current user: public




1mhyG
Query: 1mhy_G mol:protein length:169 METHANE MONOOXYGENASE HYDROXYLASE, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .
# Score Template Links and tools%idFirst MAKREPIHDNSIRTEWEAKIAKLTSVDQATKFIQDFRLAYTSPFRKSYDIDVDYQYIERKIEEKLSVLKTEKLPVADLITKATTGEDAAAVEATWIAKIKAAKSKYEAEAIHIEFRQLYKPPVLPVNVFLRTDAALGTVLMEIRNTDYYGTPLEGLRKERGVKVLHLQALast
1 -120.0001mhy_G mol:protein length:169 METHANE MONOOXYGENASE HYDROXYLASE  ali model  100  1MAKREPIHDNSIRTEWEAKIAKLTSVDQATKFIQDFRLAYTSPFRKSYDIDVDYQYIERKIEEKLSVLKTEKLPVADLITKATTGEDAAAVEATWIAKIKAAKSKYEAEAIHIEFRQLYKPPVLPVNVFLRTDAALGTVLMEIRNTDYYGTPLEGLRKERGVKVLHLQA 169
2 -110.0001fyz_E mol:protein length:170 METHANE MONOOXYGENASE COMPONENT A, GAMMA CHAI  ali model follow..  52  1MAKLG-IHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS 168
3 -110.0001mmo_G mol:protein length:162 METHANE MONOOXYGENASE HYDROLASE (GAMMA CHAIN)  ali model follow..  51  3......IHSNDTRDAWVNKIAHVNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVH... 162
4 -7.1901s2x_A mol:protein length:206 Cag-Z  ali model follow..  19  32.........NEVRDKFIQNYASLKDSNDPQDFLRRVQELRINMQKNFISFDAYYNYLNNLVLASYNRCKQEKFAESTIKNELTLGEFVAEISDNFVARISDLVASY--------LPREYLPPFIDGNMMGVAFQILG--------IDDFGKKLNEIVQDIGTKYIILS. 183
5 -7.1001vpq_A mol:protein length:273 hypothetical protein TM1631  ali model follow..  11  34....................................FLKYYWAVLGFRIVELNFTYYTQPSWRSFVQMLRKTPPDFYFTVKTKEGKDPKEDMENFTRQIEPLIEEQRLKMTLAQFPFSFKFSRKNVEYLEKLRESYPYELVEFRHYSWDREETYEFLRNHGITFVVVDE 176
6 -5.7703kb4_A mol:protein length:225 Alr8543 protein  ali model follow..  12  72................LEQLHQLPNYTLGYMYADHMIRNQLTPPPVNENVNHPFMFLAAHLGETHDIWH------------VVTGCDTDKPGEVKLEAFYTAQLIPDRLFLALLAKNLLKTAMYEVELCEQILDGLAKPLFGIEWNKLWETPLEELQTSLNIV...... 215
7 -5.7602i53_A mol:protein length:258 Cyclin K  ali model follow..  46..............RFIFDVGTRDTLATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQFGQFGDDPKEEVM----------VLERITIKFDLQVEHPYQFLLKYAKQLKGDKNKIQKLVQMAWT.................... 178
8 -5.7101wyp_A mol:protein length:136 Calponin 1  ali model follow..  18  25.......................................................WIEGVTGRRIGNNFMDGLKDGIILCEFI-----NKLQPGSVKKINESTQNWHLENIGNFIKAITKYGVKPHDIFEAND------LFENTNHTQVQSTLLALAS........... 117
9 -5.6703lwa_A mol:protein length:183 Secreted thiol-disulfide isomerase  ali model follow..  12  58...........................ENQVVILNAWGQWCAPCRSESD---------QIIHEELQAAGNGDTPGGTVLGINVRDYSRDIAQDFVTDNGLDYPSIYDPPFMTAASLGGVPASVIPTTIVLDKQHRPAAVFLREVTSKDVLDVALPLVDE.......... 182
10 -5.6203hty_A mol:protein length:94 hypothetical protein BT_0869  ali model follow..  13  1........GASIVGSWVEPVPGLEGQVQGIKMEEGGVASSVNMATLVYE-----SW---KQEGTKLILTGKSIGNGQTIEFVDTMDIKRLTADSLVLDNQGMEIRYAKQK........................................................... 94

FFAS is supported by the NIH grant R01-GM087218-01
5 9 9 2 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Schwarzenbacher R, Godzik A, Jaroszewski L. The JCSG MR pipeline: optimized alignments, multiple models and parallel searches. Acta Crystallogr D Biol Crystallogr. 2008 Jan;64(Pt 1):133-40. Epub 2007 Dec 5.