current user: public

anford Burnham Prebys Medical Discovery Institute

Query: 1nw2_A mol:protein length:105 THIOREDOXIN, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
45 -60.4001m7t_A mol:protein length:107 Chimera of Human and E. coli thioredoxin  ali model follow..  34  2.VKQIESKTAFQEAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVI-FLEVDVDDAQDVAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL. 106
54 -54.5002dj0_A mol:protein length:137 Thioredoxin-related transmembrane protein 2  ali model follow..  20  9.IKYFNDKTIDEELERDKTWIVEFFANWSNDCQSFAPIYADLSLKYNTGLNFGKVDVGRYTDVSTRYKVKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEEN 121
55 -53.3003p2a_A mol:protein length:148 Putative thioredoxin-like protein  ali model follow..  36  41..INATAETLDKLLQDDLPMVIDFWAPWCGPCRSFAPIFAETAAERAGKVRFVKVNTEAEPALSTRFRIRSIPTIMLYRNGKMIDMLNGAVPKAPFDNWLDEQLS 143
68 -48.0002oe0_A mol:protein length:114 Thioredoxin-3  ali model follow..  34  13.....NLTEFRNLIKQNDKLVIDFYATWCGPCKMMQPHLTKLIQAYPD-VRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPTA........... 100

FFAS is supported by the NIH grant R01-GM087218-01
9 5 7 1 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;