current user: public




Query: 1nw2_A mol:protein length:105 THIOREDOXIN, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst ATMTLTDANFQQAIQGDKPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGEPVKQLIGYQPKEQLEAQLADVLQLast
1 -80.0001nw2_A mol:protein length:105 THIOREDOXIN  ali model  100  1ATMTLTDANFQQAIQGDKPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGEPVKQLIGYQPKEQLEAQLADVLQ 105
2 -79.6001nsw_A mol:protein length:105 THIOREDOXIN  ali model   98  1ATMTLTDANFQQAIQGDGPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGRPVKQLIGYQPKEQLEAQLADVLQ 105
3 -78.1002cvk_A mol:protein length:110 Thioredoxin  ali model   50  3KPIEVTDQNFDETLGQHPLVLVDFWAEWCAPCRMIAPILEEIAKEYEGKLLVAKLDVDENPKTAMRYRVMSIPTVILFKDGQPVEVLVGAQPKRNYQAKIEKHLP 107
4 -77.3003tco_A mol:protein length:109 Thioredoxin (TrxA-1)  ali model   36  5VTLVLTEENFDEVIRNNKLVLVDCWAEWCAPCHLYEPIYKKVAEKYKGKAVFGRLNVDENQKIADKYSVLNIPTTLIFVNGQLVDSLVGAVDEDTLESTVNKYLK 109
5 -75.0001dby_A mol:protein length:107 CHLOROPLAST THIOREDOXIN M CH2  ali model   42  2EAGAVNDDTFKVVLESSVPVLVDFWAPWCGPCRIIAPVVDEIAGEYKDKLKCVKLNTDESPNVASEYGIRSIPTIMVFKGGKKCETIIGAVPKATIVQTVEKYLN 107
6 -74.9001t00_A mol:protein length:112 Thioredoxin  ali model   48  6TLKHVTDDSFEDVLKNDKPVLVDFWAAWCGPCRQIAPSLEAIAAEYGDKIEIVKLNIDENPGTAAKYGVMSIPTLNVYQGGEVAKTIVGAKPKAAIVRDLEDFIA 111
7 -74.6002voc_A mol:protein length:112 THIOREDOXIN  ali model   45  2AIVKATDQSFSAET-SEGVVLADFWAPWCGPSKMIAPVLEELDQEMGDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKDGEVVETSVGFKPKEALQELVNKHLL 105
8 -74.6002eir_A mol:protein length:108 Thioredoxin 1  ali model   47  3KIIHLTDDSFDDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKCFLDCNLA 108
9 -74.5001srx_A mol:protein length:108 THIOREDOXIN  ali model   45  3KIIHLTDDSFDDLVKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYIERGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 108
10 -74.3001keb_A mol:protein length:108 Thioredoxin 1  ali model   45  3KIIHLTDDSFDDVLKADGAILVDFWAEWCGPCKLIASILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 108
11 -74.3003dyr_A mol:protein length:111 Thioredoxin-1  ali model   46  4KIIHLTDDSFDDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGTPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 109
12 -74.2001zcp_A mol:protein length:108 Thioredoxin 1  ali model   44  3KIIHLTDDSFDDVLKADGAILVDFWAEWCACAKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 108
13 -74.1001txx_A mol:protein length:108 PROTEIN (THIOREDOXIN)  ali model   45  3KIIHLTDDSFDDVLKADGAILVDFWAEWCVWCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 108
14 -74.1001thx_A mol:protein length:115 THIOREDOXIN  ali model   36  8GVITITDAEFEEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN 113
15 -74.0002puk_C mol:protein length:106 Thioredoxin M-type, chloroplast (TRX-M)  ali model   39  2.VQDVNDSSWKFVLESEVPVMVDFWAPWCGPSKLIAPVIDELAKEYSGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAVPKSTLTDSIEKYLS 106
16 -74.0002o7k_A mol:protein length:107 Thioredoxin  ali model   51  5AIVKVTDADFDSKVESG-VQLVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL. 107
17 -74.0002o89_A mol:protein length:107 Thioredoxin  ali model   49  5AIVKVTDADFDSKVESG-VQLVDFWATWCGTSKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL. 107
18 -73.0002i4a_A mol:protein length:107 thioredoxin  ali model   44  4.TLAVSDSSFDDVLKASGLVLVDFWAEWCGPCKMIGPALGEIGKEFAGKVTVAKVNIDDNPETPNAYQVRSIPTLMLVRDGKVIDKKVGALPKSQLKAWVESA.. 106
19 -72.8002i1u_A mol:protein length:121 Thioredoxin  ali model   57  13ATIKVTDASFADVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERATDLTVAKLDVDTNPETARNFQVVSIPTLILFKDGQPVKRIVGAKGKAALLRELSDVVP 118
20 -72.5002o8v_B mol:protein length:128 Thioredoxin 1  ali model   46  17KIIHLTDDSFDDVLKADGAILVDFWAEWCGPAKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 122
21 -72.1003VFI Entity 1(prereleased)  ali follow..  26  1.LRSLSDSDFQEVRQHPDPIIIMFTGSWCQPCKKMKPTFEEMASQMEGDIRFAYMDAEDAEKTMAELNIRTLPSLALFVDGMIREVFSGTMNKSDLRYWINNNI. 104
22 -72.0002e0q_A mol:protein length:104 thioredoxin  ali model   42  1.VIHLDSKNFDSFLASHEIAVVDFWAEWCAPCLILAPIIEELAEDY-PQVGFGKLNSDENPDIAARYGVMSLPTVIFFKDGEPVDEIIGAVPREEIEIRIKNLLG 103
23 -71.5001oaz_A mol:protein length:123 THIOREDOXIN 1  ali model   47  4KIIHLTDDSFDDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 123
24 -71.1003gnj_A mol:protein length:111 Thioredoxin domain protein  ali model   26  5SLEKLDTNTFEQIYDEGKACLVMFSRKNCHVCQKVTPVLEELRLNYEESFGFYYVDVEEEKTLFQRFSLKGVPQILYFKDGEYKGKMAGDVEDDEVEQMIADVLE 110
25 -70.9003hhv_A mol:protein length:110 Thioredoxin (TrxA-2)  ali model   42  7PVKHLNSKNFDEFITKNKIVVVDFWAEWCAPCLILAPVIEELANDY-PQVAFGKLNTEESQDIAMRYGIMSLPTIMFFKNGELVDQILGAVPREEIEVRLKSLLE 110
26 -69.5003hz4_A mol:protein length:140 Thioredoxin  ali model   28  7SIIEFEDMTWSQVEDSKKPVVVMFYSPACPYCKAMEPYFEEYAKEYGSSAVFGRINIATNPWTAEKYGVQGTPTFKFFCHGRPVWEQVGQIYPSILKNAVRDMLQ 112
27 -68.6001uvz_A mol:protein length:119 THIOREDOXIN  ali model   30  8TFNIQDGPDFQRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG 113
28 -68.1002l5l_A mol:protein length:136 Thioredoxin  ali model   31  21AKVYNFEKNPEEKYEGDKPAIVDFYADWCGPCKMVAPILDELAKEYDGQIVIYKVDTEKEQELAGAFGIRSIPSILFIPMEGKPEMAQGAMPKASFKKAIDEFL. 125
29 -67.6003emx_A mol:protein length:135 Thioredoxin  ali model   18  17RLIYITPEEFRQLLQG--DAILAVYSKTCPHCHRDWPQLIQASKEVDVPIVIGERELSAARLEMNKAGVEGTPTLVFYKEGRIVDKLVGATPWSLKVEKAREIYG 126
30 -67.5003hxs_A mol:protein length:141 Thioredoxin  ali model   45  23GTIHLTRAEFLKKILGDKPAIVDFYADWCGPCKMVAPILEELSKEYAGKIYIYKVNVDKEPELARDFGIQSIPTIWFVPMKGEPQVNMGALSKEQLKGYIDKVL. 138
31 -66.6003ul3_B mol:protein length:128 Thioredoxin  ali model   18  25PRLQQNGSNIIGVNMKNTVIVLYFFAKWCQACTMQSTEMDKLQKYYGKRIYLLKVDLDKNESLARKFSVKSLPTIILLKNKTMLARKDHFVSSNDLIALIKKH.. 128
32 -65.3003p2a_A mol:protein length:148 Putative thioredoxin-like protein  ali model   36  39EVINATAETLDKLLQDDLPMVIDFWAPWCGPCRSFAPIFAETAAERAGKVRFVKVNTEAEPALSTRFRIRSIPTIMLYRNGKMIDMLNGAVPKAPFDNWLDEQLS 143
33 -64.4002l6c_A mol:protein length:110 Thioredoxin  ali model   23  3AIRDITTEAGMAHFEGLSDAIVFFHKNLCPHCKNMEKVLDKFGARA-PQVAISSVDSEARPELMKELGFERVPTLVFIRDGKVAKVFSGIMNPRELQALYASI.. 104
34 -63.3001v98_A mol:protein length:140 thioredoxin  ali model   41  34WVVEADEKGFAQEVAGAPLTLVDFFAPWCGPCRLVSPILEELARDHAGRLKVVKVNVDEHPGLAARYGVRSVPTLVLFRRGAPVATWVGASPRRVLEERLRPYLE 138
35 -62.0001xwa_A mol:protein length:111 thioredoxin  ali model   32  7VYQVKDKADLDGQLASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAK-RLEDVIKANI. 111
36 -61.8001m7t_A mol:protein length:107 Chimera of Human and E. coli thioredoxin  ali model   35  2.VKQIESKTAFQEAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSN-VIFLEVDVDDAQDVAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL. 106
37 -61.3002j23_A mol:protein length:121 THIOREDOXIN  ali model   34  10SVQVISSYDQKQVTGGDKVVVIDFWATWCGPCKMIGPVFEKISDTPAGKVGFYKVDVDEQSQIAQEVGIRAMPTFVFFKNGQKIDTVVGADPS-KLQAAITQHSA 115
38 -61.0001ep7_A mol:protein length:112 THIOREDOXIN CH1, H-TYPE  ali model   31  4VIVIDSKAAWDAQLEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKVDVDAVAAVAEAAGITAMPTFHVYKDGVKADDLVGA-SQDKLKALVAKHAA 111
39 -60.5003f3q_A mol:protein length:109 Thioredoxin-1  ali model   38  2VTQFKTASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYP-QADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAA-IKQAIAAN.. 102
40 -60.2002ppt_A mol:protein length:155 thioredoxin-2  ali model   34  47GKVAGIDPAILRAERDDLPLLVDFWAPWCGPCRQMAPQFQAAAATLAGQVRLAKIDTQAHPAVAGRHRIQGIPAFILFHKGRELARAAGARPASELVGFVRGKLG 152
41 -59.4003aps_A mol:protein length:122 DnaJ homolog subfamily C member 10  ali model   29  4ASIDLTPQTFNEVLQGKTHWVVDFYAPWCGPCQNFAPEFELLARMIKGKVRAGKVDCQAYPQTCQKAGIKAYPSVKLYQYERAKKSIWEEQINSRDAKTIAALIY 109
42 -59.4002l57_A mol:protein length:126 Uncharacterized protein  ali model   15  10NFQSINVVENLEEAKEGIPTIIMFKTDTCPYCVEMQKELSYVSKEREGKFNIYYARLEKNIDLAYKYDANIVPTTVFLKEGNKFYVHQGLMRKNNIETILNSLG. 116
43 -58.5002dj0_A mol:protein length:137 Thioredoxin-related transmembrane protein 2  ali model   18  8YIKYFNDKTIDEELDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNTGLNFGKVDVGRYTDVSTRYKVKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSE.. 119
44 -58.4002oe0_A mol:protein length:114 Thioredoxin-3  ali model   33  7SITKLTNLTFRNLIKQNDKLVIDFYATWCGPCKMMQPHLTKLIQAY-PDVRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPT-ALEKGIKDL.. 108
45 -57.9001ti3_A mol:protein length:113 thioredoxin H  ali model   31  10HTVDTWKEHFEKGKGSQKLIVVDFTASWCPPCKMIAPIFAELAKKFP-NVTFLKVDVDELKAVAEEWNVEAMPTFIFLKDGKLVDKTVGA-DKDGLPTLVAKHAT 112
46 -57.6001r26_A mol:protein length:125 Thioredoxin  ali model   26  14SVVDVYSVEFRNIMSEDILTVAWFTAVWCGPCKTIERPMEKIAYEFP-TVKFAKVDADNNSEIVSKCRVLQLPTFIIARSGKMLGHVIGANPGM-LRQKLRDIIK 117
47 -57.4001syr_A mol:protein length:112 thioredoxin  ali model   34  9.....SQAEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECSKTY-TKMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGA-NDSALKQLIEKYAA 106
48 -56.9002fa4_A mol:protein length:111 Thioredoxin II  ali model   36  3VTQLKSASEYDSLASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQY-SDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPA-AIKQAIASNV. 105
49 -56.8003dxb_A mol:protein length:222 thioredoxin N-terminally fused to Puf60(UHM)  ali model   48  7KIIHLTDDSFDDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL. 111
50 -56.6001faa_A mol:protein length:124 THIOREDOXIN F  ali model   30  19KVTEVNKDTFWPIVAGDKPVVLDMFTQWCGPCKAMAPKYEKLAEEYLD-VIFLKLDCNENKTLAKELGIRVVPTFKILKENSVVGEVTGAKYDK-LLEAIQAARS 124
51 -56.2003qdn_A mol:protein length:287 Putative thioredoxin protein  ali model   35  9.IVNINESNLQQTLEQTTPVLFYFWSERSQHCLQLTPVLESLAAQYHGQFILAKLDCDAEQMIAAQFGLRAIPTVYLFQNGQPVDGFQGPQPEEAIRALLDKVLP 114
52 -56.0002vim_A mol:protein length:104 THIOREDOXIN  ali model   30  2.RVLATAADLEKLINKGRLIVVDFFAQWCGPCRNIAPKVEALAKEI-PEVEFAKVDVDQNEEAAAKYSVTAMPTFVFIKDGKEVDRFSGA-NETKLRETITRH.. 103
53 -55.9003qou_A mol:protein length:287 protein ybbN  ali model   34  9.IVNINESNLQQVLEQSTPVLFYFWSERSQHCLQLTPILESLAAQYNGQFILAKLDCDAEQMIAAQFGLRAIPTVYLFQNGQPVDGFQGPQPEEAIRALLDKVLP 114
54 -55.4002xbi_A mol:protein length:108 THIOREDOXIN  ali model   30  6LIELKQDGDLESLLHKNKLVVVDFFATWCGPCKTIAPLFKELSEKY--DAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIA-KVEDMIKKFI. 108
55 -55.3001x5d_A mol:protein length:133 Protein disulfide-isomerase A6  ali model   25  8DVIELTDDSFDKVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFS 117
56 -55.3003d6i_A mol:protein length:112 Monothiol glutaredoxin-3  ali model   25  4EINDQEQFTYLTTAAGDKLIVLYFHTSWAEPCKALKQVFEAISNEPSSNVSFLSIDADENSEISELFEISAVPYFIIIHKGTILKELSGADPKE-YVSLLEDCKN 109
57 -55.2001qgv_A mol:protein length:142 SPLICEOSOMAL PROTEIN U5-15KD  ali model   18  9....HNGWQVDQAIEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQE 111
58 -55.1002xbq_A mol:protein length:117 THIOREDOXIN  ali model   30  15LIELKQDGDLESLLHKNKLVVVDFFATWCGPCKTIAPLFKELSEKY--DAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIA-KVEDMIKKFI. 117
59 -54.0002f51_A mol:protein length:118 thioredoxin  ali model   28  6VHFNGTHEALNRIKEAPGLVLVDFFATWCGPCQRLGQILPSIAEAN-KDVTFIKVDVDKNGNAADAYGVSSIPALFFVKKEGNEIKTLDQFDVSRIKADIEKF.. 111
60 -53.9002av4_A mol:protein length:160 Thioredoxin-like protein 4A (DIM1)  ali model   13  22.....SGWAVDQAIEDERLVCIRFGHDYDPDCMKMDELLYKVADDIKNFCVIYLVDITEVPDFNTMYELYDPVSVMFFYRNKHMMIDLGTGNNNKINWPMNNKQE 123
61 -53.8001x5c_A mol:protein length:121 Protein disulfide-isomerase  ali model   24  8PVKVLVGKNFEDAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVINGERTLDGFKKFLESGGQ 115
62 -53.5003ZZX Entity 1(prereleased)  ali follow..  30  2VYQVKDQEDFTKQLNGNKLVVIDFYATWCGPCKMIAPKLEELSQSM-SDVVFLKVDVDECEDIAQDNQIACMPTFLFMKNGQKLDSLSGA-NYDKLLELVEKN.. 104
63 -53.5002diz_A mol:protein length:117 Thioredoxin domain-containing protein 5  ali model   26  8TVLALTENNFDDTI-AEGITFIKFYAPWCGHCKTLAPTWEELSKKELAGVKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSLHRFVLSQAK 114
64 -53.4002dml_A mol:protein length:130 Protein disulfide-isomerase A6  ali model   29  18DVIELTPSNFNRVIQSDGLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVNADKHQSLGGQYGVQGFPTIKIFGANKKPEDYQGGRTGEAIVDAALSALR 124
65 -53.2001xbs_A mol:protein length:149 Dim1-like protein  ali model   17  9....TSKKEVDQAITAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQD 111
66 -53.1001xfl_A mol:protein length:124 Thioredoxin h1  ali model   31  22......NEQLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKL-PNVLFLKVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGA-KKDELQSTIAKHLA 118
67 -53.1003kd0_A mol:protein length:105 Thioredoxin  ali model   34  7.....SKTAFQEALDADKLVVVDFSATWCGPSKMIKPFFHSLSEKY-SNVIFLEVDVDDSQDVASESEVKSMPTFQFFKKGQKVGEFSGA-NKEKLEATINELV. 105
68 -52.9001gh2_A mol:protein length:107 THIOREDOXIN-LIKE PROTEIN  ali model   23  8.....SDPDFQPELSGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYP-QAVFLEVDVHQCQGTAATNNISATPTFQFFRNKVRIDQYQGA-DAVGLEEKIKQHLE 107
69 -52.9002vm1_A mol:protein length:118 THIOREDOXIN H ISOFORM 1.  ali model   28  13.....TKQEFDTHMDTGKLVIIDFTASWCGPCRVIAPVFAEYAKKFPG-AIFLKVDVDELKDVAEAYNVEAMPTFLFIKDGEKVDSVVGGRKDD-IHTKIVALMG 114
70 -52.9001aiu_A mol:protein length:105 THIOREDOXIN  ali model   34  7.....SKTAFQEALDGDKLVVVDFSATWCGPCKMIKPFFHSLSEKY-SNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGA-NKEKLEATINELV. 105
71 -52.8003e3e_A mol:protein length:105 Thioredoxin  ali model   33  7.....SKTAFQEALDADKLVVVDFSATWCGPSKMIKPFFHSLSEKY-SNVIFLEVDVDDCQDVASECEVKRMPTFQFFKKGQKVGEFSGA-NKEKLEATINELV. 105
72 -52.8001erv_A mol:protein length:105 THIOREDOXIN  ali model   35  7.....SKTAFQEALDADKLVVVDFSATWCGPCKMIKPFFHSLSEKY-SNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGA-NKEKLEATINELV. 105
73 -52.7003trx_A mol:protein length:105 THIOREDOXIN  ali model   34  7.....SKTAFQEALDADKLVVVDFSATWCGPCKMIKPFFHSLSEKY-SNVIFLEVDVDDCQDVASECEVKCTPTFQFFKKGQKVGEFSGA-NKEKLEATINELV. 105
74 -52.7001erw_A mol:protein length:105 THIOREDOXIN  ali model   32  7.....SKTAFQEALDADKLVVVDFSATWSGPSKMIKPFFHSLSEKY-SNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGA-NKEKLEATINELV. 105
75 -52.6001cqg_A mol:protein length:105 THIOREDOXIN  ali model   33  7.....SKTAFQEALDADKLVVVDFSATWCGPAKMIKPFFHSLSEKY-SNVIFLEVDVDDAQDVASEAEVKATPTFQFFKKGQKVGEFSGA-NKEKLEATINELV. 105

FFAS is supported by the NIH grant R01-GM087218-01
6 6 2 0 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Plewczynski D, Tkacz A, Wyrwicz LS, Godzik A, Kloczkowski A, Rychlewski L. Support-vector-machine classification of linear functional motifs in proteins. J Mol Model 2006 Aug;12(4):453-61. Epub 2005 Dec 10.