLASREASFITGTCLYVDGGLSIR 249
22 -83.7004nim_A mol:protein length:277 Versicolorin reductase  ali model follow..  28  4GGQLKGKIAVITGSTQGLGAATARLFAERGAQGLVCGRSAEKGRAQAAGLEEGAKAVFVQVDLENVEDCRRIVAEADRAFGRLDILVNAAGLTDRGTILDTSPELFDRLFAVNTRAPFFLIQEAIKLFRRDRVEGAIVNVSSMSSMGGQPFIAAYCASKGALDTLTRNVAYSVLRN--RIRVNSLNIGWMASDGEDRIAPANWLEEAVKTQPFGRLLDPAKVARAIAFLASEESGLMTGAIVNFDQSVWG. 259
23 -83.6004ure_A mol:protein length:248 CYCLOHEXANOL DEHYDROGENASE  ali model follow..  33  2..LLEGKTALVTGAGNGIGRTIALTYAAEGANVVVSDISDEWGRETLALIGKGGKAVFQHADTAHPEDHDELIAAAKRAFGRLDIACNNAGISGFTPTAETTDAQWQRVIGINLSGVFYGVRAQIRAMLETG-GGAIVNISSIAGQIGIEGITPYTAAKHGVVGLTKTVAWEYGSK--GIRINSVGPAFINTTLVQNV-PLETRRQLEQMHALRRLGETEEVANLVAWLSSDKASFVTGSYYAVDGGYLAR 248
24 -83.6001iy8_A mol:protein length:267 LEVODIONE REDUCTASE  ali model follow..  28  8TTRFTDRVVLITGGGSGLGRATAVRLAAEGAKLSLVDVSSEGLEASKAAVAPDAEVLTTVADVSDEAQVEAYVTATTERFGRIDGFFNNAGIGKQNPTESFTAAEFDKVVSINLRGVFLGLEKVLKIMREQG-SGMVVNTASVGGIRGIGNQSGYAAAKHGVVGLTRNSAVEYGRY--GIRINAIAPGAIWTPMVENSMKRKAAEEFIQVNPSKRYGEAPEIAAVVAFLLSDDASYVNATVVPIDGGQSAA 266
25 -83.6005f1p_A mol:protein length:265 PtmO8  ali model follow..  30  5.GRLEGKIAIVTGAASGIGAVTAERLAAEGARVALADLDAVGVQTLAEKIRGGTHAIGIEVDLADPASVRAMVAAAVEEFGGLDILHNNAAATALVPVADADPEVWDRTMRVNLSGAMVATQAALPHLIARG-GGCVINTSSAAGLSGDLSHPAYAASKAALISLTRSVATQAGRS--GVRCNAIAPGLIITRPER----EAAYRVMLPHHLTTRLGRPEDVASAVVFLASDEASFITGQTLVVDGGLLAH 254
26 -83.2001zem_A mol:protein length:262 xylitol dehydrogenase  ali model follow..  28  2SKKFNGKVCLVTGAGGNIGLATALRLAEEGTAIALLDMNREALEKAEASVREGVEARSYVCDVTSEEAVIGTVDSVVRDFGKIDFLFNNAGYQGFAPVQDYPSDDFARVLTINVTGAFHVLKAVSRQMITQN-YGRIVNTASMAGVKGPPNMAAYGTSKGAIIALTETAALDLAPY--NIRVNAISPGYMGPGFMWERQPKVVAQQMIGSVPMRRYGDINEIPGVVAFLLGDDSSFMTGVNLPIAGG.... 262
27 -82.8002bgk_A mol:protein length:278 RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE  ali model follow..  32  11TNRLQDKVAIITGGAGGIGETTAKLFVRYGAKVVIADIADDHGQKVCNNIGSPDVISFVHCDVTKDEDVRNLVDTTIAKHGKLDIMFGNVGVLSTYSILEAGNEDFKRVMDINVYGAFLVAKHAARVMIPAKKG-SIVFTASISSFTAGEGVSVYTATKHAVLGLTTSLCTELGE--YGIRVNCVSPYIVASPLLTDVFGVDSSRVEQAANLKGTLLRAEDVADAVAYLAGDESKYVSGLNLVIDGGYTR. 264
28 -82.4001k2w_A mol:protein length:256 SORBITOL DEHYDROGENASE  ali model follow..  29  2..RLDGKTALITGSARGIGRAFAEAYVREGARVAIADINLEAARATAAEIG--PAACAIALDVTDQASIDRCVAELLDRWGSIDILVNNAALFDLAPIVEITRESYDRLFAINVSGTLFMMQAVARAMIAGGRGGKIINMASQAGRRGEALVGVYCATKAAVISLTQSAGLNLIRH--GINVNAIAPGVVDGEHWDGVDAGEKKRQVGAAVPFGRMGRAEDLTGMAIFLATPEADYIVAQTYNVDGGNW.. 254
29 -82.3004cr6_A mol:protein length:271 N-ACYLMANNOSAMINE 1-DEHYDROGENASE  ali model follow..  27  10PGRLAGKAAIVTGAAGGIGRATVEAYLREGASVVAMDLAPRLAATRYE----EPGAIPIACDLADRAAIDAAMADAVARLGGLDILVAGGALKGTGNFLDLSDADWDRYVDVNMTGTFLTCRAGARAMVAAGAGARIITIGSVNSFMAEPEAAAYVAAKGGVAMLTRAMAVDLARH--GILVNMIAPGPVDVTGNNTGSEPRLAEQVLDEVALGRPGLPEEVATAAVFLAEDGSSFITGSTITIDGGLSAM 261
30 -81.9003ak4_A mol:protein length:263 NADH-dependent quinuclidinone reductase  ali model follow..  29  9..DLSGRKAIVTGGSKGIGAAIARALDKAGATVAIADLDVMAAQAVVAGLE--NGGFAVEVDVTKRASVDAAMQKAIDALGGFDLLCANAGVSTMRPAVDITDEEWDFNFDVNARGVFLANQIACRHFLASNTKGVIVNTASLAAKVGAPLLAHYSASKFAVFGWTQALAREMAPK--NIRVNCVCPGFVKTAMQEGMTPEAVRAEYVSLTPLGRIEEPEDVADVVVFLASDAARFMTGQGINVTGGVRMD 263
31 -81.9003tox_A mol:protein length:280 Short chain dehydrogenase  ali model follow..  29  3MSRLEGKIAIVTGASSGIGRAAALLFAREGAKVVVTARNGNALAELTDEIGGGGEAAALAGDVGDEALHEALVELAVRRFGGLDTAFNNAGAGAMGEISSLSVEGWRETLDTNLTSAFLAAKYQVPAIAALG-GGSLTFTSSFVGTAGFAGVAPYAASKAGLIGLVQALAVELGAR--GIRVNALLPGGTDTPANFANAAPETRGFVEGLHALKRIARPEEIAEAALYLASDGASFVTGAALLADGGASV. 255
32 -81.7003svt_A mol:protein length:281 Short-chain type dehydrogenase/reductase  ali model follow..  28  8..SFQDRTYLVTGGGSGIGKGVAAGLVAAGASVMIVGRNPDKLAGAVQELANGGAIRYEPTDITNEDETARAVDAVTAWHGRLHGVVHCAGGSEIGPITQVDSEAWRRTVDLNVNGTMYVLKHAAREMVRGG-GGSFVGISSIAASNTHRWFGAYGVTKSAVDHLMQLAADELGAS--WVRVNSIRPGLIRTDLVAAITESELSSDYAMCTPLPRQGEVEDVANMAMFLLSDAASFVTGQVINVDGGQMLR 259
33 -81.6004yqz_A mol:protein length:257 Putative oxidoreductase  ali model follow..  34  19..KLKGKKALVIAAGQGIGRAIAEAFQREGAEVLGATLHPEKLQGVVPAV---------RLDARDKEA----VFRLIQGLDRLDVLVNAQGVVPVGGLLEATDQDWEEAFLLNAKSVFWAMQAALPKMAAQG-GGSVINIASVAAFKTVPGRFIYSATKAALVAMTKAAALEFAPK--GVRVNAICPGTVDTPSLREAGGEEGLRAFAERQLLKRLGRPEEIAALAVYLASDEGAFATGSAFVVDGGMS.. 250
34 -81.5004wec_A mol:protein length:278 Short chain dehydrogenase  ali model follow..  35  19TQRLAGKVAVITGGASGIGLATGRRLRAEGATVVVGDIDPTTGKAAADEL----EGLFVPVDVSEQEAVDNLFDTAASTFGRVDIAFNNAGISPPEDIENTDLPAWQRVQDINLKSVYLSCRAALRHMVPAG-KGSIINTASFVAVMGSASQISYTASKGGVLAMSRELGVQYARQ--GIRVNALCPGPVNTPLLQELFDPERAARRLVHIPLGRFAEPEELAAAVAFLASDDASFITGSTFLVDGGISS. 266
35 -81.2004fn4_A mol:protein length:254 Short chain dehydrogenase  ali model follow..  29  3.QSLKNKVVIVTGAGSGIGRAIAKKFALNDSIVVAVELLEDRLNQIVQELGMGKEVLGVKADVSKKKDVEEFVRRTFETYSRIDVLCNNAGIMDVTPVAEVSDELWERVLAVNLYSAFYSSRAVIPIMLKQG-KGVIVNTASIAGIRGGFAGAPYTVAKHGLIGLTRSIAAHYGDQ--GIRAVAVLPGTVKTNIGLGSSKPSMRTLTKLMSLSSRLAEPEDIANVIVFLASDEASFVNGDAVVVDGGLTV. 253
36 -80.8004npc_A mol:protein length:265 Sorbitol dehydrogenase  ali model follow..  33  15..PLSEKVAIVTGGASGIGAAISKAFIAKGAKVAVLDISADIAKAKAEELG--ENAKPFVCDVSSQQSVNDAITAVISQFGKIDIAVNSAGVVYLAPAEDISLDYWDKTININLKGSFLVTQAVGRAMIAAGNGGKIINLASQAGTVAIEEHVAYCASKFGVIGMSKTFAAEWGK--YGICVNTLSPTIVLTELGKKAWAGEKGEAAKKRIPAGRFAYPEEIAAAAVFLASAGADMITGADLLIDGGYTI. 258
37 -80.7004e6p_A mol:protein length:259 Probable sorbitol dehydrogenase (L-iditol 2-d  ali model follow..  31  3MKRLEGKSALITGSARGIGRAFAEAYVREGATVAIADIDIERARQAAAEIG--PAAYAVQMDVTRQDSIDAAIAATVEHAGGLDILVNNAALFDLAPIVEITRESYEKLFAINVAGTLFTLQAAARQMIAQGRGGKIINMASQAGRRGEALVAIYCATKAAVISLTQSAGLDLIKH--RINVNAIAPGVVDGEHWDGVDAGEKKRLVGEAVPFGRMGTAEDLTGMAIFLASAESDYIVSQTYNVDGGNW.. 257
38 -80.5001ahh_A mol:protein length:255 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  29  8..RLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPF-DMPMADFRRAYELNVFSFFHLSQLVAPEMEKNG-GGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEK--NIRVNGIAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQE 253
39 -80.4003gaf_A mol:protein length:256 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  30  9..HLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDLKSEGAEAVAAAIRQGGKAIGLECNVTDEQHREAVIKAALDQFGKITVLVNNAGGGGPKPF-DMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAG-GGAILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPM--GIRVNAIAPGAIKTDALATVLTPEIERAMLKHTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGGGVQE 254
40 -80.1004gkb_A mol:protein length:258 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  28  4..NLQDKVVIVTGGASGIGGAISMRLAEERAIPVVFARHAPDGAFLDALAQRQPRATYLPVELQDDAQCRDAVAQTIATFGRLDGLVNNAGVND-GIGLDAGRDAFVASLERNLIHYYAMAHYCVPHLKAT--RGAIVNISSKTAVTGQGNTSGYCASKGAQLALTREWAVALREH--GVRVNAVIPAEVMTPLYRNWIAEAKLAEIAAKVPLGRFTTPDEIADTAVFLLSPRASHTTGEWLFVDGGYTH. 252
41 -79.8002ag5_A mol:protein length:246 dehydrogenase/reductase (SDR family) member 6  ali model follow..  29  2.GRLDGKVIILTAAAQGIGQAAALAFAREGAKVIATDINESK----LQELEKYPGIQTRVLDVTKKKQ----IDQFANEVERLDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQK-SGNIINMSSVASVKGVVNRCVYSTTKAAVIGLTKSVAADFIQQ--GIRCNCVCPGTVDTPSLQERIQEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIIDGGWS.. 244
42 -79.2003uxy_A mol:protein length:266 Short-chain dehydrogenase/reductase SDR  ali model follow..  29  19..GFEGKVALVTGAAGGIGGAVVTALRAAGARVAVADRAVAGIAA----------DLHLPGDLREAAYADGLPGAVAAGLGRLDIVVNNAGVISRGRITETTDADWSLSLGVNVEAPFRICRAAIPLMAAAG-GGAIVNVASCWGLRPGPGHALYCLTKAALASLTQCMGMDHAPQ--GIRINAVCPNEVNTPMLRTGDPDRAVAELGRTVPLGRIAEPEDIADVVLFLASDAARYLCGSLVEVNGGKAV. 259
43 -78.9003r1i_A mol:protein length:276 Short-chain type dehydrogenase/reductase  ali model follow..  33  23..DLSGKRALITGASTGIGKKVALAYAEAGAQVAVAARHSDALQVVADEIAGVGKALPIRCDVTQPDQVRGMLDQMTGELGGIDIAVCNAGIVSVQAMLDMPLEEFQRIQDTNVTGVFLTAQAAARAMVDQGLGGTIITTASMSGHIINIPVSHYCTSKAAVVHLTKAMAVELA--PHQIRVNSVSPGYIRTELVEPL--ADYHALWEPKIPLGRMGRPEELTGLYLYLASAASSYMTGSDIVIDGGYTC. 269
44 -78.2003wye_A mol:protein length:256 Diacetyl reductase [(S)-acetoin forming], L-2  ali model follow..  31  2.....KKVALVTGAGQGIGKAIALRLVKDGFAVAIADYNDATAKAVASEINQGGHAVAVKVDVSDRDQVFAAVEQARKTLGGFDVIVNNAGIAQIKPLLEVTEEDLKQIYSVNVFSVFFGIQAAVEAFKKEGHGGKIINAASIAAIQGFPILSAYSTTKFAVRGLTQTAARDLAPL--GITVNGYCPGIVGTGMWEQIDAEENFKEYSSSIALGRPSVPEDVAGLVSFLASPDSDYMTGQSLLIDGGMV.. 254
45 -78.0001geg_A mol:protein length:256 ACETOIN REDUCTASE  ali model follow..  32  2.....KKVALVTGAGQGIGKAIALRLVKDGFAVAIADYNDATAKAVASEINQGGHAVAVKVDVSDRDQVFAAVEQARKTLGGFDVIVNNAGVAPSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKEGHGGKIINACSQAGHVGNPELAVYSSSKFAVRGLTQTAARDLAPL--GITVNGYCPGIVKTPMWAEIDRQYGTAEFAKRITLGRLSEPEDVAACVSYLASPDSDYMTGQSLLIDGGMV.. 254
46 -77.9003o38_A mol:protein length:266 Short chain dehydrogenase  ali model follow..  25  18.GLLKGKVVLVTAAATGIGSTTARRALLEGADVVISDYHERRLGETRDQLADLGRVEAVVCDVTSTEAVDALITQTVEKAGRLDVLVNNAGLGGQTPVVDMTDEEWDRVLNVTLTSVMRATRAALRYFRGVDHGGVIVNNASVLGWRAQHSQSHYAAAKAGVMALTRCSAIEAVEF--GVRINAVSPSIARHKFLEKTSSSELLDRLASDEAFGRAAEPWEVAATIAFLASDYSSYMTGEVVSVSSQRA.. 266
47 -77.9003wtc_A mol:protein length:262 Putative oxidoreductase  ali model follow..  31  5..SLSGKIAAVTGAAQGIGKAIALRLAKDGADVILLDVKQDTLAETAKEVEAGRRAVALTADISNRDQFRSTLADAAKTLGGLDIMVNNAGICQVKPILDIEPAEIEKIFSINVQGVLWGMQAAATLFKEKGTKGKIINACSIAGHEGYPLLGAYSATKFAVRALTQSAAKELASS--GITVNSYCPGIVGTDMWVTIDKRATYKKYVEGIALGRVETADDVAGFVAYLSSSDADYMTGQSVLIDGGLVFR 262
48 -77.7003ndr_A mol:protein length:247 3-oxoacyl-(Acyl-carrier protein) reductase  ali model follow..  31  1TERLAGKTALVTGAAQGIGKAIAARLAADGATVIVSDINAEGAKAAAASIG--KKARAIAADISDPGSVKALFAEIQALTGGIDILVNNASIVPFVAWDDVDLDHWRKIIDVNLTGTFIVTRAGTDQMRAAGKAGRVISIASNTFFAGTPNMAAYVAAKGGVIGFTRALATELGKY--NITANAVTPGLIESDGVKASPHNEAFGFVEMLQAMKGKGQPEHIADVVSFLASDDARWITGQTLNVDAGMVRH 247
49 -77.6002y93_A mol:protein length:281 CIS-2,3-DIHYDROBIPHENYL-2,3-DIOL DEHYDROGENAS  ali model follow..  26  2..KLTGEVALITGGASGLGRALVDRFVAEGARVAVLDKSAERLRELEVAHG--GNAVGVVGDVRSLQDQKRAAERCLAAFGKIDTLIPNAGIWDYSTAEDKIDAAFDDIFHVNVKGYIHAVKACLPALVSS--RGSVVFTISNAGFYPNGGGPLYTATKHAVVGLVRQMAFELAP---HVRVNGVAPGGMNTDLRQSISSVPLADMLKSVLPIGRMPALEEYTGAYVFFATRGSLPATGALLNYDGGMGVR 258
50 -77.5003a28_C mol:protein length:258 L-2.3-butanediol dehydrogenase  ali model follow..  30  2.....SKVAMVTGGAQGIGRGISEKLAADGFDIAVADLQEEQAAETIKLIEADQKAVFVGLDVTDKANFDSAIDEAAEKLGGFDVLVNNAGIAQIKPLLEVTEEDLKQIYSVNVFSVFFGIQAASRKFDELGVKGKIINAASIAAIQGFPILSAYSTTKFAVRGLTQAAAQELAPK--GHTVNAYAPGIVGTGMWEQIDAEENFKEYSSSIALGRPSVPEDVAGLVSFLASENSNYVTGQVMLVDGGML.. 256
51 -77.4003ucx_A mol:protein length:264 Short chain dehydrogenase  ali model follow..  23  6GGLLTDKVVVISGVGPALGTTLARRCAEQGADLVLAARTVERLEDVAKQVTDGRRALSVGTDITDDAQVAHLVDETMKAYGRVDVVINNAFRVSMKPFANTTFEHMRDAIELTVFGALRLIQGFTPALEES--KGAVVNVNSMVVRHSQAKYGAYKMAKSALLAMSQTLATELGEK--GIRVNSVLPGYIWGGTLKSYFEEDIYNAAAAGSDLKRLPTEDEVASAILFMASDLASGITGQALDVNCG.... 260
52 -77.2001bdb_A mol:protein length:277 CIS-BIPHENYL-2,3-DIHYDRODIOL-2,3-DEHYDROGENAS  ali model follow..  24  2..KLKGEAVLITGGASGLGRALVDRFVAEGAKVAVLDKSAERLAELETDHG--DNVLGIVGDVRSLEDQKQAASRCVARFGKIDTLIPNAGIWDYSTAEESLDAAFDEVFHINVKGYIHAVKACLPALVAS--RGNVIFTISNAGFYPNGGGPLYTAAKHAIVGLVRELAFELAP---YVRVNGVGSGGINSDLRGPSSTVPLADMLKSVLPIGRMPEVEEYTGAYVFFATGDAAPATGALLNYDGGLGVR 258
53 -77.0003v8b_A mol:protein length:283 Putative dehydrogenase, possibly 3-oxoacyl-[a  ali model follow..  31  19..NQPSPVALITGAGSGIGRATALALAADGVTVGALGRTRTEVEEVADEIGAGGQAIALEADVSDELQMRNAVRDLVLKFGHLDIVVANAGIGVWAPIDDLKPFEWDETIAVNLRGTFLTLHLTVPYLKQRG-GGAIVVVSSINGTFTTPGATAYTATKAAQVAIVQQLALELGKH--HIRVNAVCPGAIETNISDNTKLRHEEETAIVPITDGQPGRSEDVAELIRFLVSERARHVTGSPVWIDGGQGL. 275
54 -77.0004lvu_A mol:protein length:279 Oxidoreductase, short chain dehydrogenase/red  ali model follow..  27  29...LAGRAVLITGGATGIGASFVEHFARQGARVAFVDLDEQAARALAARLADAHEPVFVACDLTDIAALRGAIEAIRARIGPIAALVNNAANDVRHAIADVTPDSFDACIAVNLRHQFFAAQAVIDDMKRLG-GGSIVNLGSISWMLKNAGYPVYASAKAAVQGLTRALARELGPF--GIRVNTLVPGWVMTDKQRRLLDDAGRAAIKAGQCIDAELLPGDLARMALFLAADDSRMITAQDVVVDGGWA.. 273
55 -76.8005er6_A mol:protein length:251 Oxidoreductase, short chain dehydrogenase/red  ali model follow..  27  3.ELLKEKLVLVTGAGRGLGAAISSGAAEQGARVILVDIDGTAAKAQADALTAGFVAEGHALDVTDRDAVAALADDILSRFGGLDVLVNNAGVAGRAAFQPEAVEVWDRVIGVNLEGAFNVSHALVPALKA--AKGNVVHLCSVAGFVSGGSTAGYVVSKGAIRSLTQVMARDLAPH--GIRVNAVAPGIMMSEMAVAQLNRPGTDWFMNRVMMKRIGETSEVVDPVVFLASPMASYITGTILPVDGGFLA. 250
56 -76.6001rwb_A mol:protein length:261 Glucose 1-dehydrogenase  ali model follow..  33  4..DLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVN--KEDEANSVLEEIKKGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTKTLALEYAPK--GIRVNNIGPGAINTPINAEKADPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMT.. 251
57 -76.6001g6k_A mol:protein length:261 GLUCOSE 1-DEHYDROGENASE  ali model follow..  33  4..DLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVN--KEDEANSVLEEIKKGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLANPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTETLALEYAPK--GIRVNNIGPGAINTPINAEKADPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMT.. 251
58 -76.5004egf_A mol:protein length:266 L-xylulose reductase  ali model follow..  29  17..RLDGKRALITGATKGIGADIARAFAAAGARLVLSGRDVSELDAARRALGEGTDVHTVAIDLAEPDAPAELARRAAEAFGGLDVLVNNAGISHPQPVVDTDPQLFDATIAVNLRAPALLASAVGKAMVAAGEGGAIITVASAAALAPLPDHYAYCTSKAGLVMATKVLARELG--PHGIRANSVCPTVVLTEMGQRVGDEAKSAPMIARIPLGRFAVPHEVSDAVVWLASDAASMINGVDIPVDGGYTM. 265
59 -76.4003aus_A mol:protein length:269 Glucose 1-dehydrogenase 4  ali model follow..  32  6..DLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVIN--NEEEALDAKKEVEEGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIKGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPK--GIRVNNIGPGAMNTPINAEKADPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQASYVTGITLFADGGMT.. 253
60 -76.1001spx_A mol:protein length:278 short-chain reductase family member (5L265)  ali model follow..  31  2.TRFAEKVAIITGSSNGIGRATAVLFAREGAKVTITGRHAERLEETRQQILAAGNVNSVVADVTTDAGQDEILSTTLGKFGKLDILVNNAGAAIPDSQSAQSIESYDATLNLNLRSVIALTKKAVPHLSSTK--GEIVNISSISGLHATPDFPYYSIAKAAIDQYTRNTAIDLIQH--GIRVNSISPGLVATGFGSAMGMPEETATMKECVPAGVMGQPQDIAEVIAFLADRKSSYIIGHQLVVDGGSSL. 264
61 -76.0004trr_A mol:protein length:269 Putative D-beta-hydroxybutyrate dehydrogenase  ali model follow..  28  4.SNLNGKTAVVTGAASGIGKEIALELAKAGAAVAIADLNQDGANAVADEINKGGKAIGVAMDVTNEEAVNTGIDKVAEAFGSVDILVSNAGIQIVNPIENYSFADWKKMQAIHVDGAFLTTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHGLLGLARVLAKEGAK--HNVRSHVVCPGFVRTPLVDKQIPEQAKELMLGNTVDGVFTTVQDVAQTVLFLSAFPSAALTGQSFIVSHGWFMQ 263
62 -76.0002gdz_A mol:protein length:267 NAD+-dependent 15-hydroxyprostaglandin dehydr  ali model follow..  28  2AHMVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALHEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGV--------NNEKNWEKTLQINLVSVISGTYLGLDYMSKQGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEEYKDHIKDMIKYYGILDPPLIANGLITLIEDDA--LNGAIMKITTSKGIH 254
63 -76.0004iuy_A mol:protein length:274 Short chain dehydrogenase/reductase  ali model follow..  26  19...VKDKYILITGASSGLGHHIAELFAKEGANIVICARRLERLKELESHIKNGVQVYTFALDVNDRSAVKDMLSSLEAEGVTIDVLINNAGVSDTKRFLDYNDEDWDKIVDTNLKAPWQCAQEVVQHMIKAERKGSIINITSILSQSTNLGVSPYCASKAGLRHLTEVMAVELAR--FGINVNAIAPGYMITEINEEYLTSEVGQQLLKKIPTRKFVEFDDLNGPLLLLASQAGQGITGIEIKVDGGHSA. 265
64 -76.0003qiv_A mol:protein length:253 short-chain dehydrogenase or 3-oxoacyl-[acyl-  ali model follow..  28  6..RFENKVGIVTGSGGGIGQAYAEALAREGAAVVVADINAEAAEAVAKQIADGGTAISVAVDVSDPESAKAMADRTLAEFGGIDYLVNNAAIFGGDFLLTIDPEYYKKFMSVNLDGALWCTRAVYKKMTKRG-GGAIVNQSSTAAWLYSNY---YGLAKVGINGLTQQLSRELGGR--NIRINAIAPGPIDTEANRTTTPKEMVDDIVKGLPLSRMGTPDDLVGMCLFLLSDEASWITGQIFNVDGGQIIR 252
65 -75.6004qec_A mol:protein length:248 ElxO  ali model follow..  31  2.....KKNVLITGGFKGIGKQVALEFLKNDYHVCITSRYFEKEKRIPHLFSSEENISFYQLDVTDEEQVNEIINKIVKKFGRLDVLVNNAGISLSDGLTETKTTDFNKMINTNILGTYFCMKYALKHMQKVS-CGAIVNISSITGLSGFPYSILYGSTKHAVIGLTKGAAVEFADK--GIKINAVAPGIIKTETLQKEIDEFSEDSISSIHPMQKLGTTLDVAKGIYFLANEDNNFITGHVLSIDGGYLSQ 248
66 -75.5001cyd_A mol:protein length:244 CARBONYL REDUCTASE  ali model follow..  29  4..NFSGLRALVTGAGKGIGRDTVKALHASGAKVVAVTRTNSDLVSLAKE---CPGIEPVCVDLGDWD----ATEKALGGIGPVDLLVNNAALVIMQPFLEVTKEAFDRSFSVNLRSVFQVSQMVARDMINRGVPGSIVNVSSMVAHVTFPNLITYSSTKGAMTMLTKAMAMELG--PHKIRVNSVNPTVVLTDMGKKVADPEFARKLKERHPLRKFAEVEDVVNSILFLLSDRSASTSGGGILVDAGYLAS 244
67 -75.5001xkq_A mol:protein length:280 short-chain reductase family member (5D234)  ali model follow..  32  2.PRFSNKTVIITGSSNGIGRTTAILFAQEGANVTITGRSSERLEETRQIILKSGQVNSVVADVTTEDGQDQIINSTLKQFGKIDVLVNNAGAAIPDAFTDQGIDIYHKTLKLNLQAVIEMTKKVKPHLVASK--GEIVNVSSIAGPQAQPDFLYYAIAKAALDQYTRSTAIDLAKF--GIRVNSVSPGMVETGFTNAMGMPDQAASHKECIPIGAAGKPEHIANIILFLADRNLSYILGQSIVADGGTSLV 265
68 -75.4001pr9_A mol:protein length:244 L-XYLULOSE REDUCTASE  ali model follow..  25  4..FLAGRRVLVTGAGKGIGRGTVQALHATGARVVAVSRTQADLDSLVRE---CPGIEPVCVDLGDWEA----TERALGSVGPVDLLVNNAAVALLQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLIARGVPGAIVNVSSQCSQRAVTNHSVYCSTKGALDMLTKVMALELG--PHKIRVNAVNPTVVMTSMGQATSDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEGGFWA. 243
69 -75.3005jla_A mol:protein length:274 Putative short-chain dehydrogenase/reductase  ali model follow..  28  6SAEFNGAIAVVTGAGSGIGRACAELLSRSGANVIVADRDIEAATRVARATG----GKTLVLDVGEDASVTAAANEVRARYGVADVLVNCAGVLQRTPPGELAQREWDVVSRIDLRGTYLCCAAFGAPMADRR-RGSIVNIASVAGMRSGPL-HAYGPAKAGVISLTETLAGEWGPK--GVRVNCVSPGFTQTPALERGTHTLKADVLRDAAALGHIVSANEIAEAVVFLASERASAITGVNLPVDAGYLI. 250
70 -75.1003ged_A mol:protein length:247 Short-chain dehydrogenase/reductase SDR  ali model follow..  26  2.....NRGVIVTGGGHGIGKQICLDFLEAGDKVCFIDIDEKRSADFAKE---RPNLFYFHGDVADPLTLKKFVEYAMEKLQRIDVLVNNACRGSKGILSSLLYEEFDYILSVGLKAPYELSRLCRDELIKN--KGRIINIASTRAFQSEPDSEAYASAKGGIVALTHALAMSLGP---DVLVNCIAPGWINVTEQQEFTQEDC-----AAIPAGKVGTPKDISNMVLFLCQQD--FITGETIIVDGGMSKR 232
71 -75.0003edm_A mol:protein length:259 Short chain dehydrogenase  ali model follow..  27  5..RFTNRTIVVAGAGRDIGRACAIRFAQEGANVVLT--AAEGAATAVAEIEKGRSALAIKADLTNAAEVEAAISAAADKFGEIHGLVHVAGLIARKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAK---GGAIVTFSSQAGRDGGPGALAYATSKGAVMTFTRGLAKEVGPK---IRVNAVCPGMISTTFHDTFTKPEVRERVAGATSLKREGSSEDVAGLVAFLASDDAAYVTGACYDINGGVL.. 249
72 -74.8004cql_A mol:protein length:261 ESTRADIOL 17-BETA-DEHYDROGENASE 8  ali model follow..  31  6QNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGRGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRH--GIRCNSVLPGFIATPMTQKV-PQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLF.. 260
73 -74.7002pd6_A mol:protein length:264 Estradiol 17-beta-dehydrogenase 8  ali model follow..  31  2QNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGRGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRH--GIRCNSVLPGFIATPMTQKV-PQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLF.. 256
74 -74.6002zat_A mol:protein length:260 Dehydrogenase/reductase SDR family member 4  ali model follow..  28  11..PLENKVALVTASTDGIGLAIARRLAQDGAHVVVSSRKQENVDRTVATLGEGLSVTGTVCHVGKAEDRERLVAMAVNLHGGVDILVSNAAVNFFGNIIDATEEVWDKILHVNVKATVLMTKAVVPEMEKRG-GGSVLIVSSVGAYHPFPNLGPYNVSKTALLGLTKNLAVELAPR--NIRVNCLAPGLIKTNFSQVLMDKARKEYMKESLRIRRLGNPEDCAGIVSFLCSEDASYITGETVVVGGGTASR 259
75 -74.5003lf1_A mol:protein length:265 Short Chain Oxidoreductase Q9HYA2  ali model follow..  28  6...LSEAVAVVTGGSSGIGLATVELLLEAGAAVAFCARDGERLRAAESALRQGARLFASVCDVLDALQVRAFAEACERTLGCASILVNNAGQGRVSTFAETTDEAWSEELQLKFFSVIHPVRAFLPQLESRA-DAAIVCVNSLLASQPEPHMVATSAARAGVKNLVRSMAFEFAPK--GVRVNGILIGLVESGQWRRRFEAREERARNKQIPLGRLGKPIEAARAILFLASPLSAYTTGSHIDVSGGLS.. 262

FFAS is supported by the NIH grant R01-GM087218-01
8 2 8 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Jaroszewski L, Godzik A. Clustering of highly homologous sequences to reduce the size of large protein databases. Bioinformatics. 2001 Mar;17(3):282-3.