current user: public




Query: 1lql_A mol:protein length:166 osmotical inducible protein C like family, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160
# Score Template Links and tools%idFirst MGSSDYDIPTTENLYFQGHMDKKYDITAVLNEDSSMTAISDQFQITLDARPKHTAKGFGPLAALLSGLAACELATANLMAPAKMITINKLLMNVTGSRSTNPTDGYFGLREINLHWEIHSPNSETEIKEFIDFVSKRCPAHNTLQGVSQLKINVNVTLVHLast
1 -91.7001lql_A mol:protein length:166 osmotical inducible protein C like family  ali model  100  1MGSSDYDIPTTENLYFQGHMDKKYDITAVLNEDSSMTAISDQFQITLDARPKHTAKGFGPLAALLSGLAACELATANLMAPAKMITINKLLMNVTGSRSTNPTDGYFGLREINLHWEIHSPNSETEIKEFIDFVSKRCPAHNTLQGVSQLKINVNVTLVH 160
2 -69.0003cje_A mol:protein length:167 OsmC-like protein  ali model follow..  15  8..............QMPDRAEVVFTCNGKAVGKMRNELDVERFALATDEGAGGDASAPPPLALFIAGLTGCVMTQIRAFAKRLKVTVTDLDVECRVVWDWAKAGPETGPKSFEIDIILHSPDPIEAQQALIEAAKKGCFLEQTLGQANTIRHRLKVG... 161
3 -68.9002opl_A mol:protein length:187 Hypothetical protein  ali model follow..  18  8..VNGVNVDQLMATIEQEIAQFKFRATNQWMGGTHNQATIKDMVFDLDEPPLGENRGANPVEYLLVALSGCLTTSLVAHAAARGIALRGVKSRYEGDIDLRGFLGPVGYREIRVFFSIDADLTDGQKEELIRMAQKYSPVYNTVAKPVPVAVLLD..... 185
4 -50.3002pn2_A mol:protein length:155 Uncharacterized protein  ali model follow..  15  1.......MGSDKIENLYFQGMTTSKVTYQGDLRTSAIHLQSNNEIITDAPVQGKGEAFSPTDLLATSLASCMLTIIGIKARDMEIDIAGTTAEVTKVMAAD----PRRVSEVHIAITFNQELDDKTQKIFYNTALT-CPVAKSIHPDIFQKVIIHSKS.. 148
5 -47.3002onf_A mol:protein length:140 Hypothetical protein Ta0195  ali model follow..  16  1...................GMHVYESDVSWIDDRRTEVSVGDHRIEVDSPPGGPEGQLYPETLFPSVLASCLLTTFLEFKDRMGINLKSWNSHVTAELGPSP-EKGFKFHRIKIHVKIGNDEDKEKIPRAMQLAEKYCFISRAIRNNVEEIVDYEFV... 140
6 -30.3002e8c_A mol:protein length:132 Hypothetical protein Aq_1549  ali model follow..  15  26...................................................TAGEKGLNPMELLLVSIGSCSGVDVYHILKKKRQEVKDIKIFLKGK---RREKHPKIYEEIEIKYVAVGKVEEKALEQAVKLTEKYCSVLAMVKPSTNLKISWEVKWEE 132
7 -28.4001vla_A mol:protein length:150 Hydroperoxide resistance protein OsmC  ali model follow..  10  1...................MGSDKIMQARWIGNMMFHVRTDSHDVLMDTKEGGKDAAPRPLELVLTGLMGCTGMDVVSILRKMKVQMKDFRIEIEYE---RTEEHPRIFTKVHLKYIFDGEPPKDKVEKAVQLQEKYCSVSAILKCSSKVTYEIVYE... 143
8 -27.9001ml8_A mol:protein length:134 hypothetical protein (crp region)  ali model follow..  14  1.......................MQARVKWVEGLTFLGESASHQILMDG--NSGDKAPSPMEMVLMAAGGCSAIDVVSILQKGRQDVVDCEVKLTSE---RREADTRLFTHINLHFIVTGDLKDAAVARAVDLAEKYCSVALMLEKAVNITHSYEVVAA. 134
9 -26.8002ql8_A mol:protein length:143 Putative redox protein  ali model follow..  15  1............GMQDERWNHPLYTTTAINDEELEGHAYIPGGLKVQTSSPMNDHPGTNPEQLLGLSLSTCLEATLEAVEKEHGLPHTG---AVRVKVAFIGARAEYQFL-VHAQVMVKG-VDFDTAKAFTNEIENRCPVSKLLKNSGNYTIETV..... 138
10 -25.9003eer_A mol:protein length:148 Organic hydroperoxide resistance protein, put  ali model follow..  13  9...................MSTIYQTSATASAGRNGVVSTEDLNLSYPKEMGGSGTATNPEQLFAVGYAACFSNAILHVAREAKVALKEAPVTATVGI---GPNGQGGF-ALSVALAAHIALEDEQARQLVTVAHQVCPYSNAVRGNIDVQVSVN..... 144
11 -25.3002bjo_A mol:protein length:136 ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN OHRB  ali model follow..  16  4.......................FTAKVTARGGRAGHITSDDFDIVMPNAAAAGQTGTNPEQLFAAGYAACFGGALEHVAKEQNIEIDS---EIEGQVSLMKDESDGGFKGVTLVVNTKD-LDREKAQELVNAAHEFCPYSKATRGNVDVKLELK..... 136
12 -25.0001ukk_A mol:protein length:142 Osmotically Inducible Protein C  ali model follow..  10  39....................................................EEGEGTNPEELIAAAHAGCFSMALAASLEREGFPPKRVSTEARVHLEVVD----GKPTLTRIELLTEAEISSEKFLEIAEAAKEGCPVSRALAGVKEVVLTARLV... 142
13 -24.0001nye_A mol:protein length:162 Osmotically inducible protein C  ali model follow..  15  56....................................................EGEKGTNPEELIGAAHAACFSMALSLMLGEAGFTPTSIDTTADVSLDKVD----AGFAITKIALKSEVAIDASTFDGIIQKAKAGCPVSQVLKAEITLDYQLK..... 157
14 -23.0002d7v_A mol:protein length:162 Hypothetical protein VCA0330  ali model follow..  11  12....................SAIVTWKRKDSEAFTDNQYSRAHTWEFDSPH-SVEANVDPEEAFVAALSSCHMLVFLSIAAKQRYLVESYTDNAVGILG-KNSKGKTSVTKVVLRPQVTSKPTLQQLEKMHHLAHENCFIANSVETEVVTE......... 159
15 -22.0004mh4_A mol:protein length:147 OsmC-like protein  ali model follow..  16  25..................................AARSSDGRLDIQLSSP-GSAGTGTNPEQLFAAGWSACFIGAMQLAARAAKVTLPA-DLAVDAEVDLGTAGNAYFLQ-ARLNVSVPG-LERDVAQRIVDAAHQTCPYSKATRGNIDVDIRIA..... 141
16 -21.8001n2f_A mol:protein length:142 Organic Hydroperoxide Resistance Protein  ali model follow..  18  9......................TATATATGGRDGRAVSSDGVLDVKLSTPRGQGGAATNPEQLFAAGYSACFIGAMKFVAGQRKQTLPA-DASITGKVGIGQIPGGFGLE-VELHINLPG-MEREAAEALVAAAHQVCPYSNATRGNIDVRLNVSV.... 142
17 -21.7001usp_A mol:protein length:139 ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN  ali model follow..  16  1...................MANVYTAEATATGGRAGTTRSSDDRLNLDEMGGDGGPGTNPEQLFAAGYAACFQGALGVVSRRQKIDVPA-DSTITARVGLQKAGLAFALD-VELEGHFPG-LSREQAEGLMHAAHEVCPYSAATRNNVDVRLKVR..... 138
18 -21.5004noz_A mol:protein length:149 Organic hydroperoxide resistance protein  ali model follow..  17  11......................RAHAKATGGRDGRATVPESGLDLKLTTPRGAGGAGANPEQLFAAGYSACFIGAMKFVAARDKIAIPA-DAAIEGSVGIGAIPNGFGIE-VELKISLPG-LDRDIAQTLIDRAHVVCPYSNATRGNIDVTLTLV..... 143
19 -21.2004xx2_A mol:protein length:163 Organic hydroperoxide resistance protein  ali model follow..  17  24......................TAIVTATGGRDGSVVSSDNVLNVKLSVPQGPGGSGTNPEQLFAAGYSACFIGALKFVANKEKVDLPA-EPRVEGRVGIGEIPGGFGLV-VELRIAVSG-MERSMLQTLVDKAHRVCPYSNATRGNIDVVLILI..... 156

FFAS is supported by the NIH grant R01-GM087218-01
8 3 0 5 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.