current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

1nxqA
Query: 1nxq_A mol:protein length:251 R-alcohol dehydrogenase, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst SNRLDGKVAIITGGTLGIGLAIATKFVEEGAKVMITGRHSDVGEKAAKSVGTPDQIQFFQHDSSDEDGWTKLFDATEKAFGPVSTLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPSLGAYNASKGAVRIMSKSAALDCALKDYDVRVNTVHPGYIKTPLVDDLPGAEEAMSQRTKTPMGHIGEPNDIAYICVYLASNESKFATGSEFVVDGGYTAQLast
1 -105.0001nxq_A mol:protein length:251 R-alcohol dehydrogenase  ali model  100  1SNRLDGKVAIITGGTLGIGLAIATKFVEEGAKVMITGRHSDVGEKAAKSVGTPDQIQFFQHDSSDEDGWTKLFDATEKAFGPVSTLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPSLGAYNASKGAVRIMSKSAALDCALKDYDVRVNTVHPGYIKTPLVDDLPGAEEAMSQRTKTPMGHIGEPNDIAYICVYLASNESKFATGSEFVVDGGYTAQ 251
2 -95.9001hxh_A mol:protein length:253 3BETA/17BETA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  34  1TNRLQGKVALVTGGASGVGLEVVKLLLGEGAKVAFSDINEAAGQQLAAEL--GERSMFVRHDVSSEADWTLVMAAVQRRLGTLNVLVNNAGILLPGDMETGRLEDFSRLLKINTESVFIGCQQGIAAMKET--GGSIINMASVSSWLPIEQYAGYSASKAAVSALTRAAALSCRKQGYAIRVNSIHPDGIYTPMMQASLPKEMVLHDPKLNRAGRAYMPERIAQLVLFLASDESSVMSGSELHADNSILG. 250
3 -93.7003ndr_A mol:protein length:247 3-oxoacyl-(Acyl-carrier protein) reductase  ali model follow..  31  1TERLAGKTALVTGAAQGIGKAIAARLAADGATVIVSDINAEGAKAAAASI--GKKARAIAADISDPGSVKALFAEIQALTGGIDILVNNASIVPFVAWDDVDLDHWRKIIDVNLTGTFIVTRAGTDQMRAAGKAGRVISIASNTFFAGTPNMAAYVAAKGGVIGFTRALATELGKY--NITANAVTPGLIESDGVKASPHNEAFGFVEMLQAMKGKGQPEHIADVVSFLASDDARWITGQTLNVDAGMVRH 247
4 -92.4004dqx_A mol:protein length:277 Probable oxidoreductase protein  ali model follow..  31  18..DLNQRVCIVTGGGSGIGRATAELFAKNGAYVVVADVNEDAAVRVANEI--GSKAFGVRVDVSSAKDAESMVEKTTAKWGRVDVLVNNAGFGTTGNVVTIPEETWDRIMSVNVKGIFLCSKYVIPVMRRNG-GGSIINTTSYTATSAIADRTAYVASKGAISSLTRAMAMDHAKE--GIRVNAVAPGTIDSPYFTKIFAAKLRSDFNARAVMDRMGTAEEIAEAMLFLASDRSRFATGSILTVDGGSSI. 265
5 -92.1001hdc_A mol:protein length:254 3-ALPHA, 20 BETA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  38  1.NDLSGKTVIITGGARGLGAEAARQAVAAGARVVLADVLDEEGAATAREL--GDAARYQHLDVTIEEDWQRVVAYAREEFGSVDGLVNNAGISTGMFLETESVERFRKVVEINLTGVFIGMKTVIPAMKDAG-GGSIVNISSAAGLMGLALTSSYGASKWGVRGLSKLAAVELGTD--RIRVNSVHPGMTYTPMTAET-GIRQGEGNYPNTPMGRVGEPGEIAGAVVKLLSDTSSYVTGAELAVDGGWTT. 244
6 -92.0001nff_A mol:protein length:260 Putative oxidoreductase Rv2002  ali model follow..  41  2SGRLTGKVALVSGGARGMGASHVRAMVAEGAKVVFGDILDEEGKAMAAEL--ADAARYVHLDVTQPAQWKAAVDTAVTAFGGLHVLVNNAGILNIGTIEDYALTEWQRILDVNLTGVFLGIRAVVKPMKEAG-RGSIINISSIEGLAGTVACHGYTATKFAVRGLTKSTALELGPS--GIRVNSIHPGLVKTPMTDWVPED------IFQTALGRAAEPVEVSNLVVYLASDESSYSTGAEFVVDGGTVA. 240
7 -91.8003o38_A mol:protein length:266 Short chain dehydrogenase  ali model follow..  25  17HGLLKGKVVLVTAAATGIGSTTARRALLEGADVVISDYHERRLGETRDQLADLGRVEAVVCDVTSTEAVDALITQTVEKAGRLDVLVNNAGLGGQTPVVDMTDEEWDRVLNVTLTSVMRATRAALRYFRGVDHGGVIVNNASVLGWRAQHSQSHYAAAKAGVMALTRCSAIEAVEF--GVRINAVSPSIARHKFLEKTSSSELLDRLASDEAFGRAAEPWEVAATIAFLASDYSSYMTGEVVSVSSQRA.. 266
8 -91.7001k2w_A mol:protein length:256 SORBITOL DEHYDROGENASE  ali model follow..  28  2..RLDGKTALITGSARGIGRAFAEAYVREGARVAIADINLEAARATAAEI--GPAACAIALDVTDQASIDRCVAELLDRWGSIDILVNNAALFDLAPIVEITRESYDRLFAINVSGTLFMMQAVARAMIAGGRGGKIINMASQAGRRGEALVGVYCATKAAVISLTQSAGLNLIRH--GINVNAIAPGVVDGEHWDGVDAKEKKRQVGAAVPFGRMGRAEDLTGMAIFLATPEADYIVAQTYNVDGGNWMS 256
9 -91.5003gvc_A mol:protein length:277 Probable short-chain type dehydrogenase/reduc  ali model follow..  31  20..DLAGKVAIVTGAGAGIGLAVARRLADEGCHVLCADIDGDAADAAATKI--GCGAAACRVDVSDEQQIIAMVDACVAAFGGVDKLVANAGVVHLASLIDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERG-GGAIVNLSSLAGQVAVGGTGAYGMSKAGIIQLSRITAAELRSS--GIRSNTLLPAFVDTPMQQTAMAGAGGARSMIARLQGRMAAPEEMAGIVVFLLSDDASMITGTTQIADGGTIAA 269
10 -91.1002d1y_A mol:protein length:256 hypothetical protein TT0321  ali model follow..  34  2.GLFAGKGVLVTGGARGIGRAIAQAFAREGALVALCDLRPE-----GKEVAEAIGGAFFQVDLEDERERVRFVEEAAYALGRVDVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVG-GGAIVNVASVQGLFAEQENAAYNASKGGLVNLTRSLALDLAPL--RIRVNAVAPGAIATEAVLEAIAERTRRDWEDLHALRRLGKPEEVAEAVLFLASEKASFITGAILPVDGGMTAS 248
11 -91.0002cfc_A mol:protein length:250 2-(R)-HYDROXYPROPYL-COM DEHYDROGENASE  ali model follow..  33  2.....SRVAIVTGASSGNGLAIATRFLARGDRVAALDLSAETLEETARTHAYADKVLRVRADVADEGDVNAAIAATMEQFGAIDVLVNNAGITGNGVLHTTPVEQFDKVMAVNVRGIFLGCRAVLPHMLLQG-AGVIVNIASVASLVAFPGRSAYTTSKGAVLQLTKSVAVDYAGS--GIRCNAVCPGMIETPMTQWRLDPELRDQVLARIPQKEIGTAAQVADAVMFLAGEDATYVNGAALVMDGAYTA. 249
12 -90.4003AY6 Entity 1(prereleased)  ali follow..  32  6..DLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNEEEALDAKKEVEEGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIKGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPK--GIRVNNIGPGAMNTPINAEKFDPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQASYVTGITLFADGGMTK. 254
13 -90.4001ahh_A mol:protein length:255 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  29  8..RLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPF-DMPMADFRRAYELNVFSFFHLSQLVAPEMEKNG-GGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEK--NIRVNGIAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQE 253
14 -90.4003ak4_A mol:protein length:263 NADH-dependent quinuclidinone reductase  ali model follow..  29  9..DLSGRKAIVTGGSKGIGAAIARALDKAGATVAIADLDVMAAQAVVAGLENGGFA--VEVDVTKRASVDAAMQKAIDALGGFDLLCANAGVSTMRPAVDITDEEWDFNFDVNARGVFLANQIACRHFLASNTKGVIVNTASLAAKVGAPLLAHYSASKFAVFGWTQALAREMAPK--NIRVNCVCPGFVKTAMQERMTPEAVRAEYVSLTPLGRIEEPEDVADVVVFLASDAARFMTGQGINVTGGVRMD 263
15 -90.4003aus_A mol:protein length:269 Glucose 1-dehydrogenase 4  ali model follow..  32  6..DLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNEEEALDAKKEVEEGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIKGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPK--GIRVNNIGPGAMNTPINAEKFDPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQASYVTGITLFADGGMTK. 254
16 -90.2001g6k_A mol:protein length:261 GLUCOSE 1-DEHYDROGENASE  ali model follow..  33  4..DLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRKEDEANSVLEEIKKGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLANPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTETLALEYAPK--GIRVNNIGPGAINTPINAEKADPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMTQ. 252
17 -90.1001rwb_A mol:protein length:261 Glucose 1-dehydrogenase  ali model follow..  33  4..DLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRKEDEANSVLEEIKKGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTKTLALEYAPK--GIRVNNIGPGAINTPINAEKADPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMTL. 252
18 -90.0003gaf_A mol:protein length:256 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  30  9..HLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDLKSEGAEAVAAAIRQAGKAIGLECNVTDEQHREAVIKAALDQFGKITVLVNNAGGGGPKPF-DMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAG-GGAILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPM--GIRVNAIAPGAIKTDALATVLTPEIERAMLKHTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGGGVQE 254
19 -90.0003n74_A mol:protein length:261 3-ketoacyl-(acyl-carrier-protein) reductase  ali model follow..  33  4SMSLEGKVALITGAGSGFGEGMAKRFAKGGAKVVIVDRDKAGAERVAGEI--GDAALAVAADISKEADVDAAVEAALSKFGKVDILVNNAGIGHKPNAELVEPEEFDRIVGVNVRGVYLMTSKLIPHFKENGAKCVILNVASTGAGRPRPNLAWYNATKGWVVSVTKALAIELAPA--KIRVVALNPVAGETPLLTTFMGEEIRKKFRDSIPMGRLLKPDDLAEAAAFLCSPQASMITGVALDVDGGRSI. 256
20 -89.8001iy8_A mol:protein length:267 LEVODIONE REDUCTASE  ali model follow..  28  8TTRFTDRVVLITGGGSGLGRATAVRLAAEGAKLSLVDVSSEGLEASKAAVLETAEVLTTVADVSDEAQVEAYVTATTERFGRIDGFFNNAGIEKQNPTESFTAAEFDKVVSINLRGVFLGLEKVLKIMREQG-SGMVVNTASVGGIRGIGNQSGYAAAKHGVVGLTRNSAVEYGRY--GIRINAIAPGAIWTPMVENSMKRKAAEEFIQVNPSKRYGEAPEIAAVVAFLLSDDASYVNATVVPIDGGQSA. 265
21 -89.6001geg_A mol:protein length:256 ACETOIN REDUCTASE  ali model follow..  32  2.....KKVALVTGAGQGIGKAIALRLVKDGFAVAIADYNDATAKAVASEINQAGHAVAVKVDVSDRDQVFAAVEQARKTLGGFDVIVNNAGVAPSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKEGHGGKIINACSQAGHVGNPELAVYSSSKFAVRGLTQTAARDLAPL--GITVNGYCPGIVKTPMWAEIDRQYGTAEFAKRITLGRLSEPEDVAACVSYLASPDSDYMTGQSLLIDGGMVFN 256
22 -89.4001zem_A mol:protein length:262 xylitol dehydrogenase  ali model follow..  29  2SKKFNGKVCLVTGAGGNIGLATALRLAEEGTAIALLDMNREALEKAEASVREKGEARSYVCDVTSEEAVIGTVDSVVRDFGKIDFLFNNAGYQGAAPVQDYPSDDFARVLTINVTGAFHVLKAVSRQMITQNYG-RIVNTASMAGVKGPPNMAAYGTSKGAIIALTETAALDLAPY--NIRVNAISPGYMGPGFMWERQPKVVAQQMIGSVPMRRYGDINEIPGVVAFLLGDDSSFMTGVNLPIAGG.... 262
23 -89.4002zk7_A mol:protein length:257 Glucose 1-dehydrogenase related protein  ali model follow..  34  4FSDLRDKVVIVTGASMGIGRAIAERFVDEGSKVIDLSIHDPGE----------AKYDHIECDVTNPDQVKASIDHIFKEYGSISVLVNNAGIESYGKIESMSMGEWRRIIDVNLFGYYYASKFAIPYMIRSR-DPSIVNISSVQASIITKNASAYVTSKHAVIGLTKSIALDYAP---LLRCNAVCPATIDTPLVRKAAEEKKISEWGHEHPMQRIGKPQEVASAVAFLASREASFITGTCLYVDGGLSIR 250
24 -88.8002ew8_A mol:protein length:249 (S)-1-Phenylethanol dehydrogenase  ali model follow..  27  2TQRLKDKLAVITGGANGIGRAIAERFAVEGADIAIADLVPAPEAEAAIR-NLGRRVLTVKCDVSQPGDVEAFGKQVISTFGRCDILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWG-RIINLTSTTYWLKIEAYTHYISTKAANIGFTRALASDLGKD--GITVNAIAPSLVRTATTEASALSAMFDVLPNMLAIPRLQVPLDLTGAAAFLASDDASFITGQTLAVDGGMVRH 249
25 -88.6003uxy_A mol:protein length:266 Short-chain dehydrogenase/reductase SDR  ali model follow..  28  18.QGFEGKVALVTGAAGGIGGAVVTALRAAGARVAVADRAVAGIAA----------DLHLPGDLREAAYADGLPGAVAAGLGRLDIVVNNAGVISRGRITETTDADWSLSLGVNVEAPFRICRAAIPLMAAAG-GGAIVNVASCWGLRPGPGHALYCLTKAALASLTQCMGMDHAPQ--GIRINAVCPNEVNTPMLRTGFADRAVAELGRTVPLGRIAEPEDIADVVLFLASDAARYLCGSLVEVNGGKAV. 259
26 -88.0002dtd_A mol:protein length:264 Glucose 1-dehydrogenase related protein  ali model follow..  34  4.SDLRDKVVIVTGASMGIGRAIAERFVDEGSKVIDLSIHDPGE----------AKYDHIECDVTNPDQVKASIDHIFKEYGSISVLVNNAGIESYGKIESMSMGEWRRIIDVNLFGYYYASKFAIPYMIRSR-DPSIVNISSVQASIITKNASAYVTSKHAVIGLTKSIALDYAP---LLRCNAVCPATIDTPLVRKAAEEKKISEWGHEHPMQRIGKPQEVASAVAFLASREASFITGTCLYVDGGLSIR 249
27 -87.9001yde_A mol:protein length:270 Retinal dehydrogenase/reductase 3  ali model follow..  34  4GTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQE---LPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKS--QGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPY--GVRVNCISPGNIWTPLWEELAARASIREGMLAQPLGRMGQPAEVGAAAVFLASE-ANFCTGIELLVTGGAEL. 251
28 -87.7003a28_C mol:protein length:258 L-2.3-butanediol dehydrogenase  ali model follow..  30  2.....SKVAMVTGGAQGIGRGISEKLAADGFDIAVADLQEEQAAETIKLIEAADKAVFVGLDVTDKANFDSAIDEAAEKLGGFDVLVNNAGIAQIKPLLEVTEEDLKQIYSVNVFSVFFGIQAASRKFDELGVKGKIINAASIAAIQGFPILSAYSTTKFAVRGLTQAAAQELAPK--GHTVNAYAPGIVGTGMWEQIDAEENFKEYSSSIALGRPSVPEDVAGLVSFLASENSNYVTGQVMLVDGGMLYN 258
29 -87.6003tox_A mol:protein length:280 Short chain dehydrogenase  ali model follow..  28  4.SRLEGKIAIVTGASSGIGRAAALLFAREGAKVVVTARNGNALAELTDEIAGGGEAAALAGDVGDEALHEALVELAVRRFGGLDTAFNNAGAGAMGEISSLSVEGWRETLDTNLTSAFLAAKYQVPAIAALG-GGSLTFTSSFVGHTGFAGVAPYAASKAGLIGLVQALAVELGAR--GIRVNALLPGGTDTPANFANAAPETRGFVEGLHALKRIARPEEIAEAALYLASDGASFVTGAALLADGGASV. 255
30 -87.2003tsc_A mol:protein length:277 Putative oxidoreductase  ali model follow..  30  6AGKLEGRVAFITGAARGQGRAHAVRMAAEGADIIAVDISPDDLSETVRLVEAANRIVAAVVDTRDFDRLRKVVDDGVAALGRLDIIVANAGVAAPQAWDDITPEDFRDVMDINVTGTWNTVMAGAPRIIEGGRGGSIILISSAAGMKMQPFMIHYTASKHAVTGLARAFAAELGKH--SIRVNSVHPGPVNTPMGSGMETNPQLSHVLTPFLPDWVAEPEDIADTVCWLASDESRKVTAAQIPVDQGSTQ. 276
31 -87.1002q2q_A mol:protein length:255 Beta-D-hydroxybutyrate dehydrogenase  ali model follow..  33  2...LKGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDPA-PALAEIARHGVKAVHHPADLSDVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWG-RIINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATS--NVTCNAICPGWVLTPLVQKQIDQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGWLAQ 255
32 -87.1003tzq_B mol:protein length:271 Short-chain type dehydrogenase/reductase  ali model follow..  29  6TAELENKVAIITGACGGIGLETSRVLARAGARVVLADLPETDLAGAAASV--GRGAVHHVVDLTNEVSVRALIDFTIDTFGRLDIVDNNAAHSDDMLVTQMTVDVWDDTFTVNARGTMLMCKYAIPRLISAG-GGAIVNISSATAHAAYDMSTAYACTKAAIETLTRYVATQYGRH--GVRCNAIAPGLVRTPRLEVGLPQPIVDIFATHHLAGRIGEPHEIAELVCFLASDRAAFITGQVIAADSGLLAH 253
33 -86.9002zat_A mol:protein length:260 Dehydrogenase/reductase SDR family member 4  ali model follow..  28  11..PLENKVALVTASTDGIGLAIARRLAQDGAHVVVSSRKQENVDRTVATLQGEGSVTGTVCHVGKAEDRERLVAMAVNLHGGVDILVSNAAVNPFGNIIDATEEVWDKILHVNVKATVLMTKAVVPEMEKRG-GGSVLIVSSVGAYHPFPNLGPYNVSKTALLGLTKNLAVELAPR--NIRVNCLAPGLIKTNFSQVLMDKARKEYMKESLRIRRLGNPEDCAGIVSFLCSEDASYITGETVVVGGGTASR 259
34 -86.5001cyd_A mol:protein length:244 CARBONYL REDUCTASE  ali model follow..  29  4..NFSGLRALVTGAGKGIGRDTVKALHASGAKVVAVTRTNSDLVSLAKE---CPGIEPVCVDLGDWDA----TEKALGGIGPVDLLVNNAALVIMQPFLEVTKEAFDRSFSVNLRSVFQVSQMVARDMINRGVPGSIVNVSSMVAHVTFPNLITYSSTKGAMTMLTKAMAMELG--PHKIRVNSVNPTVVLTDMGKKVADPEFARKLKERHPLRKFAEVEDVVNSILFLLSDRSASTSGGGILVDAGYLAS 244
35 -86.5003VM3 Entity 1(prereleased)  ali follow..  33  10..RLDGQTALITGASAGIGLAIAHELAGFGADLMIVGRDIDMLETARDELLDQMQVHALAADVSDDEDRRQILDWVEDHSDGLHILVNNAGGNVTKAATEYSEDEWRKIFETNLFSAFELSRYAHPLLARHASS-SIVNVGSVSGLTHVRSGVVYGMSKAAMHQMTRNLAVEWAED--GIRVNAVAPWYIRTRRTSGPLDPDYYEEVINRTPMRRIGEPEEVAAAVGFLCLPAASYVTGECIAVDGGFLR. 258
36 -86.5002a4k_A mol:protein length:263 3-oxoacyl-[acyl carrier protein] reductase  ali model follow..  30  2.GRLSGKTILVTGAASGIGRAALDLFAREGASLVAVDREERLLAEAVAALE--AEAIAVVADVSDPKAVEAVFAEALEEFGRLHGVAHFAGVAHSALSWNLPLEAWEKVLRVNLTGSFLVARKAGEVLEE---GGSLVLTGSVAGL-GAFGLAHYAAGKLGVVGLARTLALELARK--GVRVNVLLPGLIQTPMTAGLP-PWAWEQEVGASPLGRAGRPEEVAQAALFLLSEESAYITGQALYVDGGRSI. 241
37 -86.5002ag5_A mol:protein length:246 dehydrogenase/reductase (SDR family) member 6  ali model follow..  29  2.GRLDGKVIILTAAAQGIGQAAALAFAREGAKVIATDINESKLQELEKYPG----IQTRVLDVTKKKQIDQFA----NEVERLDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQK-SGNIINMSSVASVKGVVNRCVYSTTKAAVIGLTKSVAADFIQQ--GIRCNCVCPGTVDTPSLQERIQEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIIDGGWSL. 245
38 -86.4001pr9_A mol:protein length:244 L-XYLULOSE REDUCTASE  ali model follow..  25  4..FLAGRRVLVTGAGKGIGRGTVQALHATGARVVAVSRTQADLDSLVRE---CPGIEPVCVDLGDWEA----TERALGSVGPVDLLVNNAAVALLQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLIARGVPGAIVNVSSQCSQRAVTNHSVYCSTKGALDMLTKVMALELG--PHKIRVNAVNPTVVMTSMGQATSDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEGGFWA. 243
39 -86.3002fwm_X mol:protein length:250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogena  ali model follow..  26  4..DFSGKNVWVTGAGKGIGYATALAFVEAGAKVTGFDQAFT---------QEQYPFATEVMDVADAAQVAQVCQRLLAETERLDALVNAAGILRMGATDQLSKEDWQQTFAVNVGGAFNLFQQTMNQFRRQR-GGAIVTVASDAAHTPRIGMSAYGASKAALKSLALSVGLELAGS--GVRCNVVSPGSTDTDMQRTLWVSDFGEQFKLGIPLGKIARPQEIANTILFLASDLASHITLQDIVVDGGSTL. 248
40 -86.3003r1i_A mol:protein length:276 Short-chain type dehydrogenase/reductase  ali model follow..  33  23..DLSGKRALITGASTGIGKKVALAYAEAGAQVAVAARHSDALQVVADEIAGVGKALPIRCDVTQPDQVRGMLDQMTGELGGIDIAVCNAGIVSVQAMLDMPLEEFQRIQDTNVTGVFLTAQAAARAMVDQGLGGTIITTASMSGHIINIPQSHYCTSKAAVVHLTKAMAVELAPH--QIRVNSVSPGYIRTELVEPL--ADYHALWEPKIPLGRMGRPEELTGLYLYLASAASSYMTGSDIVIDGGYTC. 269
41 -86.2003o4r_A mol:protein length:261 Dehydrogenase/reductase SDR family member 4  ali model follow..  29  12..PLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRG-GGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPR--NIRVNCLAPGLIKTSFSRMLMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPSR 260
42 -86.1003lf1_A mol:protein length:265 Short Chain Oxidoreductase Q9HYA2  ali model follow..  27  5..DLSEAVAVVTGGSSGIGLATVELLLEAGAAVAFCARDGERLRAAESALRQGARLFASVCDVLDALQVRAFAEACERTLGCASILVNNAGQGRVSTFAETTDEAWSEELQLKFFSVIHPVRAFLPQLESRA-DAAIVCVNSLLASQPEPHMVATSAARAGVKNLVRSMAFEFAPK--GVRVNGILIGLVESGQWRRRFEATAQLARNKQIPLGRLGKPIEAARAILFLASPLSAYTTGSHIDVSGGLSRH 264
43 -86.0003v8b_A mol:protein length:283 Putative dehydrogenase, possibly 3-oxoacyl-[a  ali model follow..  30  19..NQPSPVALITGAGSGIGRATALALAADGVTVGALGRTRTEVEEVADEIVGGGQAIALEADVSDELQMRNAVRDLVLKFGHLDIVVANAGINGVAPIDDLKPFEWDETIAVNLRGTFLTLHLTVPYLKQRG-GGAIVVVSSINGTFTTPGATAYTATKAAQVAIVQQLALELGKH--HIRVNAVCPGAIETNISDNTKLRHEEEKGQVPITDGQPGRSEDVAELIRFLVSERARHVTGSPVWIDGGQGL. 275
44 -85.8003oic_A mol:protein length:258 Enoyl-[acyl-carrier-protein] reductase [NADPH  ali model follow..  22  2...EQNKCALVTGSSRGVGKAAAIRLAENGYNIVINYASKKAALETAEEIEKLGKVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKNG-GGHIVSISSLGSIRYLENYTTVGVSKAALEALTRYLAVELSPK--QIIVNAVSGGAIDTDALKHFPNEDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSKADMIRGQTIIVDGGRSL. 248
45 -85.7003pk0_A mol:protein length:262 Short-chain dehydrogenase/reductase SDR  ali model follow..  29  7..DLQGRSVVVTGGTKGIGRGIATVFARAGANVAVAGRSTADIDACVADLDQSGKVIGVQTDVSDRAQCDALAGRAVEEFGGIDVVCANAGVFPDAPLATMTPEQLNGIFAVNVNGTFYAVQACLDALIASGSG-RVVLTSSITGITGYPGWSHYGATKAAQLGFMRTAAIELAPH--KITVNAIMPGNIMTEGLLEN-GEEYIASMARSIPAGALGTPEDIGHLAAFLATKEAGYITGQAIAVDGGQVL. 253
46 -85.7003pgx_A mol:protein length:280 carveol dehydrogenase  ali model follow..  25  10AGSLQGRVAFITGAARGQGRSHAVRLAAEGADIIACDISPEDLDETARLVEDQGKALTRVLDVRDDAALRELVADGMEQFGRLDVVVANAGVLSWGRVWELTDEQWDTVIGVNLTGTWRTLRATVPAMIEAGNGGSIVVVSSSAGLKATPGNGHYSASKHGLTALTNTLAIELGEY--GIRVNSIHPYSVETPMIEPEAPSFVHSFPPMPVQPNGFMTADEVADVVAWLAGDGSGTLTGTQIPVDKGALK. 279
47 -85.6003v2h_A mol:protein length:281 D-beta-hydroxybutyrate dehydrogenase  ali model follow..  31  16..SMMTKTAVITGSTSGIGLAIARTLAKAGANIVLNGFGPDEIRTVTDEVAGSGTVLHHPADMTKPSEIADMMAMVADRFGGADILVNNAGVQFVEKIEDFPVEQWDRIIAVNLSSSFHTIRGAIPPMKKKGWG-RIINIASAHGLVASPFKSAYVAAKHGIMGLTKTVALEVAES--GVTVNSICPGYVLTPLVEKQIPDQANEVMLKGQPTKKFITVEQVASLALYLAGDDAAQITGTHVSMDGGWTAQ 275
48 -85.6001xq1_A mol:protein length:266 PUTATIVE TROPINONE REDUCATSE  ali model follow..  28  11..SLKAKTVLVTGGTKGIGHAIVEEFAGFGAVIHTCARNEYELNECLSKWQKKGQVTGSVCDASLRPEREKLMQTVSSMFGKLDILINNLGAIRSKPTLDYTAEDFSFHISTNLESAYHLSQLAHPLLKASGCG-NIIFMSSIAGVVSASVGSIYSATKGALNQLARNLACEWASD--GIRANAVAPAVIATPLAEAVYDDEFKKVVISRKPLGRFGEPEEVSSLVAFLCMPAASYITGQTICVDGGLTVN 258
49 -85.6001i01_A mol:protein length:244 BETA-KETOACYL [ACP] REDUCTASE  ali model follow..  29  2..NFEGKIALVTGASRGIGRAIAETLAARGAKVIGTATSENGAQAISDYL--GANGKGLMLNVTDPASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHG-RIITIGSVVGTMGNGGQANYAAAKAGLIGFSKSLAREVASR--GITVNVVAPGFIETDMTRAL-SDDQRAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGMYM. 243
50 -85.5001wmb_A mol:protein length:260 D(-)-3-hydroxybutyrate dehydrogenase  ali model follow..  33  2...LKGKVAVVTGSTSGIGLGIATALAAQGADIVLNGFGDAAEIEKVRA-QHGVKVLYDGADLSKGEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFG-RIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQ--GITANAICPGWVRTPLVEKQQETAARELLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGWTAR 260
51 -85.4003rro_A mol:protein length:251 3-ketoacyl-(acyl-carrier-protein) reductase  ali model follow..  32  9..NLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYL--GDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQG-RIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASR--GVTVNTVAPGFIETDMTKAL-NDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYM. 250
52 -85.4003qiv_A mol:protein length:253 short-chain dehydrogenase or 3-oxoacyl-[acyl-  ali model follow..  28  6..RFENKVGIVTGSGGGIGQAYAEALAREGAAVVVADINAEAAEAVAKQIVAGGTAISVAVDVSDPESAKAMADRTLAEFGGIDYLVNNAAIMKLDFLLTIDPEYYKKFMSVNLDGALWCTRAVYKKMTKRG-GGAIVNQSSTAAWLY---SNYYGLAKVGINGLTQQLSRELGGR--NIRINAIAPGPIDTEANRTTTPKEMVDDIVKGLPLSRMGTPDDLVGMCLFLLSDEASWITGQIFNVDGGQIIR 252
53 -85.3003awd_A mol:protein length:260 Putative polyol dehydrogenase  ali model follow..  31  10..RLDNRVAIVTGGAQNIGLACVTALAEAGARVIIADLDEAMATKAVEDLRMEGDVSSVVMDVTNTESVQNAVRSVHEQEGRVDILVACAGICSEVKAEDMTDGQWLKQVDINLNGMFRSCQAVGRIMLEQKQG-VIVAIGSMSGLIVNQQQAAYNASKAGVHQYIRSLAAEWAPH--GIRANAVAPTYIETTLTRFGMEKELYDAWIAGTPMGRVGQPDEVASVVQFLASDAASLMTGAIVNVDAGFTV. 259
54 -85.2001uls_A mol:protein length:245 putative 3-oxoacyl-acyl carrier protein reduc  ali model follow..  30  2..RLKDKAVLITGAAHGIGRATLELFAKEGARLVACDIEEGPLREAAEAVG----AHPVVMDVADPASVERGFAEALAHLGRLDGVVHYAGITRDNFHWKMPLEDWELVLRVNLTGSFLVAKAASEAMREKNPG-SIVLTASRVYL-GNLGQANYAASMAGVVGLTRTLALELGRW--GIRVNTLAPGFIETRMTAKVP-EKVREKAIAATPLGRAGKPLEVAYAALFLLSDESSFITGQVLFVDGGRTI. 240
55 -85.2002yz7_A mol:protein length:260 D-3-hydroxybutyrate dehydrogenase  ali model follow..  33  2...LKGKKAVVTGSTSGIGLAMATELAKAGADVVINGFGQPEDIERERS-KFGVKAYYLNADLSDAQATRDFIAKAAEALGGLDILVNNAGIQHTAPIEEFPVDKWNAIIALNLSAVFHGTAAALPIMQKQGWG-RIINIASAHGLVASVNKSAYVAAKHGVVGLTKVTALENAGK--GITCNAICPGWVRTPLVEKQIEAAARELLAEKQPSLQFVTPEQLGGAAVFLSSAAADQMTGTTLSLDGGWTAR 260
56 -85.1003lyl_A mol:protein length:247 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  33  2..SLNEKVALVTGASRGIGFEVAHALASKGATVVGTATSQASAEKFENSMKEKGKARGLVLNISDIESIQNFFAEIKAENLAIDILVNNAGITRDNLMMRMSEDEWQSVINTNLSSIFRMSKECVRGMMKKRWG-RIISIGSVVGSAGNPGQTNYCAAKAGVIGFSKSLAYEVASR--NITVNVVAPGFIATDMTDKL-TDEQKSFIATKIPSGQIGEPKDIAAAVAFLASEEAKYITGQTLHVNGGMYM. 246
57 -85.1003vc7_A mol:protein length:254 Putative oxidoreductase  ali model follow..  29  2VGNYQGKKAIVIGGTHGMGLATVRRLVEGGAEVLLTGRNESNIARIREEF--GPRVHALRSDIADLNEIAVLGAAAGQTLGAIDLLHINAGVSELEPFDQVSEASYDRQFAVNTKGAFFTVQRLTPLIRE---GGSIVFTSSVADEGGHPGMSVYSASKAALVSFASVLAAELLPR--GIRVNSVSPGFIDTPTKGVAERAEFKTLGDNITPMKRNGTADEVARAVLFLAFE-ATFTTGAKLAVDGGLGQK 249
58 -85.0003sju_A mol:protein length:279 Keto reductase  ali model follow..  27  13SHMSRPQTAFVTGVSSGIGLAVARTLAARGIAVYGCARDAKNVSAAVDGLRAAGDVDGSSCDVTSTDEVHAAVAAAVERFGPIGILVNSAGRNGGGETADLDDALWADVLDTNLTGVFRVTREVLRAGMREAGWGRIVNIASTGGKQGVMYAAPYTASKHGVVGFTKSVGFELAKT--GITVNAVCPGYVETPMAERVTEQEVHERFNAKIPLGRYSTPEEVAGLVGYLVTDAAASITAQALNVCGGLGN. 272
59 -84.9003svt_A mol:protein length:281 Short-chain type dehydrogenase/reductase  ali model follow..  29  8..SFQDRTYLVTGGGSGIGKGVAAGLVAAGASVMIVGRNPDKLAGAVQELEALGAIRYEPTDITNEDETARAVDAVTAWHGRLHGVVHCAGGSENGPITQVDSEAWRRTVDLNVNGTMYVLKHAAREMVRGG-GGSFVGISSIAASNTHRWFGAYGVTKSAVDHLMQLAADELGAS--WVRVNSIRPGLIRTDLVAAITEAELSSDYAMCTPLPRQGEVEDVANMAMFLLSDAASFVTGQVINVDGGQMLR 259
60 -84.9003ucx_A mol:protein length:264 Short chain dehydrogenase  ali model follow..  23  6GGLLTDKVVVISGVGPALGTTLARRCAEQGADLVLAARTVERLEDVAKQVTDTGRALSVGTDITDDAQVAHLVDETMKAYGRVDVVINNAFVPSMKPFANTTFEHMRDAIELTVFGALRLIQGFTPALEES--KGAVVNVNSMVVRHSQAKYGAYKMAKSALLAMSQTLATELGEK--GIRVNSVLPGYIWGGTLKSYFEEDIYNAAAAGSDLKRLPTEDEVASAILFMASDLASGITGQALDVNCGEYK. 263
61 -84.7003ai1_A mol:protein length:263 NADPH-sorbose reductase  ali model follow..  28  4..GISGKVAVITGSSSGIGLAIAEGFAKEGAHIVLVARQVDRLHEAARSLKEGVRVLEVAVDVATPEGVDAVVESVRSSFGGADILVNNAGTGSNETIMEAADEKWQFYWELHVMAAVRLARGLVPGMRARG-GGAIIHNASICAVQPLWYEPIYNVTKAALMMFSKTLATEVIKD--NIRVNCINPGLILTPDWIKTAKGYLQSVADEHAPIKRFASPEELANFFVFLCSERATYSVGSAYFVDGGMLK. 261
62 -84.7001ae1_A mol:protein length:273 TROPINONE REDUCTASE-I  ali model follow..  31  18..SLKGTTALVTGGSKGIGYAIVEELAGLGARVYTCSRNEKELDECLEIWREKGNVEGSVCDLLSRTERDKLMQTVAHVFGKLNILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAAYHLSQIAYPLLKASQNG-NVIFLSSIAGFSALPSVSLYSASKGAINQMTKSLACEWAKD--NIRVNSVAPGVILTPLVETAIKKEEIDNFIVKTPMGRAGKPQEVSALIAFLCFPAASYITGQIIWADGGFTAN 270
63 -84.7003enn_A mol:protein length:249 GLUCOSE/RIBITOL DEHYDROGENASE  ali model follow..  34  7..DLTGRKALVTGATGGLGEAIARALHAQGAIVGLHGTREEKLKELAAEL--GERIFVFPANLSDREAVKALGQKAEEEMGGVDILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMRRRNG-RIINITSIVGVTGNPGQANYCASKAGLIGFSKSLAQEIASR--NVTVNCIAPGFIESAMTGKL-NEKQKDAIMGNIPMKRMGVGADIAAAVVYLASDEAAYVTGQTLHVNGGMAM. 248
64 -84.7002bgk_A mol:protein length:278 RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE  ali model follow..  32  11TNRLQDKVAIITGGAGGIGETTAKLFVRYGAKVVIADIADDHGQKVCNNIGSPDVISFVHCDVTKDEDVRNLVDTTIAKHGKLDIMFGNVGVTTPYSILEAGNEDFKRVMDINVYGAFLVAKHAARVMIPAK-KGSIVFTASISSFTAGEGVSVYTATKHAVLGLTTSLCTELGEY--GIRVNCVSPYIVASPLLTDVFGVDEELAHQAANLKGTLLRAEDVADAVAYLAGDESKYVSGLNLVIDGGYTR. 264
65 -84.2002ae1_A mol:protein length:260 TROPINONE REDUCTASE-II  ali model follow..  26  6..NLEGCTALVTGGSRGIGYGIVEELASLGASVYTCSRNQKELNDCLTQWRSKGKVEASVCDLSSRSERQELMNTVANHFGKLNILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERG-NVVFISSVSGALAVPYEAVYGATKGAMDQLTRCLAFEWAKD--NIRVNGVGPGVIATSLVEMTIQDENLNKLIDRCALRRMGEPKELAAMVAFLCFPAASYVTGQIIYVDGGLMAN 257
66 -84.1004DBZ Entity 1(prereleased)  ali follow..  27  16.ATQDSEVALVTGATSGIGLEIARRLGKEGLRVFVCARGEEGLRTTLKELREAGEADGRTCDVRSVPEIEALVAAVVERYGPVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAGMLERGTGRIVNIASTGGKQGLVHAAPYSASKHGVVGFTKALGLELART--GITVNAVCPGFVETPMAASVREEEAFDRITARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGGLGN. 274
67 -84.1001w4z_A mol:protein length:281 KETOACYL REDUCTASE  ali model follow..  28  16.ATQDSEVALVTGATSGIGLEIARRLGKEGLRVFVCARGEEGLRTTLKELREAGEADGRTCDVRSVPEIEALVAAVVERYGPVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTG-RIVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELART--GITVNAVCPGFVETPMAASVREEEAFDRITARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGGLGN. 274
68 -84.1003uve_A mol:protein length:286 Carveol dehydrogenase ((+)-trans-carveol dehy  ali model follow..  27  6TGRVEGKVAFVTGAARGQGRSHAVRLAQEGADIIAVDITPEDLAETADLVKGHNRIVTAEVDVRDYDALKAAVDSGVEQLGRLDIIVANAGIGNGGTLDKTSEEDWTEMIDINLAGVWKTVKAGVPHMIAGGRGGSIILTSSVGGLKAYPHTGHYVAAKHGVVGLMRAFGVELGQH--MIRVNSVHPTHVKTPMLHNEGDMAPICQMFHTLPIPW-VEPIDISNAVLFFASDEARYITGVTLPIDAGSCLK 286
69 -83.9003gk3_A mol:protein length:269 Acetoacetyl-CoA reductase  ali model follow..  26  17...QAKRVAFVTGGMGGLGAAISRRLHDAGMAVAVSHSRNDHVSTWLMHERDAGDFKAYAVDVADFESCERCAEKVLADFGKVDVLINNAGITRDATFMKMTKGDWDAVMRTDLDAMFNVTKQFIAGMVERRFG-RIVNIGSVNGSRGAFGQANYASAKAGIHGFTKTLALETAKR--GITVNTVSPGYLATAMVEAVPQDVLEAKILPQIPVGRLGRPDEVAALIAFLCSDDAGFVTGADLAINGGMHM. 262
70 -83.5003cxr_A mol:protein length:291 Dehydrogenase with different specificities  ali model follow..  31  25..SLKGKIALVTGASYGIGFAIASAYAKAGATIVFNDINQELVDRGMAAYKAAGNAHGYVCDVTDEDGIQAMVAQIESEVGIIDILVNNAGIIRRVPMIEMTAAQFRQVIDIDLNAPFIVSKAVIPSMIKKGHG-KIINICSMMSELGRETVSAYAAAKGGLKMLTKNIASEYGEA--NIQCNGIGPGYIATPQTAPLRELQKDQFIIAKTPAARWGEAEDLMGPAVFLASDASNFVNGHILYVDGGILA. 277
71 -83.5002p68_A mol:protein length:248 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  31  4..KLQGKVSLVTGSTRGIGRAIAEKLASAGSTVIITGTSGERAKAVAEEIKYGVKAHGVEMNLLSEESINKAFEEIYNLVDGIDILVNNAGITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQRWG-RIVNISSVVGFTGNVGQVNYSTTKAGLIGFTKSLAKELAPR--NVLVNAVAPGFIETDMTAVL-SEEIKQKYKEQIPLGRFGSPEEVANVVLFLCSELASYITGEVIHVNGGM... 247
72 -83.5003grp_A mol:protein length:266 3-oxoacyl-(Acyl carrierprotein) reductase  ali model follow..  33  18..KLTGRKALVTGATGGIGEAIARCFHAQGAIVGLHGTREDKLKEIAADL--GKDVFVFSANLSDRKSIKQLAEVAEREMEGIDILVNNAGITRDGLFVRMQDQDWDDVLAVNLTAASTLTRELIHSMMRRRYG-RIINITSIVGVVGNPGQTNYCAAKAGLIGFSKALAQEIASR--NITVNCIAPGFIKSAMTDKL-NEKQKEAIMAMIPMKRMGIGEEIAFATVYLASDEAAYLTGQTLHINGGMAM. 259
73 -83.4001h5q_A mol:protein length:265 NADP-DEPENDENT MANNITOL DEHYDROGENASE  ali model follow..  28  11..SFVNKTIIVTGGNRGIGLAFTRAVAAAGANVAVIYRSAADAVEVTEKVGKGVKTKAYQCDVSNTDIVTKTIQQIDADLGPISGLIANAGVSVVKPATELTHEDFAFVYDVNVFGVFNTCRAVAKLWLQKQQKGSIVVTSSMSSLNGSLTQVFYNSSKAACSNLVKGLAAEWASA--GIRVNALSPGYVNTDQTAHM-DKKIRDHQASNIPLNRFAQPEEMTGQAILLLSDHATYMTGGEYFIDGGQLI. 264
74 -83.2003ftp_A mol:protein length:270 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  31  20...LDKQVAIVTGASRGIGRAIALELARRGAMVIGTATTEAGAEGIGAAFKQAGEGRGAVLNVNDATAVDALVESTLKEFGALNVLVNNAGITQDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKARGG-RIVNITSVVGSAGNPGQVNYAAAKAGVAGMTRALAREIGSR--GITVNCVAPGFIDTDMTKGL-PQEQQTALKTQIPLGRLGSPEDIAHAVAFLASPQAGYITGTTLHVNGGMFM. 263
75 -83.0003imf_A mol:protein length:257 Short chain dehydrogenase  ali model follow..  31  1SNAMKEKVVIITGGSSGMGKGMATRFAKEGARVVITGRTKEKLEEAKLEIEQPGQILTVQMDVRNTDDIQKMIEQIDEKFGRIDILINNAAGNFICPAEDLSVNGWNSVINIVLNGTFYCSQAIGKYWIEKGIKGNIINMVATYAWDAGPGVIHSAAAKAGVLAMTKTLAVEWGRK-YGIRVNAIAPGPIERTGGADWISEEMAKRTIQSVPLGRLGTPEEIAGLAYYLCSDEAAYINGTCMTMDGGQHLH 253

FFAS is supported by the NIH grant R01-GM087218-01
6 1 2 3 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.