current user: public




Query: 1mhy_G mol:protein length:169 METHANE MONOOXYGENASE HYDROXYLASE, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .
# Score Template Links and tools%idFirst MAKREPIHDNSIRTEWEAKIAKLTSVDQATKFIQDFRLAYTSPFRKSYDIDVDYQYIERKIEEKLSVLKTEKLPVADLITKATTGEDAAAVEATWIAKIKAAKSKYEAEAIHIEFRQLYKPPVLPVNVFLRTDAALGTVLMEIRNTDYYGTPLEGLRKERGVKVLHLQALast
1 -115.0001mhy_G mol:protein length:169 METHANE MONOOXYGENASE HYDROXYLASE  ali model  100  1MAKREPIHDNSIRTEWEAKIAKLTSVDQATKFIQDFRLAYTSPFRKSYDIDVDYQYIERKIEEKLSVLKTEKLPVADLITKATTGEDAAAVEATWIAKIKAAKSKYEAEAIHIEFRQLYKPPVLPVNVFLRTDAALGTVLMEIRNTDYYGTPLEGLRKERGVKVLHLQA 169
2 -105.0001fyz_E mol:protein length:170 METHANE MONOOXYGENASE COMPONENT A, GAMMA CHAI  ali model follow..  51  3...KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS 168
3 -104.0001mmo_G mol:protein length:162 METHANE MONOOXYGENASE HYDROLASE (GAMMA CHAIN)  ali model follow..  51  3......IHSNDTRDAWVNKIAHVNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVH... 162
4 -6.6301dk8_A mol:protein length:147 AXIN  ali model follow..  11..............KWAESLHSLLDDQDGISLFRTF-------LKQEGCADLLDFWFAC---TGFRKLEPCDSNEEKRLKL------ARAIYRKYILDNNGIVSRQTKPATKSFIKGCIMKQLIDPAMFDQAQTEIQATMEENTYPSFLKSDI................ 133
5 -6.5503kb4_A mol:protein length:225 Alr8543 protein  ali model follow..  12  72................LEQLHQLPNYTLGYMYADHMIRNQLTPPPVNENVNHPFMFLAAHLGETHDIWH------------VVTGCDTDKPGEVKLEAFYTAQLIPDRLFLALLAKNLLKTAMYEVELCEQILDGLAKPLFGIEWNKLWETPLEELQTSLNIV...... 215
6 -6.3102lht_A mol:protein length:122 Cellophane-induced protein 1  ali model follow..  19  31................................................DCRKDVQACDKKYDDQGRETACAKGIREKYKPAVVYGYDGKPLDLGFCTLAQTCDKKYESDKCLNAIKEKYKPVVDP............................................ 118
7 -5.8602qv0_A mol:protein length:143 Protein mrkE  ali model follow..  13  18.........................................................EFLAQQELSWL-INTHSQMEIVGSFDDGLDVLKFLQHNKVDAIFLDINIPSLDGVLLAQNISQFAHKPFIVFITAWKEHAVEAFELEAFDYILKPYQESRIINMLQKLT... 125
8 -5.7501aod_A mol:protein length:289 PHOSPHATIDYLINOSITOL-SPECIFIC PHOSPHOLIPASE C  ali model follow..  11  17............TKQWMSALPDTTNLAADITWTLTKPLAQTQTMSLYQQLEAGIRYIDIRAKDNLNIYHGPIFLNASL--------------SGVLETITQFLKKNPKETIIMRLKDEQNSNDSFDYRIQPLINIYKDYFYT-TPRTDTSNKIPTLKDVRGKILL.... 168
9 -5.6801wyp_A mol:protein length:136 Calponin 1  ali model follow..  18  25.......................................................WIEGVTGRRIGNNFMDGLKDGIILCEFI-----NKLQPGSVKKINESTQNWQLENIGNFIKAITKYGVKPHDIFEAND------LFENTNHTQVQSTLLALAS........... 117
10 -5.6703j6b_R mol:protein length:371 54S ribosomal protein L2, mitochondrial  ali model follow..  13  237..........................NEKLSESLSKIDECSDLLNSSTSFNNKLELHQYISEQEKQALKAKLLEDLEKSQHLETKKDKNYI-----KALFKDACNFLTLSEEVHLRRKYLKSVFPETDSTVETKS-GKKSIVSRRFDYTKNKVEVIARSRRAFLSKL.. 371

FFAS is supported by the NIH grant R01-GM087218-01
8 3 0 7 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.