current user: public




Query: 1kqa_A mol:protein length:203 GALACTOSIDE O-ACETYLTRANSFERASE, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200
# Score Template Links and tools%idFirst MNMPMTERIRAGKLFTDMCEGLPEKRLRGKTLMYEFNHSHPSEVEKRESLIKEMFATVGENAWVEPPVYFSYGSNIHIGRNFYANFNLTIVDDYTVTIGDNVLIAPNVTLSVTGHPVHHELRKNGEMYSFPITIGNNVWIGSHVVINPGVTIGDNSVIGAGSIVTKDIPPNVVAAGVPCRVIREINDRDKHYYFKDYKVESSVLast
1 -103.0001kqa_A mol:protein length:203 GALACTOSIDE O-ACETYLTRANSFERASE  ali model  100  1MNMPMTERIRAGKLFTDMCEGLPEKRLRGKTLMYEFNHSHPSEVEKRESLIKEMFATVGENAWVEPPVYFSYGSNIHIGRNFYANFNLTIVDDYTVTIGDNVLIAPNVTLSVTGHPVHHELRKNGEMYSFPITIGNNVWIGSHVVINPGVTIGDNSVIGAGSIVTKDIPPNVVAAGVPCRVIREINDRDKHYYFKDYKVESSV 203
2 -96.6003v4e_A mol:protein length:202 Galactoside O-acetyltransferase  ali model follow..  40  4..MTEKEKMLAEKWYDANDQYLINERARAKDICFELNHTRPSATNKRKELIDQLFQTTTDNVSISIPFDTDYGWNVKLGKNVYVNTNCYFMDGGQITIGDNVFIGPNCGFYTATHPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKVVRKIDNDLPSETLNDETIK... 202
3 -96.4004dcl_A mol:protein length:207 Putative acetyltransferase SACOL2570  ali model follow..  40  1..MTEKEKMLAEKWYDANDQTLINERLRAKVICFALNHTNPSATLKRKVLIDALFQTTTDNVSISIPFDTDYGWNVKLGKNVYVNTNCYFMDGGQITIGDNVFIGPNCGFYTATHPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKVVRKIDNDLPSETLNDETIKLE. 201
4 -96.2004egg_A mol:protein length:207 Putative acetyltransferase SACOL2570  ali model follow..  39  1..MTEKEKMLAEKWYDANDQTLINERLRAKVICFALNHTNPVATMMRKVLIDALFQTTTDNVSISIPFDTDYGWNVKLGKNVYVNTNCYFMDGGQITIGDNVFIGPNCGFYTATHPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKVVRKIDNDLPSETLNDETIKLE. 201
5 -95.4003srt_A mol:protein length:188 Maltose O-acetyltransferase  ali model follow..  46  2NAMTEKEKMLSGKGYYANDELLVKEREYCKKLTRLFNNTLEDEYEKREDILRQLFGSVGKQINVEQNIRCDYGYNIHVGENFFANYDCIFLDVCKIEIGDNVMLAPNVQIYTAYHPIDAQLRNSGIEYGSPVKIGDNVWIGGGVIITPGITIGDNVVIGAGSVVTKDIPPNTVAVGNPCRVIKKIEE................ 188
6 -93.7002ic7_A mol:protein length:185 Maltose transacetylase  ali model follow..  41  2..KSEKEKMLAGHLYNPADLELVKERERARRLVRLYNETLETEYDKRTGLLKELFGSTGERLFIEPNFRCDYGYNIHVGENFFMNFDGVILDVCEVRIGDHCFIGPGVHIYTATHPLDPHERNSGLEYGKPVVIGHNVWIGGRAVINPGVTIGDNAVIASGAVVTKDVPANAVVGGNPAKVIKWLK................. 185
7 -92.9003ect_A mol:protein length:195 Hexapeptide-repeat containing-acetyltransfera  ali model follow..  34  4MKMSELEKMLKGEHFDGASAEIEALRSQAGRLKLEINQSLDEA--ERYALQRELFGHLGHKSCVQPPFHCEFGKTIRIGDHTFINMNVVMLDGAPITIGDHVLIGPSTQFYTASHSLDYRRRQAWETICKPIVIEDDVWIGGNVVINQGVTIGARSVVAANSVVNQDVPPDTLVGGTPARILRSLKDPAESMA.......... 194
8 -92.5003hjj_A mol:protein length:190 Maltose O-acetyltransferase  ali model follow..  38  3AMKTEKDKMLAGEMYIADDEELVADRVEAKRLTRLYNEAVETGDERRFTLLNQLLGSSADKAQINPDFRCDYGYNIHVGKSFFANFNCVILDVCEVRIGDHCMFAPGVHIYTATHPLHPVERNSGKEYGKPVKIGNNVWVGGGAIINPGVSIGDNAVIASGAVVTKDVPNNVVVGGNPAKVIKTIEE................ 190
9 -91.6001ocx_A mol:protein length:182 MALTOSE O-ACETYLTRANSFERASE  ali model follow..  43  2...TEKEKMIAGELYRSADETLSRDRLRARQLIHRYNHSLAEEHTLRQQILADLFGQVTE-AYIEPTFRCDYGYNIFLGNNFFANFDCVMLDVCPIRIGDNCMLAPGVHIYTATHPIDPVARNSGAELGKPVTIGNNVWIGGRAVINPGVTIGDNVVVASGAVVTKDVPDNVVVGGNPARIIKKL.................. 182
10 -59.4003jqy_B mol:protein length:252 Polysialic acid O-acetyltransferase  ali model follow..  26  19..KTQDSRLKTQDSFSVDDNDLVNSKENKVQFNGNNNKLIIEDDVECRWLTVIFRGDIHKNSKIKGDIVATKGSKVIIGRRTTIGAGFEVVDKCNVTIGHDCMIARDVILRASGHPIFDIHSKKRINWAKDIIISSYVWVGRNVSIMKGVSVGSGSVIGYGSIVTKDVPSMCAAAGNPAKIIKRNIIWARTDKAELISDDKR. 234
11 -50.2002wlc_A mol:protein length:215 POLYSIALIC ACID O-ACETYLTRANSFERASE  ali model follow..  19  10...GINNTINISTTSLTNATQLTVIGNNNSVYIGNNCKIVSSNIRLKGNNITLFIADDVEIMGLVCSLHSDCSLQIQ-AKTTMGNGEITIAEKGKISIGKDCMLAHGYEIRNTMHPIYSLENGERINHGKDVIIGNHVWLGRNVTILKGVCIPNNVVVGSHTVLYKSFKPNCVIAGSPAKIVKENIVWGRKMYHSTMYDDPTL 210
12 -38.5003vbi_A mol:protein length:205 Galactoside O-acetyltransferase  ali model follow..  21  18..............................................QEELKKIGFLSVGKNVLISKKASIYNPGVISIGNNVRIDDFCIL-GEVGIEMYDFANISSRTIVYAAIDDFSGNALMGPTIKTGKVILKKHVIIGAHSIIFPNVVIGEGVAVGAMSMVKESLDDWYIYVGVPVRKIKARKRKIVEL........... 189
13 -28.0003eev_A mol:protein length:212 Chloramphenicol acetyltransferase  ali model follow..  21  2....................................NAMNFFTSPFSGIPLDQQVTN-----------------NIIVGKHSYYS---ERDDVDKLVIGSFCSIGSGAVFMMAGNQGHRSDWISTFPFFYDTIIGHDVWIGTEAMIMPGVKIGHGAIIASRSVVTKDVAPYEVVGSNPAKHIKFRFSDV.............. 169
14 -27.6001xat_A mol:protein length:212 XENOBIOTIC ACETYLTRANSFERASE  ali model follow..  28  22..........................................................................NIRVGRYSYYS---DRDDVDKLVIGSFCSIGSGAAFIMAGNQGHRAEWASTFPFHFDTLIGHEVWIGTEAMFMPGVRVGHGAIIGSRALVTGDVEPYAIVGGNPARTIRKRFSDG.............. 168
15 -27.1001khr_A mol:protein length:209 STREPTOGRAMIN A ACETYLTRANSFERASE  ali model follow..  29  6....................................MKMYPIEGNKSVQFIKPILEKVGEYSYYDSKNGETFDKQILYHYPILND---------KLKIGKFCSIGPGVTIIMANHRMDGSTKLDQLPIKGDTIIGNDVWIGKDVVIMPGVKIGDGAIVAANSVVVKDIAPYMLAGGNPANEIKQRFDQD.............. 171
16 -27.1004hur_A mol:protein length:220 Virginiamycin A acetyltransferase  ali model follow..  25  13....................................ENILPIKGNRNLQFIKPTITNVGEYSYYDSKRGESFEDQVLYHYEVIGD---------KLIIGRFCSIGPGTTFIMANHRMDGSTSLKDLPLKGDIEIGNDVWIGRDVTIMPGVKIGDGAIIAAEAVVTKNVAPYSIVGGNPLKFIRKRFSDG.............. 177
17 -27.0003fs8_A mol:protein length:273 QdtC  ali model follow..  26  96........................................................QTGHKVTIREN--TKIGNNVKIGTLSDIQHHVYIGNYVNIIIKDFVWLFPHVVLTNDPTPPSNELL--------GVTIELFAVIAARSVVLPGIHINEDALVGAGAVVTKDVPKETVVVGNPAREICSIRKIKNK............ 230
18 -25.4004mfg_A mol:protein length:168 Putative acyltransferase  ali model follow..  26  1............................SNAMIRDYLEDKPL-VAKSADVIGNVKIGKDSSIWYNAVVRGDEG-PITIGENTNIQDCSIVHGDTETIIGNNVTVGHRSIVHGC-------------------KISDNVLIGMGSIILDNAEIGEYTLIGAGTLITKKFPPGVLIMGSPGKVVRELTEEDKKYIDESYE..... 157
19 -25.3003mqg_A mol:protein length:192 Lipopolysaccharides biosynthesis acetyltransf  ali model follow..  23  39....................................................................GCSLGQNVFVGNRVRIGNRVKIQNNVSVYDNDDVFCGPSMVFTNVYNPRAAIERKSEYR---DTIVRQGATLGANCTVVCGATIGRYAFVGAGAVVNKDVPDFALVVGVPARQIGWMSRHGEQ............ 162
20 -24.9002npo_A mol:protein length:207 Acetyltransferase  ali model follow..  17  63.........................RKKIYQKISENGFKIVNLIHKSALISPSAIVEENAGILIMPYVVIN--AKAKIEKGVILNTSSVI--EHECVIGEFSHVSVGAKCAGN------------------VKIGKNCFLGINSCVLPNLSLADDSILGGGATLVKNQDEKGVFVGVPAKRMEG................... 199
21 -24.8004m9c_A mol:protein length:216 Bacterial transferase hexapeptide (Three repe  ali model follow..  33  105........................................................EIGEGSLLCP--FTCLTSNIKIGKFFHANIYSYVAHDC--VIGDYVTFAPGAKC------------------NGNIHIEDHAYIGTGAVIKQGLIIGKGAIVGMGAVVTKSVPAGVTVVGNPARILER................... 215
22 -24.8004ea7_A mol:protein length:220 Perosamine N-acetyltransferase  ali model follow..  23  81....................................NRLRQKLGRKARDHGFSLVNAIHPSAVVSPSVRLGEGVAVWIGDLAIINTGAVV--DHDCRLGAACHLGPASALAGG------------------VSVGERAFLGVGARVIPGVTIGADTIVGAGGVVVRDLPDSVLAIGVPAKIKGD................... 218
23 -24.6003r8y_A mol:protein length:240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  33  106.........................................................IGDNAVIMMNATINIG--AVIGEGSMIDMNAVL--GGRATVGKNCHVGAGAVLAGVIEPPSAK----------PVIVEDDVVIGANVVVLEGVTVGKGAVVAAGAVVTEDVPPYTVVAGTPARVIKEIDEKTKA............ 225
24 -24.6003cj8_A mol:protein length:236 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  29  106.........................................................IGDQAVIMMGAILNIG--AVVGAGTMIDMGAVL--GGRATVGKHCHIGAGTVLAGVIEPPSAA----------PVVIENEVVIGANAVVLEGVRVGEGAVVAAGAVVVEDVPAHTVVAGVPAKVIKQIDDKTKS............ 225
25 -24.2004m98_A mol:protein length:208 Pilin glycosylation protein  ali model follow..  22  73....................................NRIRRQITENAAALGFKLPVLIHPDATVSPSAIIGQGSGSVLKDGVIVNTAATV--DHDCLLDAFVHISPGAHLSGN------------------TRIGEESRIGTGACSRQQTTVGSGVTAGAGAVIVCDIPDGMTVAGNPAKPL..................... 208
26 -24.0003bss_A mol:protein length:198 Acetyltransferase  ali model follow..  17  64.........................RKKIYQKISENGFKIVNLIHKSALISPSAIVEENAGILIMPYVVIN--AKAKIEKGVILNTSSVI--EHECVIGEFSHVSVGAKCAGN------------------VKIGKNCFLGINSCVLPNLSLADDSILGGGATLVKNQDEKGVFVGVPAKRM..................... 198
27 -23.7003vnp_A mol:protein length:183 Hypothetical conserved protein  ali model follow..  26  6..................................................YKGKTPQIAASAFIADY--VTITGDVVIGEETSIWFNTVI-DVAPTVIGNRVNIQDNSILHQPNNPIEDGVTVGHQVILHSAIVRKNALIGMGSIILDRAEIGEGAFIGAGSLVPKKIPPNTLALGRPAKVVRELTEDDIREMERIRR..... 157
28 -23.6001xhd_A mol:protein length:173 putative acetyltransferase/acyltransferase  ali model follow..  28  8..................................................YKEKKPKIASSAFIADY--VTITGDVYVGEESSIWFNTVI-DVSPTIIGDRVNVQDQCTLHQPQYPLILEDDVTVGHQVISCHIKKDALIGMGSIILDGAEIGEGAFIGAGSLVSKKIPPNTLAFGRPAKVIRELTAEDRKDMERIRT..... 159
29 -23.1005adx_V mol:protein length:165 DYNACTIN SUBUNIT 6  ali model follow..  15  1...........................................................SGNKVSRQSVLCGSQNIVLNGKTIVMNDCII-DLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIESYVHVGKNCVIGRRCVLKDCCKILDNTVLPPEVPPFTVFSGCPGLFSGELPECTQELMIDVTK..... 153
30 -22.8001v3w_A mol:protein length:173 ferripyochelin binding protein  ali model follow..  22  6..................................................INGKKPRIHPSAFVDENAVV----DVVLEEKTSVWPSAVL-DIEQIYVGKYSNVQDNVSIHTHGYPTEIGEYVTIGHNAM-AKVGNYVIIGISSVILDGAKIGDHVIIGAGAVVPKEIPDYSLVLGVPGKVVRQLTEEEIEWTKKNAE..... 157
31 -22.7004mzu_A mol:protein length:312 WxcM-like protein  ali model follow..  27  29.......................................................AVIGRNCNICA--NSLIENDVVIGDNVTIKSGVQIWDG--IHIQDDVFIGPNVTFTNDKQPRSKIYPDE-----LKTIVKKGASIGANSTILPGILIGENAMVGAGAVITKNVPDNAIVIGNPGRITGYVEANTGV............ 156
32 -21.8004n27_A mol:protein length:195 Bacterial transferase hexapeptide repeat  ali model follow..  27  44..........................................................................KVVVGENAGFWFGAVL-DNEPITIGADTNVQEQTIMHTIGFPLTIGAGCTIGHRAI-CTIGENTLIGMGAIVLNGAKVGKNCLIGAGTLVKMEIPDNSLVVGSPARVLRQLDDAAVE............ 166
33 -21.5003ixc_A mol:protein length:191 Hexapeptide transferase family protein  ali model follow..  17  23..................................................YAGVSPSVDSTAFIAGNARI----DVCIGKNASIWYGTVL-DVDKIEVGEGTNIQDNTVVHTDSM-IGKFVTIGHSCILHACTLGNNAFVGMGSIVMDRAVMEEGSMLAAGSLLTKIVKSGELWAGRPAKFLRMMTEEEILYLQKSAE..... 175
34 -20.5003tio_A mol:protein length:183 Protein YrdA  ali model follow..  22  7..................................................YRDLFPQIGQRVMIDDSSVV----DVRLADDVGIWPLVVI-DVHYVQIGARTNIQDGSMLHVT-HKSSYNPDGNPLTIGEDVTVGNRVLVGMGSILLDGAIVEDDVMIGAGSLVPKRLESGYLYLGSPVKQIRPLSDEEKAGLRYSAN..... 165
35 -20.2003r1w_A mol:protein length:189 carbonic anhydrase  ali model follow..  20  15..................................................YQGISPKLGERVFVDRSSVI----DVELGDDCSVWPLAVI-DMHHIRIGARTSVQDGSVLHIT-HASDYNPGGYPLIIGDDVTIGNRVLIGMKSMIMDGAIVEDEVIVAAGATVSKVLESGFVYMGTPAKKVRPITEKERSFFTYGAG..... 173
36 -20.2003r3r_A mol:protein length:187 ferripyochelin binding protein  ali model follow..  21  1........................................SNAMSDTLRPYKNLFPGIGQRVMIDTSSVV----DVRLADDVGIWPLVVI-DVNYVAIGARTNIQDGSVLHVT-HKSSSNPHGNPLIIGEDVTVGNRVLVGMGSIVLDGAIIEDDVMIGAGSLVPKRLESGYLYLGSPVKQIRPLSDAERSGLQYSAN..... 169
37 -20.0004n69_A mol:protein length:286 Serine Acetyltransferase Apoenzyme  ali model follow..  29  147...............................................................IANVFAVDIHPAARIGKGILFDHATGVVVGETAVIGNNVSILHHVTLGGTGHP----------------KIGDGVLIGAGATILGNIKIGEGAKVGAGSVVLIDVPPRTTAVGNPARLVGGKEKPSKHEDVPGESMDHTS 276
38 -19.5004hzd_A mol:protein length:282 CysE, serine acetyltransferase  ali model follow..  31  146...............................................................SSSIFQTDIHPAARLGSGLFLDHATGLVVGETAVVEDNVSILHGVTLGGTGHP----------------KIRQGVLIGAGAKILGNIQVGQCSKIAAGSVVLKSVPHNVTVAGVPARIIGETGCTE.............. 261
39 -19.5003mc4_A mol:protein length:287 WW/Rsp5/WWP domain:Bacterial transferase hexa  ali model follow..  31  153...............................................................SSSIFQTDIHPAARLGSGLFLDHATGLVVGETAVVEDNVSILHGVTLGGTGHP----------------KIRQGVLIGAGAKILGNIQVGQCSKIAAGSVVLKSVPHNVTVAGVPARIIGETGCTE.............. 268
40 -19.5001t3d_A mol:protein length:289 Serine acetyltransferase  ali model follow..  31  146...............................................................VSVTFQVDIHPAAKIGRGIMLDHATGIVVGETAVIENDVSILQSVTLGGTGHP----------------KIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQPVPPHTTAAGVPARIVGKPDSDK.............. 261
41 -19.4001s80_A mol:protein length:278 Serine acetyltransferase  ali model follow..  27  134...............................................................ISVAFDVDIHPAAKIGHGIMFDHATGIVVGETSVIENDVSILQGVTLGGTGHP----------------KVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVPEYATAAGVPARIVSQDKAAK.............. 249
42 -19.4003gvd_A mol:protein length:276 Serine acetyltransferase  ali model follow..  29  139...............................................................VSVAFGVDIHPAATIGCGIMLDHATGIVIGETAVVENDVSILQSVTLGGTGHP----------------KIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQSVPAHTTAAGVPARIVGKPESDK.............. 254
43 -19.4001ssq_A mol:protein length:267 Serine acetyltransferase  ali model follow..  27  132...............................................................ISVAFDVDIHPAAKIGHGIMFDHATGIVVGETSVIENDVSILQGVTLGGTGHP----------------KVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVPEYATAAGVPARIVSQDKAAK.............. 247
44 -19.3004h7o_A mol:protein length:281 Serine acetyltransferase  ali model follow..  29  136...............................................................ISVACQVDIHPAARIGRGIMLDHATGIVIGETAVVEDDVSILQDVTLGGTGHP----------------KIREGVMIGAGAKILGNIEVGEGAKIGSGSVVLQAVPPHTTVAGVPARIVGRPQSDK.............. 251
45 -18.2005adx_U mol:protein length:190 DYNACTIN 5  ali model follow..  19  26..........................................................................DVTIGPRTVIHPKARIIEAGPIVIGEGNLIEEQALIINAHPDNITPDAEDSEPKPMIIKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNEVIPENTVIYGADCLRRVQTERPQPQ............ 160
46 -17.9003tv0_A mol:protein length:194 Dynactin subunit 6  ali model follow..  19  30..........................................................................DVTIGPRTVIHPKARIIEAGPIVIGEGNLIEEQALIINAYPDNITPDTEDPEPKPMIIKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNEVIPENTVIYGADCLRRVQTERPQPQ............ 164
47 -17.4003kwc_A mol:protein length:229 Carbon dioxide concentrating mechanism protei  ali model follow..  15  10................PRGSHMAVQSYAAPPTPWSRDLAEPE-VHSFSNLIGDVRIKDYVHIAPGTSIRADEGTPFHIGSRTNIQDGVVI-QEYSVWIGDNVSITHMALIH-------------------PAYIGDGCFIGFRSTVF-NARVGAGCVVMMHVLIQEIPPGKYVPSGMVITTQQQADR................ 180
48 -17.3005afu_U mol:protein length:168 DYNACTIN  ali model follow..  18  14..........................................................................DVTIGPRTVIHPKARIIEAGPIVIGEGNLIEEQALIINAYPDNITPDTEKPMIIGQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNEVIPENTVIYGADCLRRVQTERP............... 141
49 -16.4001qq0_A mol:protein length:247 CARBONIC ANHYDRASE  ali model follow..  19  61........................................................VIDPTAYIDPQASV----EVTIGANVMVSPMASIRSDMPIFVGDRSNVQDGVVLHALGEPIEDNIVEVDGK-EYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFRYIPAGMVVTSQEADKLPEVTDDYAYSHTNEAVVYVN. 236
50 -15.0003f1x_A mol:protein length:310 Serine acetyltransferase  ali model follow..  24  176.................................................LIPRFITEMA---------HSETGIDIHIGHHFTIDHGTGVVIGATSIIGNNVKLYQGVTLGAKSFPLDNNGNPIKGIPRHPI-LEDDVIVYSNATILGRVTIGKGATVGGNIWVTENVPAGSIVQRKNKDELE.................... 304
51 -14.3003p47_A mol:protein length:315 Serine acetyltransferase  ali model follow..  23  156...............................................................MMESVHSYTSIDIHIKGHFFIDHGVGVVIGETAIIGEWCRIYQSVTLGAMHFQEEGGVIKRGTK-----TVGDYVTIGTGAKVLGNIIVGSHVRIGANCWIDRDVDSNQTVY............................ 269
52 -14.0003r0s_A mol:protein length:266 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  18  61................................VFSYAIVGDIPQDISYKEEQKSGVVIGKNATIREFATINSGTAKGDGFTRIGDNAFIMA-AHDCLLGNNIILANNATL--AGH----------------VELGDFTVVGGLTPIHQFVKVGEGCMIAGASALSQDIVPFCLAEGNRASI...................... 194
53 -13.9005dem_A mol:protein length:258 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  19  81........................................................VIGDHNVIREGVTIHRGTVQDRAETTIGDHNLIMA-GHDSVIGNHCILVNNTAL--AGH----------------VHVDDWAILSGYTLVHQYCRIGAHSFSGMGSAIGKDVPAYVTVFGNPAEAIHALRRAYKVVYRQGHTVEEAL 229
54 -13.9001j2z_A mol:protein length:270 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  23  82.........................................................IGEDNLIREFCMINPGTEGGIKKTLIGDKNLLMAYV-DCVIGSHCILANGVTL--AGH----------------IEIGDYVNIGGLTAIHQFVRIAKGCMIAGKSALGKDVPPYCTVEGNRAFIIDFIYALYKRLFRPIPSLRESA 228
55 -13.8003t57_A mol:protein length:305 UDP-N-acetylglucosamine O-acyltransferase dom  ali model follow..  18  82............................CNNIIGHHAVVGVKCQDLKYKHGDECFLCIGNNNEIREFCSIHRSSKTVIGDNNLIMGSCHIAHDCKI--GDRNIFANNTLL--AGH----------------VVVEDNTHTAGASVVHQFCHIGSFAFIGGGSVVSQDVPKYMMVAGERAELMKSLRAAYRKIFMSTETVSLSF 257
56 -13.8004r36_A mol:protein length:275 Putative acyl-[acyl-carrier-protein]--UDP-N-a  ali model follow..  27  26.......................................................AKIGENVEIAP--FVYIDRNVVIGDNNKIMANANILEESTAEIGDNNLIRENVTINRGAHDANGCIVGNSTKMAGEIIIDDNAIISANVLMHQFCRVGGYVMIQGGCRFSKDIPPYIIAGREPIEIIENIHNAYRIIYQSGLNTSDAL 240
57 -13.7004eqy_A mol:protein length:283 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  19  96........................................................VIGDRNTIREFTTIHTGTVQDAGVTTLGDDNWIMA-GHDCRVGSHVVLSSNAQM--AGH----------------VEIGDWAIVGGMSGVHQYVRIGAHSMLGGASALVQDIPPFVIAAGNKAEPISALRSAYRILYKNSLSLEEAK 244
58 -13.6004e6t_A mol:protein length:294 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  21  110........................................................EIGNNNLIREHCSLHRGTVQDNALTKIGSHNLLMV-AHDCIVGDHNIFANNVGV--AGH----------------VHIGDHVIVGGNSGIHQFCKIDSYSMIGGASLILKDVPAYVMASGNPAHAIQGLREAYKLIFKSGLTSVQAI 258
59 -13.6003hsq_A mol:protein length:259 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  19  69................................................................DLGFNQQLLTKTVIGDH-YSNIHKGTKEDSPTVIGNKNYFMGNSHVGHDCILGNNNILTHGAVLAGHVTLGNFAFISGLVAVHQFCFVGDYSMVAGLAKVVQDVPPYSTVDGNPSTVRNAIKHAYKVIYHSGISTRKAL 228
60 -13.6002jf2_A mol:protein length:264 ACYL-[ACYL-CARRIER-PROTEIN]--UDP-N-ACETYLGLUC  ali model follow..  21  87........................................................EIGDRNRIRESVTIHRGTVQGGGLTKVGSDNLLMINA-DCTVGNRCILANNATL--AGH----------------VSVDDFAIIGGMTAVHQFCIIGAHVMVGGCSGVAQDVPPYVIAQGNHATPITAIRNAYKLIYRSGKTLDEVK 235
61 -11.2002ggo_A mol:protein length:401 401aa long hypothetical glucose-1-phosphate t  ali model follow..  25  270........................................................EIGPNSYLRP--YTILVEKNKIGASVEVK-ESVIMEGSKIVIAEDVNFGAGVKVNVKGKRISSGRRKLG------AFIGGHVRTGINVTILPGVKIGAYARIYPGAVVNRDVGYGEFFK............................ 400
62 -11.1005e3p_A mol:protein length:302 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  13  83INLDGIFGLLNNVVWTNFGPCAVDGFALTRARLSRRGQVTVYSVDKFPRMVDYV---VPSGVRIGDADRVRLGAYLADGTTVFVNFNAGTLGASMVEVDDGTDVGGGASIMGTLSGGGQH----------VISLGKRCLLGANSGC--GIPLGDDCIIEAGLYITA---GTKVLFDGSLHKASTLAGSNGLIFRRD....... 272
63 -10.9003r5a_A mol:protein length:347 Tetrahydrodipicolinate N-succinyletransferase  ali model follow..  16  181.........................................................VPAGVRIADTARVRLGAYIGEGTTVFVNFNAGTEGPGMIEVGKGSDLGGGCSTMGTLSGGGNI----------VISVGEGCLIGANAGI--GIPLGDRNIVEAGLYITAGTKVALLDEQN.......................... 300
64 -10.8003tk8_A mol:protein length:316 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  25  165...............................................................VLMPSYTNIGAYVDEG---------TMVDTSCAQIGKNVHLSGGVGIGGVLEPLQAN----------PVIIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSIPASVVVAGN-AVIVKKVDAKTRA............ 305
65 -10.6002rij_A mol:protein length:387 Putative 2,3,4,5-tetrahydropyridine-2-carboxy  ali model follow..  15  203............................................DKFPRFLAHIIPEDN--TRILESSKVRMGASLAAGTTIYVNFNAGTTGACMVIVGEGSDVGGGASILGVLSGTSGN----------AISVGKACLLGANSVT--GIPLGDNCIVDAGIAVLEGTKFLLKDAEE.......................... 334
66 -10.4003eg4_A mol:protein length:304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  21  143...............................................................ILMPSFVNLGAYVDKG---------AMIDTSCAQIGKNVHLSGGVGIGGVLEPMQAG----------PTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSVPPYSVVV............................ 255
67 -10.3003bxy_A mol:protein length:285 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  21  127...............................................................VLMPSYVNIGAYVDEG---------TMVDTSCAQIGKNVHLSGGVGIGGVLEPLQAN----------PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSVPAGSVVVSGNAVIVKKVDAKTRG............ 267
68 -10.3001kgq_A mol:protein length:274 2,3,4,5-TETRAHYDROPYRIDINE-2-CARBOXYLATE N-SU  ali model follow..  21  122...............................................................VLMPSYVNIGAYVDEG---------TMVDTSCAQIGKNVHLSGGVGIGGVLEPLQAN----------PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSVPAGSVVVSGNAVIVKKVDAKTRG............ 262
69 -10.3003gos_A mol:protein length:276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  20  124...............................................................VLMPSYVNIGAFVDEG---------TMVDTSCAQIGKNVHLSGGVGIGGVLEPLQAN----------PTIIEDNCFVGARSEVVEGVIVEEGSVISMGVFIGQSVPAGSVVVSGNAVIVKKVDAKTRS............ 264
70 -10.3001hm0_A mol:protein length:468 N-ACETYLGLUCOSAMINE 1-PHOSPHATE URIDYLTRANSFE  ali model follow..  32  327........................................................TVGPYAHIRP--NSSLGAQVHIG-NFVEVKGSSIGENTKAYIGN-CEVGSNVNFGAGTITVNYDGKNK-----YKTVIGDNVFVGSNSTIIAPVELGDNSLVGAGSTITKDVPADAIAIGRGRQINKD................... 449
71 -10.3001g95_A mol:protein length:459 N-ACETYLGLUCOSAMINE-1-PHOSPHATE URIDYLTRANSFE  ali model follow..  32  324........................................................IVGPYAHIRP--NSSLGAQVHIG-NFVEVKGSSIGENTKAYIGN-CEVGSNVNFGAGTITVNYDGKNK-----YKTVIGNNVFVGSNSTIIAPVELGDNSLVGAGSTITKDVPADAIAIGRGRQINKD................... 446
72 -10.2003foq_A mol:protein length:503 Bifunctional protein glmU  ali model follow..  28  337.......................................................AAVGPFTYLRPG--TALGADGKLG-AFVEVKNSTIGTGTKVYVGD-ADIGEYSNIGASSVFVNYDGTSK-----RRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSA.......................... 453
73 -9.7502iu8_A mol:protein length:374 UDP-3-O-[3-HYDROXYMYRISTOYL] GLUCOSAMINE N-AC  ali model follow..  22  168........................................................TVGEHSYIHP--RVVIRERVSIGKRVIIQPGAVI-HLGKVIIEDDVEIGANTTIDRGR--FKHSVVREGSKIDNLVQIAHQVEVGGQAGITGHICIADHVIMMAQTGVTKSITSPGIYGGAPARKVRNLPRLEERIAALEKLVQ... 359
74 -9.6503fsx_A mol:protein length:332 Tetrahydrodipicolinate N-succinyltransferase  ali model follow..  15  104LNAGGLFGVLTNVVWTNHGPCAIDGFEAVRARLRRRGPVTVYGVDKFPRMVDYV---VPTGVRIADADRVRLGAHLAPGTTVFVNYNAGTLGASMVEVGDGSDVGGGASIMGTLSGGGTH----------VISIGKRCLLGANSGL--GISLGDDCVVEAGLYVTAG.................................... 267
75 -9.3604fce_A mol:protein length:459 Bifunctional protein GlmU  ali model follow..  22  191.....DNNNAQGEFYITDIIALAHADGKKIATVHPTRLSEVEGVNNRLQLLERVFQTLLAGVMLLDPSRFDLRGELTHGRDITIDTNVII--EGHVILGDRVRIGTGCVLSKAGHLSYLGDAEIGAGVNIKTIIGDDVFVGSDTQLVAPVTVANGATIGAGTTVTRDVAENELVISR.......................... 443

FFAS is supported by the NIH grant R01-GM087218-01
8 5 9 5 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ma H, Xiong H, Liu T, Zhang L, Godzik A., Zhang Z. Aggregate formation and synaptic abnormality induced by DSCR1. J Neurochem. 2004 Mar;88(6):1485-96.