current user: public




Query: 1nw2_A mol:protein length:105 THIOREDOXIN, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst ATMTLTDANFQQAIQGDKPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGEPVKQLIGYQPKEQLEAQLADVLQLast
1 -78.9001nw2_A mol:protein length:105 THIOREDOXIN  ali model  100  1ATMTLTDANFQQAIQGDKPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGEPVKQLIGYQPKEQLEAQLADVLQ 105
2 -78.6001nsw_A mol:protein length:105 THIOREDOXIN  ali model follow..  98  1ATMTLTDANFQQAIQGDGPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGRPVKQLIGYQPKEQLEAQLADVLQ 105
3 -77.5002cvk_A mol:protein length:110 Thioredoxin  ali model follow..  50  3KPIEVTDQNFDETLGQHPLVLVDFWAEWCAPCRMIAPILEEIAKEYEGKLLVAKLDVDENPKTAMRYRVMSIPTVILFKDGQPVEVLVGAQPKRNYQAKIEKHLP 107
4 -75.7003tco_A mol:protein length:109 Thioredoxin (TrxA-1)  ali model follow..  36  5VTLVLTEENFDEVIRNNKLVLVDCWAEWCAPCHLYEPIYKKVAEKYKGKAVFGRLNVDENQKIADKYSVLNIPTTLIFVNGQLVDSLVGAVDEDTLESTVNKYLK 109
5 -75.1003dyr_A mol:protein length:111 Thioredoxin-1  ali model follow..  47  5.IIHLTDDSFDDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGTPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 109
6 -75.1001dby_A mol:protein length:107 CHLOROPLAST THIOREDOXIN M CH2  ali model follow..  42  2EAGAVNDDTFKVVLESSVPVLVDFWAPWCGPCRIIAPVVDEIAGEYKDKLKCVKLNTDESPNVASEYGIRSIPTIMVFKGGKKCETIIGAVPKATIVQTVEKYLN 107
7 -75.1002yj7_A mol:protein length:106 LPBCA THIOREDOXIN  ali model follow..  55  2SVIEVTDENFEEVLKSDKPVLVDFWAPWCGPCRMIAPIIEELAKEYEGKVKVVKVNVDENPNTAAQYGIRSIPTLLLFKNGQVVDRLVGAQPKEALKERIDKHL. 106
8 -75.0004ba7_A mol:protein length:106 LBCA THIOREDOXIN  ali model follow..  56  2SVIEINDENFEEVLKSDKPVLVDFWAPWCGPCRMIAPIIEELAEEYEGKVKFAKVNVDENPETAAKYGIMSIPTLLLFKNGEVVDKLVGARPKEALKERIEKHL. 106
9 -74.9002eir_A mol:protein length:108 Thioredoxin 1  ali model follow..  48  4.IIHLTDDSFDDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKCFLDCNL. 107
10 -74.8001srx_A mol:protein length:108 THIOREDOXIN  ali model follow..  46  4.IIHLTDDSFDDLVKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYIERGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL. 107
11 -74.8001txx_A mol:protein length:108 PROTEIN (THIOREDOXIN)  ali model follow..  46  4.IIHLTDDSFDDVLKADGAILVDFWAEWCVWCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL. 107
12 -74.8001keb_A mol:protein length:108 Thioredoxin 1  ali model follow..  46  4.IIHLTDDSFDDVLKADGAILVDFWAEWCGPCKLIASILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 108
13 -74.8002yn1_A mol:protein length:106 LGPCA THIOREDOXIN  ali model follow..  50  2SIIHVTDDSFDDVLKADKPVLVDFWAEWCGPCKMIAPILDEIAEEYEGKLKVAKVNIDENPETAAKYGIRGIPTLMLFKNGEVAATKVGALSKSQLKEFLDANL. 106
14 -74.8001zcp_A mol:protein length:108 Thioredoxin 1  ali model follow..  45  4.IIHLTDDSFDDVLKADGAILVDFWAEWCACAKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL. 107
15 -74.7004hu7_A mol:protein length:108 Thioredoxin-1  ali model follow..  45  4.IIHLTDDSFDDVLKADGAILVDFWAEWCGACKMIAAILDEIADEYQGKLTVAKLNIDQNAGTAAKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 108
16 -74.5002i4a_A mol:protein length:107 thioredoxin  ali model follow..  43  3HTLAVSDSSFDDVLKASGLVLVDFWAEWCGPCKMIGPALGEIGKEFAGKVTVAKVNIDDNPETPNAYQVRSIPTLMLVRDGKVIDKKVGALPKSQLKAWVESAQ. 107
17 -74.5001t00_A mol:protein length:112 Thioredoxin  ali model follow..  48  6TLKHVTDDSFEDVLKNDKPVLVDFWAAWCGPCRQIAPSLEAIAAEYGDKIEIVKLNIDENPGTAAKYGVMSIPTLNVYQGGEVAKTIVGAKPKAAIVRDLEDFIA 111
18 -74.4004wxt_A mol:protein length:125 Thioredoxin  ali model follow..  55  11ATIEVSDASFSDVLASNKPVLVDFWATWCGPCKMVAPVLEEIASERGDHLTVAKLDVDANPETAQNFQVVSIPTLILFKDGQPVKRIVGAKGKAALLRELSDAVP 116
19 -74.1004pob_A mol:protein length:117 Thioredoxin  ali model follow..  54  7ATVTVTDDSFQDVVSSNKPVLVDFWATWCGPCKMVAPVLEEIAKDHGEALTIAKLDVDANPETARAFQVTSIPTLILFQNGEATKRIVGAKSKSALLRELDGVV. 111
20 -73.8002puk_C mol:protein length:106 Thioredoxin M-type, chloroplast (TRX-M)  ali model follow..  39  2.VQDVNDSSWKFVLESEVPVMVDFWAPWCGPSKLIAPVIDELAKEYSGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAVPKSTLTDSIEKYLS 106
21 -73.5004xhm_A mol:protein length:137 Thioredoxin (Trx-3)  ali model follow..  47  34SPVKLNSSNFDETLKNNENVVVDFWAEWCHPCKMIAPVIEELAKEYAGKVVFGKLNTDENPTIAARYGISAIPTLIFFKKGKPVDQLVGAMPKSELKRWVQRNL. 137
22 -73.5003ziv_A mol:protein length:106 AECA THIOREDOXIN  ali model follow..  52  2SVIEINDENFDVIKKSDKVVVVDFWAEWCGPCRMIAPIIEELAEEYAGKVVFGKVNVDENPEIAAKYGIMSIPTLLFFKNGKVVDQLVGARPKEALKERIKKYL. 106
23 -73.5001thx_A mol:protein length:115 THIOREDOXIN  ali model follow..  36  8GVITITDAEFEEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN 113
24 -73.4002ynx_A mol:protein length:106 LACA THIOREDOXIN  ali model follow..  52  2SVVQLNDENFDVIKKNNKVVVVDFWAEWCGPCRMIAPIIEELAKEYAGKVVFGKLNVDENPEIAAKYGIMSIPTLLFFKNGKVVDQLVGAMPKEALKERIKKYL. 106
25 -73.2002i1u_A mol:protein length:121 Thioredoxin  ali model follow..  57  13ATIKVTDASFADVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERATDLTVAKLDVDTNPETARNFQVVSIPTLILFKDGQPVKRIVGAKGKAALLRELSDVVP 118
26 -72.4002voc_A mol:protein length:112 THIOREDOXIN  ali model follow..  45  2AIVKATDQSFSAET-SEGVVLADFWAPWCGPSKMIAPVLEELDQEMGDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKDGEVVETSVGFKPKEALQELVNKHL. 104
27 -72.3002o8v_B mol:protein length:128 Thioredoxin 1  ali model follow..  46  17KIIHLTDDSFDDVLKADGAILVDFWAEWCGPAKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 122
28 -72.2002o89_A mol:protein length:107 Thioredoxin  ali model follow..  49  5AIVKVTDADFDSKVESG-VQLVDFWATWCGTSKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL. 107
29 -72.2002o7k_A mol:protein length:107 Thioredoxin  ali model follow..  51  5AIVKVTDADFDSKVESG-VQLVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL. 107
30 -72.1003vfi_A mol:protein length:104 thioredoxin  ali model follow..  26  1.LRSLSDSDFQEVRQHPDPIIIMFTGSWCQPCKKMKPTFEEMASQMEGDIRFAYMDAEDAEKTMAELNIRTLPSLALFVDGMIREVFSGTMNKSDLRYWINNNI. 104
31 -71.0004knd_A mol:protein length:112 Thioredoxin  ali model follow..  42  8DVVVLQDSTFEEVLKSDTPVLVDFWAVWCGPCKAIAPVVDDLAARYKGKLKVAKMDVDQHQGVPQQYGIRSIPTLLVFKGGRVVDTVIGA-DKTRLEDSVKKAIG 112
32 -70.6003hz4_A mol:protein length:140 Thioredoxin  ali model follow..  28  7SIIEFEDMTWSQVEDSKKPVVVMFYSPACPYCKAMEPYFEEYAKEYGSSAVFGRINIATNPWTAEKYGVQGTPTFKFFCHGRPVWEQVGQIYPSILKNAVRDMLQ 112
33 -70.3003gnj_A mol:protein length:111 Thioredoxin domain protein  ali model follow..  26  5SLEKLDTNTFEQIYDEGKACLVMFSRKNCHVCQKVTPVLEELRLNYEESFGFYYVDVEEEKTLFQRFSLKGVPQILYFKDGEYKGKMAGDVEDDEVEQMIADVLE 110
34 -70.1002e0q_A mol:protein length:104 thioredoxin  ali model follow..  42  1.VIHLDSKNFDSFLASHEIAVVDFWAEWCAPCLILAPIIEELAEDY-PQVGFGKLNSDENPDIAARYGVMSLPTVIFFKDGEPVDEIIGAVPREEIEIRIKNLLG 103
35 -69.9003dxb_A mol:protein length:222 thioredoxin N-terminally fused to Puf60(UHM)  ali model follow..  47  7KIIHLTDDSFDDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 112
36 -69.9003hhv_A mol:protein length:110 Thioredoxin (TrxA-2)  ali model follow..  42  7PVKHLNSKNFDEFITKNKIVVVDFWAEWCAPCLILAPVIEELANDY-PQVAFGKLNTEESQDIAMRYGIMSLPTIMFFKNGELVDQILGAVPREEIEVRLKSLLE 110
37 -68.5001oaz_A mol:protein length:123 THIOREDOXIN 1  ali model follow..  47  4KIIHLTDDSFDDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 123
38 -67.1002mcs_A mol:protein length:128 Thioredoxin  ali model follow..  32  17.IEQIGDSEFDNKVNDNILILVDFWAPWCGPCRSLEPQLEKLAQQYTENVKIYKINIEDNQDVATQYGVSAIPTILMFKNGKKLSQVIGADISKIISEINNN... 120
39 -65.4001uvz_A mol:protein length:119 THIOREDOXIN  ali model follow..  30  8TFNIQDGPDFQRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLI. 112
40 -65.2004o32_A mol:protein length:138 Thioredoxin  ali model follow..  19  31PRLQQNGSNIIGVNMKNTVIVLYFFAKWCQACTMQSTEMDKLQKYYGKRIYLLKVDLDKNESLARKFSVKSLPTIILLKNKTMLARKDHFVSSNDLIALIKKHLV 136
41 -62.4002l5l_A mol:protein length:136 Thioredoxin  ali model follow..  33  10KVIHLTKAEFLAKYEGDKPAIVDFYADWCGPCKMVAPILDELAKEYDGQIVIYKVDTEKEQELAGAFGIRSIPSILFIPMEGKPEMAQGAMPKASFKKAIDEFL. 125
42 -61.7003emx_A mol:protein length:135 Thioredoxin  ali model follow..  18  18.LIYITPEEFRQLLQG--DAILAVYSKTCPHCHRDWPQLIQASKEVDVPIVIGERELSAARLEMNKAGVEGTPTLVFYKEGRIVDKLVGATPWSLKVEKAREIYG 126
43 -61.3002l6c_A mol:protein length:110 Thioredoxin  ali model follow..  23  3AIRDITTEAGMAHFEGLSDAIVFFHKNLCPHCKNMEKVLDKFGARA-PQVAISSVDSEARPELMKELGFERVPTLVFIRDGKVAKVFSGIMNPRELQALYAS... 103
44 -61.3003hxs_A mol:protein length:141 Thioredoxin  ali model follow..  44  23GTIHLTRAEFLKKYLGDKPAIVDFYADWCGPCKMVAPILEELSKEYAGKIYIYKVNVDKEPELARDFGIQSIPTIWFVPMKGEPQVNMGALSKEQLKGYIDKVL. 138
45 -60.4001m7t_A mol:protein length:107 Chimera of Human and E. coli thioredoxin  ali model follow..  34  2.VKQIESKTAFQEAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVI-FLEVDVDDAQDVAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL. 106
46 -60.0003aps_A mol:protein length:122 DnaJ homolog subfamily C member 10  ali model follow..  30  4ASIDLTPQTFNKVLQGKTHWVVDFYAPWCGPCQNFAPEFELLARMIKGKVRAGKVDCQAYPQTCQKAGIKAYPSVKLYQYERAKKSIINSRDAKTIAALIYGKLE 113
47 -59.9002j23_A mol:protein length:121 THIOREDOXIN  ali model follow..  35  10SVQVISSYDFKQVTGGDKVVVIDFWATWCGPCKMIGPVFEKISDTPAGKVGFYKVDVDEQSQIAQEVGIRAMPTFVFFKNGQKIDTVVGADPS-KLQAAITQHSA 115
48 -58.4002yoi_A mol:protein length:106 LECA THIOREDOXIN  ali model follow..  38  2VIQVTNKEEFEAILEADKLVVVDFFATWCGPCKMIAPFFEELSEEYPDKVVFIKVDVDEVPDVAAKYGITSMPTFKFFKNGKKVDELVGA-NQEKLKQMILKHAP 106
49 -58.4001v98_A mol:protein length:140 thioredoxin  ali model follow..  41  34WVVEADEKGFAQEVAGAPLTLVDFFAPWCGPCRLVSPILEELARDHAGRLKVVKVNVDEHPGLAARYGVRSVPTLVLFRRGAPVATWVGASPRRVLEERLRPYLE 138
50 -57.0002l57_A mol:protein length:126 Uncharacterized protein  ali model follow..  19  2SLEGIKQINFQEEAKEGIPTIIMFKTDTCPYCVEMQKELSYVSKEREGKFNIYYARLEENIDLAYKYDANIVPTTVFLKEGNKFYVHQGLMRKNNIETILNSLG. 116
51 -55.7002lrc_A mol:protein length:114 Probable thioredoxin  ali model follow..  20  2KTRYSAEAPARELDRLAGPTLVEFGTDWCGHCQAAQPLLAEVFSDYPE-VGHLKVEDGPGRRLGRSFQVKLWPTFVFLRDGREVARVVRPGSASVLEEAFESLVG 106
52 -55.1003qdn_A mol:protein length:287 Putative thioredoxin protein  ali model follow..  35  9.IVNINESNLQQTLEQSTPVLFYFWSERSQHCLQLTPVLESLAAQYHGQFILAKLDCDAEQMIAAQFGLRAIPTVYLFQNGQPVDGFQGPQPEEAIRALLDKVL. 113
53 -54.8003qou_A mol:protein length:287 protein ybbN  ali model follow..  34  9.IVNINESNLQQVLEQSTPVLFYFWSERSQHCLQLTPILESLAAQYNGQFILAKLDCDAEQMIAAQFGLRAIPTVYLFQNGQPVDGFQGPQPEEAIRALLDKVL. 113
54 -54.5002dj0_A mol:protein length:137 Thioredoxin-related transmembrane protein 2  ali model follow..  20  9.IKYFNDKTIDEELERDKTWIVEFFANWSNDCQSFAPIYADLSLKYNTGLNFGKVDVGRYTDVSTRYKVKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEEN 121
55 -53.3003p2a_A mol:protein length:148 Putative thioredoxin-like protein  ali model follow..  36  41..INATAETLDKLLQDDLPMVIDFWAPWCGPCRSFAPIFAETAAERAGKVRFVKVNTEAEPALSTRFRIRSIPTIMLYRNGKMIDMLNGAVPKAPFDNWLDEQLS 143
56 -53.2004ruv_A mol:protein length:114 Thioredoxin  ali model follow..  30  8.....SNESFKSVINSDTPVIVKFEAGWCPDCRAMDLWIDPIVEQY-NDYQWYTVNRDELEDVVVENEVMGIPSLLVFKNGDKIAHLHSANAKSQVESFLAETFK 108
57 -53.0002f51_A mol:protein length:118 thioredoxin  ali model follow..  28  8..FNGTHEALNRIKEAPGLVLVDFFATWCGPCQRLGQILPSIAEAN-KDVTFIKVDVDKNGNAADAYGVSSIPALFFVKKEGNEIKTLDQFDVSRIKADIEKF.. 111
58 -52.0004kca_A mol:protein length:692 Endo-1,5-alpha-L-arabinanase  ali model follow..  47  4KIIHLTDDSFDDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 109
59 -50.8003f3q_A mol:protein length:109 Thioredoxin-1  ali model follow..  39  7.....TASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQ-ADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAA-IKQAIAAN.. 102
60 -50.0002ppt_A mol:protein length:155 thioredoxin-2  ali model follow..  34  50..AGIDPAILARAERDDLPLLVDFWAPWCGPCRQMAPQFQAAAATLAGQVRLAKIDTQAHPAVAGRHRIQGIPAFILFHKGRELARAAGARPASELVGFVRGKLG 152
61 -49.9004euy_A mol:protein length:105 Uncharacterized protein  ali model follow..  19  6....KTIEELATYIEEQQLVLLFIKTENCGVCDVMLRKVNYVLENY-NYVEKIEILLQDMQEIAGRYAVFTGPTVLLFYNGKEILRESRFISLENLERTIQLFEE 105
62 -49.4001r26_A mol:protein length:125 Thioredoxin  ali model follow..  28  20.....SVEQFRNIMSEDILTVAWFTAVWCGPCKTIERPMEKIAYEFP-TVKFAKVDADNNSEIVSKCRVLQLPTFIIARSGKMLGHVIGANPGM-LRQKLRDIIK 117
63 -48.6004cw9_A mol:protein length:109 THIOREDOXIN  ali model follow..  27  8.....ALDQLTALLSTEKVIVIDFFATWCGPSRSISPYFEELAGQYNN-IKFVKVDVDQAEEICVNYKVRSMPTFVLVKDGIEQKRFSGA-DRNALKQMVETA.. 103
64 -48.4001syr_A mol:protein length:112 thioredoxin  ali model follow..  34  9.....SQAEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECSKTYT-KMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGA-NDSALKQLIEKYAA 106
65 -48.3001qgv_A mol:protein length:142 SPLICEOSOMAL PROTEIN U5-15KD  ali model follow..  18  9....HNGWQVDQAIEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQE 111
66 -48.3002mmn_A mol:protein length:104 Thioredoxin  ali model follow..  34  7.....SQSEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECSKTYT-KMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGA-NDSALKQLIEKY.. 102
67 -48.2004j56_E mol:protein length:114 Thioredoxin  ali model follow..  34  11.....SQAEFDSIISQNELVIVDFFAEWCGPSKRIAPFYEECSKTYT-KMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGA-NDSALKQLIEKY.. 106
68 -48.0002oe0_A mol:protein length:114 Thioredoxin-3  ali model follow..  34  13.....NLTEFRNLIKQNDKLVIDFYATWCGPCKMMQPHLTKLIQAYPD-VRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPTA........... 100
69 -47.9001xbs_A mol:protein length:149 Dim1-like protein  ali model follow..  17  9....TSKKEVDQAITAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQD 111
70 -47.7002fa4_A mol:protein length:111 Thioredoxin II  ali model follow..  39  8.....SASEYDSALSGDKLVVVDFFATWCGPCKMIAPMIEKFAEQYSD-AAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAA-IKQAIASNV. 105
71 -47.2002av4_A mol:protein length:160 Thioredoxin-like protein 4A (DIM1)  ali model follow..  13  22.....SGWAVDQAIEDERLVCIRFGHDYDPDCMKMDELLYKVADDIKNFCVIYLVDITEVPDFNTMYELYDPVSVMFFYRNKHMMIDLGTGNNNKINWPMNNKQE 123
72 -47.1003jcm_L mol:protein length:143 Spliceosomal protein DIB1  ali model follow..  18  11.....TGWHVDQAIETKRLVVIRFGRKNDRQCMIMDELLSSIAERVRNFAVIYLCDIDEVSDFDEMYELTDPMTVMFFYHNKHMMCDFGTGNNNKLNFIVDDKQE 112
73 -46.7002ypm_A mol:protein length:106 LAFCA THIOREDOXIN  ali model follow..  38  7.....NKDEFESILSADKLVVVDFTATWCGPCKMIAPKFEELSEEYPDNVVFLKVDVDEVEDVAAEYGISAMPTFQFFKNGKKVDELTGA-NQEKLKAMIKKH.. 104
74 -46.7001xwa_A mol:protein length:111 thioredoxin  ali model follow..  33  12.....DKADLDGQLTSGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGA-NAKRLEDVIKANI. 111
75 -46.6001ep7_A mol:protein length:112 THIOREDOXIN CH1, H-TYPE  ali model follow..  34  14......DAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKVDVDAVAAVAEAAGITAMPTFHVYKDGVKADDLVGA-SQDKLKALVAKHAA 111

FFAS is supported by the NIH grant R01-GM087218-01
8 5 6 6 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.