current user: public

Query: 1nw2_A mol:protein length:105 THIOREDOXIN, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
36 -61.8001m7t_A mol:protein length:107 Chimera of Human and E. coli thioredoxin  ali model follow..  35  2.VKQIESKTAFQEAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSN-VIFLEVDVDDAQDVAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL. 106
43 -58.5002dj0_A mol:protein length:137 Thioredoxin-related transmembrane protein 2  ali model follow..  18  8YIKYFNDKTIDEELDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNTGLNFGKVDVGRYTDVSTRYKVKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSE.. 119
49 -56.8003dxb_A mol:protein length:222 thioredoxin N-terminally fused to Puf60(UHM)  ali model follow..  48  7KIIHLTDDSFDDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL. 111
63 -53.5002diz_A mol:protein length:117 Thioredoxin domain-containing protein 5  ali model follow..  26  8TVLALTENNFDDTI-AEGITFIKFYAPWCGHCKTLAPTWEELSKKELAGVKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSLHRFVLSQAK 114

FFAS is supported by the NIH grant R01-GM087218-01
6 1 9 0 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab

Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Bourne PE, Allerston CK, Krebs W, Li W, Shindyalov IN, Godzik A.,Friedberg I, Liu T, Wild D, Hwang S, Ghahramani Z, Chen L, Westbrook J. The status of structural genomics defined through the analysis of current targets and structures. Pac Symp Biocomput. 2004;:375-86.