current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

1lqlA
Query: 1lql_A mol:protein length:166 osmotical inducible protein C like family, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160
# Score Template Links and tools%idFirst MGSSDYDIPTTENLYFQGHMDKKYDITAVLNEDSSMTAISDQFQITLDARPKHTAKGFGPLAALLSGLAACELATANLMAPAKMITINKLLMNVTGSRSTNPTDGYFGLREINLHWEIHSPNSETEIKEFIDFVSKRCPAHNTLQGVSQLKINVNVTLVHLast
1 -85.1001lql_A mol:protein length:166 osmotical inducible protein C like family  ali model  100  1MGSSDYDIPTTENLYFQGHMDKKYDITAVLNEDSSMTAISDQFQITLDARPKHTAKGFGPLAALLSGLAACELATANLMAPAKMITINKLLMNVTGSRSTNPTDGYFGLREINLHWEIHSPNSETEIKEFIDFVSKRCPAHNTLQGVSQLKINVNVTLVH 160
2 -60.9003cje_A mol:protein length:167 OsmC-like protein  ali model follow..  16  2MALTPDQMPDRAEVVFTCNGKAVGKMRNELDVA-MVKPFEERFALATDEGAGGDASAPPPLALFIAGLTGCVMTQIRAFAKRLKVTVTDLDVECRVVWDWAKAGPETGPKSFEIDIILHSPDPIEAQQALIEAAKKGCFLEQTLGQANTIRHRLKV.... 160
3 -60.6002opl_A mol:protein length:187 Hypothetical protein  ali model follow..  17  35..........RATNQWMGGTHNQATIKDF-YGACAEDDTRKPMVFDLDEPPLGENRGANPVEYLLVALSGCLTTSLVAHAAARGIALRGVKSRYEGDIDLRGEEVPVGYREIRVFFSIDADLTDGQKEELIRMAQKYSPVYNTVAKPVPVAVLLD..... 185
4 -56.0002pn2_A mol:protein length:155 Uncharacterized protein  ali model follow..  14  1.......MGSDKIENLYFQGMTTSKVTYQGDLRTSAIHLQSNNEIITDAPVQGKGEAFSPTDLLATSLASCMLTIIGIKARDMEIDIAGTTAEVTKVMA----ADPRRVSEVHIAITFNQELDDKT-QKIFYNTALTCPVAKSIHPDIFQKVIIH..... 145
5 -53.8003eer_A mol:protein length:148 Organic hydroperoxide resistance protein, put  ali model follow..  12  1.........SNAMRNKNMSTIYQTSATASAGRNGVVSTEDKLLELNLSYPKGGSGTATNPEQLFAVGYAACFSNAILHVAREAKVALKEAPVTATVGIGPNGQ----GGFALSVALAAHIALEDEQARQLVTVAHQVCPYSNAVRGNIDVQVSVNGLAL. 148
6 -52.9002onf_A mol:protein length:140 Hypothetical protein Ta0195  ali model follow..  16  1...................GMHVYESDVSWIDDRRTEVSVGDHRIEVDSPPGGPEGQLYPETLFPSVLASCLLTTFLEFKDRMGINLKSWNSHVTAELGPSP-EKGFKFHRIKIHVKIGNDEDKEKIPRAMQLAEKYCFISRAIRNNVEEIVDYEFV... 140
7 -51.7001vla_A mol:protein length:150 Hydroperoxide resistance protein OsmC  ali model follow..  10  1...................MGSDKIMQARWIGNMMFHVRTSNHDVLMDTKEGGKDAAPRPLELVLTGLMGCTGMDVVSILRKMKVIDQMKDFRIEIEYERTE-EHPRIFTKVHLKYIFDGEPPKDKVEKAVQLSEKYCSVSAILKCSSKVTYEIVY.... 142
8 -50.0002e8c_A mol:protein length:132 Hypothetical protein Aq_1549  ali model follow..  15  7..................................ELELSSEATFLSKTSIGTAGEKGLNPMELLLVSIGSCSGVDVYHILKKKRQEVKDIKIFLKGKRR---EKHPKIYEEIEIKYVAVGKVEEKALEQAVKLSEKYCSVLAMVKPSTNLKISWEVK... 129
9 -47.8001ml8_A mol:protein length:134 hypothetical protein (crp region)  ali model follow..  14  1.....................MQARVKWVEGLTFLGESA-SGHQILMDG--NSGDKAPSPMEMVLMAAGGCSAIDVVSILQKGRQDVVDCEVKLTSERR---EADTRLFTHINLHFIVTGDLKDAAVARAVDLSEKYCSVALMLEKAVNITHSYEVVAA. 134
10 -46.7002d7v_A mol:protein length:162 Hypothetical protein VCA0330  ali model follow..  11  1MSFGGKSMSEHSAIVTWKRKDSEAFTDNQYSRAHTWEFDGGSKILASASPPLSVEANVDPEEAFVAALSSCHMLVFLSIAAKQRYLVESYTDNAVGILGKNS-KGKTSVTKVVLRPQVVSKPTLQQLEKMHHLAHENCFIANSVETEVVTEII....... 161
11 -46.0001nye_A mol:protein length:162 Osmotically inducible protein C  ali model follow..  22  1....DYDIPTTENLYFQGHMTIHKKGQAHGKGTVSTESGVLNQQPYGFNTRFEGEKGTNPEELIGAAHAACFSMALSLMLGEAGFTPTSIDTTADVSLDKVDAGFAITKIALKSEVAVPG-IDASTFDGIIQKAKAGCPVSQVLKAEITLDYQLK..... 157
12 -43.9001usp_A mol:protein length:139 ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN  ali model follow..  13  2..................ANVYTAEATATGGRAGTTRSSDDRLNLDLSVPAGDGGPGTNPEQLFAAGYAACFQGALGVVSRRQKIDVPA-DSTITARVGLQKAGLAFAL-DVELEGHFPG-LSREQAEGLMHAAHEVCPYSAATRNNVDVRLKVR..... 138
13 -43.7001ukk_A mol:protein length:142 Osmotically Inducible Protein C  ali model follow..  13  16..............................QGKGVMELQSQAFQGPYSYPSREEGEGTNPEELIAAAHAGCFSMALAASLEREGFPPKRVSTEARVHLEVVDGKPTLTRIELLTEAEVPG-ISSEKFLEIAEAAKEGCPVSRALAGVKEVVLTARLV... 142
14 -43.6002bjo_A mol:protein length:136 ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN OHRB  ali model follow..  16  2...................ALFTAKVTARGGRAGHITSDDGVLDFDIVMPNAAGQTGTNPEQLFAAGYAACFGGALEHVAKEQNIEIDS-EIEGQVSLMKDESDGGFKI-GVTLVVNTKD-LDREKAQELVNAAHEFCPYSKATRGNVDVKLELK..... 136
15 -43.4001n2f_A mol:protein length:142 Organic Hydroperoxide Resistance Protein  ali model follow..  18  5..................KALYTATATATGGRDGRAVSSDGVLDVKLSTPRGQGGAATNPEQLFAAGYSACFIGAMKFVAGQRKQTLPA-DASITGKVGIGQIPGGFGL-EVELHINLPG-MEREAAEALVAAAHQVCPYSNATRGNIDVRLNVSV.... 142
16 -43.3001zb8_A mol:protein length:143 organic hydroperoxide resistance protein  ali model follow..  16  1.............MNSLEKVLYTAIVTATGGRDGSVVSSDNVLNVKLSVPQGPGGSGTNPEQLFAAGYSACFIGALKFVANKEKVDLPA-EPRVEGRVGIGEIPGGFGL-VVELRIAVSG-MERSMLQTLVDKAHRVCPYSNATRGNIDVVLIL...... 141
17 -38.6002ql8_A mol:protein length:143 Putative redox protein  ali model follow..  12  9..................HPLYTTTAINDEELEGHAYIP-GGLKVQTSSP-MNDHPGTNPEQLLGLSLSTCLEATLEAVEKEHGLPHT---GAVRVKVAFIGARAEYQF-LVHAQVMVKG-VDFDTAKAFTNEIENRCPVSKLLKNSGNYTIET...... 137

FFAS is supported by the NIH grant R01-GM087218-01
6 1 0 4 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.