current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

1kqaA
Query: 1kqa_A mol:protein length:203 GALACTOSIDE O-ACETYLTRANSFERASE, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200
# Score Template Links and tools%idFirst MNMPMTERIRAGKLFTDMCEGLPEKRLRGKTLMYEFNHSHPSEVEKRESLIKEMFATVGENAWVEPPVYFSYGSNIHIGRNFYANFNLTIVDDYTVTIGDNVLIAPNVTLSVTGHPVHHELRKNGEMYSFPITIGNNVWIGSHVVINPGVTIGDNSVIGAGSIVTKDIPPNVVAAGVPCRVIREINDRDKHYYFKDYKVESSVLast
1 -105.0001kqa_A mol:protein length:203 GALACTOSIDE O-ACETYLTRANSFERASE  ali model  100  1MNMPMTERIRAGKLFTDMCEGLPEKRLRGKTLMYEFNHSHPSEVEKRESLIKEMFATVGENAWVEPPVYFSYGSNIHIGRNFYANFNLTIVDDYTVTIGDNVLIAPNVTLSVTGHPVHHELRKNGEMYSFPITIGNNVWIGSHVVINPGVTIGDNSVIGAGSIVTKDIPPNVVAAGVPCRVIREINDRDKHYYFKDYKVESSV 203
2 -100.0003srt_A mol:protein length:188 Maltose O-acetyltransferase  ali model follow..  46  3.AMTEKEKMLSGKGYYANDELLVKEREYCKKLTRLFNNTLEDEYEKREDILRQLFGSVGKQINVEQNIRCDYGYNIHVGENFFANYDCIFLDVCKIEIGDNVMLAPNVQIYTAYHPIDAQLRNSGIEYGSPVKIGDNVWIGGGVIITPGITIGDNVVIGAGSVVTKDIPPNTVAVGNPCRVIKKIEE................ 188
3 -100.0003v4e_A mol:protein length:202 Galactoside O-acetyltransferase  ali model follow..  40  2NAMTEKEKMLAEKWYDANDQYLINERARAKDICFELNHTRPSATNKRKELIDQLFQTTTDNVSISIPFDTDYGWNVKLGKNVYVNTNCYFMDGGQITIGDNVFIGPNCGFYTATHPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKVVRKIDNDLPSETLNDETIK... 202
4 -99.8002ic7_A mol:protein length:185 Maltose transacetylase  ali model follow..  41  1.MKSEKEKMLAGHLYNPADLELVKERERARRLVRLYNETLETEYDKRTGLLKELFGSTGERLFIEPNFRCDYGYNIHVGENFFMNFDGVILDVCEVRIGDHCFIGPGVHIYTATHPLDPHERNSGLEYGKPVVIGHNVWIGGRAVINPGVTIGDNAVIASGAVVTKDVPANAVVGGNPAKVIKWLK................. 185
5 -99.3003ect_A mol:protein length:195 Hexapeptide-repeat containing-acetyltransfera  ali model follow..  34  4MKMSELEKMLKGEHFDGASAEIEALRSQAGRLKLEINQSLDEA--ERYALQRELFGHLGHKSCVQPPFHCEFGKTIRIGDHTFINMNVVMLDGAPITIGDHVLIGPSTQFYTASHSLDYRRRQAWETICKPIVIEDDVWIGGNVVINQGVTIGARSVVAANSVVNQDVPPDTLVGGTPARILRSLKDPAESMA.......... 194
6 -98.1003hjj_A mol:protein length:190 Maltose O-acetyltransferase  ali model follow..  38  4.MKTEKDKMLAGEMYIADDEELVADRVEAKRLTRLYNEAVETGDERRFTLLNQLLGSSADKAQINPDFRCDYGYNIHVGKSFFANFNCVILDVCEVRIGDHCMFAPGVHIYTATHPLHPVERNSGKEYGKPVKIGNNVWVGGGAIINPGVSIGDNAVIASGAVVTKDVPNNVVVGGNPAKVIKTIEE................ 190
7 -97.0001ocx_A mol:protein length:182 MALTOSE O-ACETYLTRANSFERASE  ali model follow..  42  1..STEKEKMIAGELYRSADETLSRDRLRARQLIHRYNHSLAEEHTLRQQILADLFGQVTE-AYIEPTFRCDYGYNIFLGNNFFANFDCVMLDVCPIRIGDNCMLAPGVHIYTATHPIDPVARNSGAELGKPVTIGNNVWIGGRAVINPGVTIGDNVVVASGAVVTKDVPDNVVVGGNPARIIKKL.................. 182
8 -74.4003jqy_B mol:protein length:252 Polysialic acid O-acetyltransferase  ali model follow..  25  17RLKTQDSRLKTQDSFSVDDNDLVNSKENKVQFNGNNNKLIIEDDVECRWLTVIFRGDIHKNSKIKGDIVATKGSKVIIGRRTTIGAGFEVVDKCNVTIGHDCMIARDVILRASGHPIFDIHSKKRINWAKDIIISSYVWVGRNVSIMKGVSVGSGSVIGYGSIVTKDVPSMCAAAGNPAKIIKRNIIWARTDKAELISDDKRC 235
9 -62.0002wlc_A mol:protein length:215 POLYSIALIC ACID O-ACETYLTRANSFERASE  ali model follow..  18  3.THMYSEQGINNTINISTTSQLTVIGNNNSVYIGNNCKIVSSNIRLKGNNITLFIADDVEIMGLVCSLHSDCSLQIQ-AKTTMGNGEITIAEKGKISIGKDCMLAHGYEIRTDMHPIYSLENGERINHGKDVIIGNHVWLGRNVTILKGVCIPNNVVVGSHTVLYKSFKENCVIAGSPAKIVKENIVWGRKMYHSTMYDDPTL 210
10 -59.8003r8y_A mol:protein length:240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  25  18.KKTPVKVYIKGDLKEVTFPETVQAFVNKKSGVSKYIVDYVVENDRRNSAI-PMLDLKGIKARIEPGAIVEIGDNAVIMMNATINIGAVIGEGSMITVGKNCHVGAGAVLAGVIEP----------PSAKPVIVEDDVVIGANVVVLEGVTVGKGAVVAAGAVVTEDVPPYTVVAGTPARVIKEIDEKTKAKTEIKQEL.... 233
11 -55.5003vbi_A mol:protein length:205 Galactoside O-acetyltransferase  ali model follow..  20  5.................................NLYFQGHMNSFYSQEELKKIGFLSVGKNVLISKKASIYNPGVISIGNNVRIDDFCILGGEVGIEMYDFANISSRTIVYAAIDDFSGNALQYKNVKTGKVILKKHVIIGAHSIIFPNVVIGEGVAVGAMSMVKESLDDWYIYVGVPVRKIKARKRKIVELENEFLKSMNS. 199
12 -53.3003cj8_A mol:protein length:236 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  20  41VFNNCKTGTLFGDWADV--KPFLEANKEKIEDYVVENDARNSAIPFLDGALIREKVEIGDQAVIMMGAILNIGAVV--GAGTMIDMGAVLGGRA--TVGKHCHIGAGTVLAGVIEPPS----------AAPVVIENEVVIGANAVVLEGVRVGEGAVVAAGAVVVEDVPAHTVVAGVPAKVIKQIDDKTKSKT.......... 227
13 -51.6001khr_A mol:protein length:209 STREPTOGRAMIN A ACETYLTRANSFERASE  ali model follow..  28  1...............................MGPNPMKMYPIEGNKSVQFIKPILEK-LENVEVGEYSYYDSKNGETFDKQILYHYPI---LNDKLKIGKFCSIGPGVTIIMNGHRMDGMPKLDQLPIKGDTIIGNDVWIGKDVVIMPGVKIGDGAIVAANSVVVKDIAPYMLAGGNPANEIKQRFDQDTINQLLDIK..... 180
14 -44.8001xat_A mol:protein length:212 XENOBIOTIC ACETYLTRANSFERASE  ali model follow..  23  2......................................GNYFESPFRGKLLSEQV--SNPNIRVGRYSYYSGYYHGHSFDDCARYLMPDRDDVDKLVIGSFCSIGSGAAFIMAGHRAEFAGAVNGYQPAGDTLIGHEVWIGTEAMFMPGVRVGHGAIIGSRALVTGDVEPYAIVGGNPARTIRKRFSDGDIQNLLEMA..... 177
15 -42.0003eev_A mol:protein length:212 Chloramphenicol acetyltransferase  ali model follow..  22  2....................................NAMNFFTSPFSGIPLDQQV--TNPNIIVGKHSYYSGYYHGHSFDDCVRYLHPERDDVDKLVIGSFCSIGSGAVFMMAGHRSDFADARDGFTRSGDTIIGHDVWIGTEAMIMPGVKIGHGAIIASRSVVTKDVAPYEVVGSNPAKHIKFRFSDVEIAMLLEMA..... 178
16 -41.1003tk8_A mol:protein length:316 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  20  103..................KAVLLSFRLEDNAPMPAGGYSQFYDKVPSKFANYTAEDFAAGGFRVVPPAIARRGSFIAKNVPSYTNIGAYVDEGTMVTVGSCAQIGKNVHLSGGVGIGGVLEPLQ----ANPVIIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVTYGRIPAGS................ 274
17 -40.0002npo_A mol:protein length:207 Acetyltransferase  ali model follow..  16  60....................................NEIRKKIYQKISENGFKIVNLIHKSALISPSAIVEENAGILIMPYVVINAK--------AKIEKGVILNTSSVIEHECVIGEFSHVSVGAKCAGNVKIGKNCFLGINSCVLPNLSLADDSILGGGATLVKNQDEKGVFVGVPAKRMEGGS................. 201
18 -39.9003mqg_A mol:protein length:192 Lipopolysaccharides biosynthesis acetyltransf  ali model follow..  25  35........................................................EIGEGCSLGQNVFV--GNRVRIGNRVKIQNNVSVYD--NVFLEDDVFCGPSMVFTNVYNPRAAIERKSEYR---DTIVRQGATLGANCTVVCGATIGRYAFVGAGAVVNKDVPDFALVVGVPARQIGWMSRHGEQ............ 162
19 -39.9003fsx_A mol:protein length:332 Tetrahydrodipicolinate N-succinyltransferase  ali model follow..  12  104LNAGGLFGVLTNVVWTNHGPCAIDGFEAVRARLRRRGPVTVYGVDKFPRMVDYV---VPTGVRIADADRVRLGAHLAVMHEGFVNYNAGTLGASMVRISAGVVVGDGSDVGGGASIMGTLSG----GGTHVISIGKRCLLGANSGL--GISLGDDCVVEAGLYVTAGTRVTMPDSNSVKA--RELSGSSNLLFRRNSVS.... 297
20 -38.1003bss_A mol:protein length:198 Acetyltransferase  ali model follow..  17  61....................................NEIRKKIYQKISENGFKIVNLIHKSALISPSAIVEENAGILIMPYVVINAK--------AKIEKGVILNTSSVIEHECVIGEFSHVSVGAKCAGNVKIGKNCFLGINSCVLPNLSLADDSILGGGATLVKNQDEKGVFVGVPAKRM..................... 198
21 -37.7002rij_A mol:protein length:387 Putative 2,3,4,5-tetrahydropyridine-2-carboxy  ali model follow..  14  160.LNGAFGLLSNVAWSDDKPIELEYLRANEMRLKMSNQYPKIDFVDKFPRFLAHIIPEDN--TRILESSKVRMGASLAAGTTIYVNFNAGTTGACMVRISSSAIVGEGSDVGGGASILGVLSG----TSGNAISVGKACLLGANSVT--GIPLGDNCIVDAGIAVLEGTKFLLKDAEELAKLNPYFNFDKEIYKGLELKGLNGL 360
22 -35.5003r5a_A mol:protein length:347 Tetrahydrodipicolinate N-succinyletransferase  ali model follow..  12  128.LSGIFPLLPNVAWTNIGAVDLAELAELQLEARLKGKLL---EVFSVDKFPKMTDYVVPAGVRIADTARVRLGAYITVMHEGFVNFNAGTEGPGMIRVSAGVFVGKGSDLGGGCSTMGTLSGGG----NIVISVGEGCLIGANAGI--GIPLGDRNIVEAGLYITAGTKVALLDEQNLVKVVKDLAGQPDLLFRRN....... 322
23 -27.5003fs8_A mol:protein length:273 QdtC  ali model follow..  26  96........................................................QTGHKVTIRENTKI--GNNVKIGTLSDIQHHVYIGNYVNIIIKDFVWLFPHVVLTNDPTPPSNEL--------LGVTIELFAVIAARSVVLPGIHINEDALVGAGAVVTKDVPKETVVVGNPAREICSIRKIKNK............ 230
24 -25.5001xhd_A mol:protein length:173 putative acetyltransferase/acyltransferase  ali model follow..  27  8..................................................YKEKKPKIASSAFIADYVTI----DVYVGEESSIWFNTVI-DVSPTIIGDRVNVQDQCTLHQSPQYPLILEDDVTVGHQVILHIKKDALIGMGSIILDGAEIGEGAFIGAGSLVSKKIPPNTLAFGRPAKVIRELTAEDRKDMERIRT..... 159
25 -25.4001v3w_A mol:protein length:173 ferripyochelin binding protein  ali model follow..  26  20............................................DENAVVIGDVVLEEKTSVWPSAVLRGDIE-QIYVGKYSNVQDNVSI-HGYPTEIGEYVTIGHNAMVHGA-------------------KVGNYVIIGISSVILDGAKIGDHVIIGAGAVVPKEIPDYSLVLGVPGKVVRQLTEEEIEWTKKNAE..... 157
26 -25.3003r1w_A mol:protein length:189 carbonic anhydrase  ali model follow..  20  15..................................................YQGISPKLGERVFVDRSSVI----DVELGDDCSVWPLAVI-DMHHIRIGARTSVQDGSVLHIT-HASDYNPGGYPLIIGDDVTIGNRVLIGMKSMIMDGAIVEDEVIVAAGATVSKVLESGFVYMGTPAKKVRPITEKERSFFTYGAG..... 173
27 -25.3003vnp_A mol:protein length:183 Hypothetical conserved protein  ali model follow..  26  6..................................................YKGKTPQIAASAFIADYVTI----DVVIGEETSIWFNTVI-DVAPTVIGNRVNIQDNSILHQSPNNPLIIEDGVTVGHQVILIVRKNALIGMGSIILDRAEIGEGAFIGAGSLVPKKIPPNTLALGRPAKVVRELTEDDIREMERIRR..... 157
28 -25.2003ixc_A mol:protein length:191 Hexapeptide transferase family protein  ali model follow..  19  37............................................AGNARIIGDVCIGKNASIWYGTVLRGDVD-KIEVGEGTNIQDNTVV-MHGDTVIGKFVTIGHSCILHAC-------------------TLGNNAFVGMGSIVMDRAVMEEGSMLAAGSLLTKIVKSGELWAGRPAKFLRMMTEEEILYLQKSAE..... 175
29 -25.1003r3r_A mol:protein length:187 ferripyochelin binding protein  ali model follow..  22  11..................................................YKNLFPGIGQRVMIDTSSVV----DVRLADDVGIWPLVVI-DVNYVAIGARTNIQDGSVLHVT-HKSSSNPHGNPLIIGEDVTVGNRVLVGMGSIVLDGAIIEDDVMIGAGSLVPKRLESGYLYLGSPVKQIRPLSDAERSGLQYSAN..... 169
30 -23.1003mc4_A mol:protein length:287 WW/Rsp5/WWP domain:Bacterial transferase hexa  ali model follow..  30  157...................................................................FQTDIHPAARLGSGLFLDHATGLVVGETAVVEDNVSILHGVTLGGTGHP----------------KIRQGVLIGAGAKILGNIQVGQCSKIAAGSVVLKSVPHNVTVAGVPARIIGETGCTEPSRVMDQMLGD... 279
31 -23.0001s80_A mol:protein length:278 Serine acetyltransferase  ali model follow..  26  138...................................................................FDVDIHPAAKIGHGIMFDHATGIVVGETSVIENDVSILQGVTLGGTGHP----------------KVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVPEYATAAGVPARIVSQDKAAKPAFDMNQYFIGIDD 263
32 -23.0003gvd_A mol:protein length:276 Serine acetyltransferase  ali model follow..  29  143...................................................................FGVDIHPAATIGCGIMLDHATGIVIGETAVVENDVSILQSVTLGGTGHP----------------KIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQSVPAHTTAAGVPARIVGKPESD............... 253
33 -22.8003eg4_A mol:protein length:304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  19  147.....................................................................SFVNLGAYVDKGAMIDTWATVGSCAQI--GKNVHLSGGVGIGGVLEPMQ----------AGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRATGEVFY....................... 245
34 -22.8001ssq_A mol:protein length:267 Serine acetyltransferase  ali model follow..  28  136...................................................................FDVDIHPAAKIGHGIMFDHATGIVVGETSVIENDVSILQGVTLGGTGHP----------------KVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVPEYATAAGVPARIVSQDKAA............... 246
35 -22.8001t3d_A mol:protein length:289 Serine acetyltransferase  ali model follow..  32  150...................................................................FQVDIHPAAKIGRGIMLDHATGIVVGETAVIENDVSILQSVTLGGTGHP----------------KIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQPVPPHTTAAGVPARIVGKPDSD............... 260
36 -22.5003TV0 Entity 1(prereleased)  ali follow..  19  30..........................................................................DVTIGPRTVIHPKARIIEAGPIVIGEGNLIEEQALIINAYPDNITPDTEDPEPKPMIIKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFIPENTVIYGADCLRRVQTERPQPQ............ 164
37 -21.9001kgq_A mol:protein length:274 2,3,4,5-TETRAHYDROPYRIDINE-2-CARBOXYLATE N-SU  ali model follow..  20  99.........................................................QKEGFRVVPPATVRQGAFIARN-PSYVNIGAYVDEGTMVQIGKNVHLSGGVGIGGVLEPLQ----------ANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTRIYDRETGECAVIVKKVDAKTRGK........... 263
38 -21.7003f1x_A mol:protein length:310 Serine acetyltransferase  ali model follow..  23  180..............................................................FITEMAHSETGIDIHIGHHFTIDHGTGVVIGATSIIGNNVKLYQGVTLGAKSFPLDNNGNPIKGIPRHP-ILEDDVIVYSNATILGRVTIGKGATVGGNIWVTENVPAGSRIVQRKNKDELE................... 304
39 -20.9003kwc_A mol:protein length:229 Carbon dioxide concentrating mechanism protei  ali model follow..  17  43............................................HSFSNLIGDVRIKDYVHIAPGTSIRADEGTPFHIGSRTNIQDGVVI-QEYSVWIGDNVSITHMALIH-------------------PAYIGDGCFIGFRSTVFNAR-VGAGCVVMMHVLIQDEIPPGVITTQQQADRLPNVEESDIHFAQHVVGINEAL 202
40 -20.4003gos_A mol:protein length:276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  21  101.........................................................QREGFRVVPPATVRKGAFIARNTPSYVNIGAFVDEGTMVQIGKNVHLSGGVGIGGVLEPLQ----------ANPTIIEDNCFVGARSEVVEGVIVEEGSVISMGVFIGQSTRIYDRETGE.......................... 223
41 -20.1003bxy_A mol:protein length:285 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  20  120.......................................................AFIARNTVLMPSY----NIGAYVDEGTMVDTWATV--GSCAQIGKNVHLSGGVGIGGVLEPLQ----------ANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGD.......................... 226
42 -20.0003p47_A mol:protein length:315 Serine acetyltransferase  ali model follow..  21  155..............................................................EMMESVHSYTSIDIHIKGHFFIDHGVGVVIGETAIIGEWCRIYQSVTLGAMHFQEEGGVIKRGTK--RHPTVGDYVTIGTGAKVLGNIIVGSHVRIGANCWIDRDVDSNVYISEHPTHFVKPCTTKGMK............ 287
43 -19.0001qq0_A mol:protein length:247 CARBONIC ANHYDRASE  ali model follow..  17  55..................................................PEPSAPVIDPTAYIDPQASV----EVTIGANVMVSPMASIRSDMPIFVGDRSNVQDGVVLHALETINEEGEPIED-GKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFRYIPAGMVVTSQEADKLPEVTDDYAYSHTNE....... 230
44 -14.9002jf2_A mol:protein length:264 ACYL-[ACYL-CARRIER-PROTEIN]--UDP-N-ACETYLGLUC  ali model follow..  21  88.........................................................IGDRNRIRESVTIHRGTVQGGGLTKVGSDNLLMINA-DCTVGNRCILANNATL--AGH----------------VSVDDFAIIGGMTAVHQFCIIGAHVMVGGCSGVAQDVPPYVIAQGNHATPITAIRNAYKLIYRSGKTLDEVK 235
45 -14.8003r0s_A mol:protein length:266 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  19  79................................................................EQKSGVVIGKNATIREFATINSG-TAKGDGFTRIGDNAFIMAYCHIAHDCLLGNNIILANNATLAGHVELGDFTVVGGLTPIHQFVKVGEGCMIAGASALSQDIVPFCLAEGNRASIVDRLSRAFKTLFRQGDLKENAK 232
46 -14.8003hsq_A mol:protein length:259 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  19  72...................................................................FNQQLLTKTVIGDHNIFREYSNIKEDSPTVIGNKNYFMGNSHVGHDCILGNNNILTHGAVLAGHVTLGNFAFISGLVAVHQFCFVGDYSMVAGLAKVVQDVPPYSTVDGNPSTVRNAIKHAYKVIYHSGISTRKAL 228
47 -14.6001j2z_A mol:protein length:270 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  23  82.........................................................IGEDNLIREFCMINPGTEGGIKKTLIGDKNLLMAYV-DCVIGSHCILANGVTL--AGH----------------IEIGDYVNIGGLTAIHQFVRIAKGCMIAGKSALGKDVPPYCTVEGNRAFIIDFIYALYKRLFRPIPSLRESA 228
48 -12.2002ggo_A mol:protein length:401 401aa long hypothetical glucose-1-phosphate t  ali model follow..  23  252........................................................EIKSGTYIEGPVYI--GKGSEIGPNSYLRPYTILVEKNKIVIAEDVNFGAGTLIANLRFEVKVNVKGKRISSGRGAFIGGHVRTGINVTILPGVKIGAYARIYPGAVVNRDVGYGEFFK............................ 400
49 -11.8002iu8_A mol:protein length:374 UDP-3-O-[3-HYDROXYMYRISTOYL] GLUCOSAMINE N-AC  ali model follow..  24  168........................................................TVGEHSYIHP--RVVIRERVSIGKRVIIQPGAVI-HLGKVIIEDDVEIGANTTIVQIAHQVEVGQHSAQAGIAGSTKIGNHVIIGGQAGITGHICIADHVIMMAQTGVTKSITSPGIYGGAPARKVRNLPRLEERIAALEKLVQK.. 360
50 -11.6003foq_A mol:protein length:503 Bifunctional protein glmU  ali model follow..  26  338........................................................AVGPFTYLRPG--TALGADGKLG-AFVEVKNSTIGTGTKVYVGD-ADIGEYSNIGASSVFVNYDGTSK-----RRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIE................... 460
51 -11.2001hm0_A mol:protein length:468 N-ACETYLGLUCOSAMINE 1-PHOSPHATE URIDYLTRANSFE  ali model follow..  32  327........................................................TVGPYAHIRPN--SSLGAQVHIG-NFVEVKGSSIGENTKAYIGN-CEVGSNVNFGAGTITVNYDGKNK-----YKTVIGDNVFVGSNSTIIAPVELGDNSLVGAGSTITKDVPADAIAIGRGRQINKD................... 449
52 -11.2002v0h_A mol:protein length:456 BIFUNCTIONAL PROTEIN GLMU  ali model follow..  21  325........................................................AIGPFSRLRPG--AELAAETHVG-NFVEIKKSTVGKGSKVYVGD-SEIGSNCNIGAGVITCNYDGANK-----FKTIIGDDVFVGSDTQLVAPVKVANGATIGAGTTITRDVGENELVITRVAQRHIQ................... 447
53 -11.2003fww_A mol:protein length:456 Bifunctional protein glmU  ali model follow..  24  325........................................................TVGPFARLRPG--AELAEGAHVG-NFVEIKKARLGKGSKAYLGD-AEIGAGVNIGAGTITCNYDGANK-----FKTIIGDDVFVGSDTQLVAPVTVANGATIGAGTTVTRDVAENELVISRVKQVHIQ................... 447
54 -11.1001g95_A mol:protein length:459 N-ACETYLGLUCOSAMINE-1-PHOSPHATE URIDYLTRANSFE  ali model follow..  32  324........................................................IVGPYAHIRPN--SSLGAQVHIG-NFVEVKGSSIGENTKAYIGN-CEVGSNVNFGAGTITVNYDGKNK-----YKTVIGNNVFVGSNSTIIAPVELGDNSLVGAGSTITKDVPADAIAIGRGRQINKD................... 446
55 -11.1001hv9_A mol:protein length:456 UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE  ali model follow..  24  325........................................................TIGPFARLRPG--AELLEGAHVG-NFVEMKKARLGKGSKAYLGD-AEIGDNVNIGAGTITCNYDGANK-----FKTIIGDDVFVGSDTQLVAPVTVGKGATIAAGTTVTRNVGENALAISRVPQTQKE................... 447
56 -11.1003c8v_A mol:protein length:496 Putative acetyltransferase  ali model follow..  18  302..........................................................................NAWMGKGSNAQENCYIINS---RLERNCVTAHGGKIINA-------------------HLGDMIFTGFNSFLSSPLKIGDGCVVMPHTIIDLEIPAGHLVWGYIRNK...................... 394
57 -10.5003eh0_A mol:protein length:341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac  ali model follow..  24  147........................................................KIGAGSRLWANVTI---HEIQIGQNCLIQSGTVV-QIGRVIIGDRVEIGACTTICQIAHNVVIGDNTGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMRPITPGVYSSGIPLQLVMNIDDMSKRLKSLERKVNQ.. 339
58 -10.5003pmo_A mol:protein length:372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac  ali model follow..  22  163........................................................VIGEGGWLAP--RVTLYHDVTIGARVSIQSGAVI-QIGGVTIGDDVEIGANTTIIMIAHNVQIGDHTACVGISGSAKIGRHCMLAGGVGLVGHIEICDNVFVTGMTMVTRSITEGSYSSGTAMQRIRQLDDMARRLQQLEKRLAA.. 355

FFAS is supported by the NIH grant R01-GM087218-01
6 1 2 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.