current user: public




Query: 1g6k_A mol:protein length:261 GLUCOSE 1-DEHYDROGENASE, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst MYKDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLANPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKFADPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMTQYPSFQAGRGLast
1 -110.0001g6k_A mol:protein length:261 GLUCOSE 1-DEHYDROGENASE  ali model  100  1MYKDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLANPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKFADPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMTQYPSFQAGRG 261
2 -110.0001rwb_A mol:protein length:261 Glucose 1-dehydrogenase  ali model follow..  98  1MYKDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTKTLALEYAPKGIRVNNIGPGAINTPINAEKFADPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMTLYPSFQAGRG 261
3 -109.0003aus_A mol:protein length:269 Glucose 1-dehydrogenase 4  ali model follow..  81  3MYTDLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNNEEEALDAKKEVEEAGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIKGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKFADPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQASYVTGITLFADGGMTKYPSFQAGRG 263
4 -94.1002uvd_A mol:protein length:246 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE  ali model follow..  38  2....LKGKVALVTGASRGIGRAIAIDLAKQGANVVVNYAGNEQKANEVVDEIKKLGSDAIAVRADVANAEDVTNMVKQTVDVFGQVDILVNNAGVTKDNLLMRMKEEEWDTVINTNLKGVFLCTKAVSRFMMRQR-HGRIVNIASVVGVTGNPGQANYVAAKAGVIGLTKTSAKELASRNITVNAIAPGFIATDMTDVL--DENIKAEMLKLIPAAQFGEAQDIANAVTFFASDQSKYITGQTLNVDGGMVM......... 246
5 -93.5002hq1_A mol:protein length:247 Glucose/ribitol dehydrogenase  ali model follow..  34  2...QLKGKTAIVTGSSRGLGKAIAWKLGNMGANIVLNGSPASTSLDATAEEFKAAGINVVVAKGDVKNPEDVENMVKTAMDAFGRIDILVNNAGITRDTLMLKMSEKDWDDVLNTNLKSAYLCTKAVSKIMLKQK-SGKIINITSIAGIIGNAGQANYAASKAGLIGFTKSIAKEFAAKGIYCNAVAPGIIKTDMTDVL--PDKVKEMYLNNIPLKRFGTPEEVANVVGFLASDDSNYITGQVINIDGGLVM......... 247
6 -93.4003oic_A mol:protein length:258 Enoyl-[acyl-carrier-protein] reductase [NADPH  ali model follow..  28  2....EQNKCALVTGSSRGVGKAAAIRLAENGYNIVINYARSKKAALETAEEIEKLGVKVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKNG-GGHIVSISSLGSIRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDALKHFPNREDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSKADMIRGQTIIVDGGRSL......... 248
7 -93.2003sj7_A mol:protein length:252 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  34  2....SMTKSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQANVADADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQR-SGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDAL--SDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGMYM......... 246
8 -92.6004jro_A mol:protein length:271 FabG protein  ali model follow..  36  21....LQGKVAVVTGGSRGIGRDIAINLAKEGANIFFNYNGSPEAAEETAKLVAEHGVEVEAMKANVAIAEDVDAFFKQAIERFGRVDILVNNAGITRDNLLMRMKEDEWDDVININLKGTFLCTKAVSRTMMKQR-AGKIINMASVVGLIGNAGQANYVASKAGVIGLTKTTARELAPRGINVNAVAPGFITTDMTDKL--DEKTKEAMLAQIPLGAYGTTEDIANAVLFLASDASKYITGQTLSVDGGMVM......... 265
9 -92.4001edo_A mol:protein length:244 BETA-KETO ACYL CARRIER PROTEIN REDUCTASE  ali model follow..  37  1......SPVVVVTGASRGIGKAIALSLGKAGCKVLVNYARSAKAAEEVSKQIEAYGGQAITFGGDVSKEADVEAMMKTAIDAWGTIDVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATKIMMKKR-KGRIINIASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDMTAKL--GEDMEKKILGTIPLGRTGQPENVAGLVEFLASPAASYITGQAFTIDGGIAI......... 244
10 -91.7004nbv_A mol:protein length:246 3-oxoacyl-[acyl-carrier-protein] reductase pu  ali model follow..  33  2...KLQGRVAIITGAAAGIGFATAQRFAEDGAIVVLCD-VQEARVREAAARLAATGATVSAYRVDVTRRDEVDAMVAAVLAAHQRVDILVNNAGITKDARLAKMTEAQFDAVIDVNLKGVFNCAQAVAGLMTEQG-KGVILNASSVVGLYGNFGQTNYAASKFGVIGFTKTWARELGPKGVRVNAVCPGFVNTEILQTV--PDKVLDGMTSSCWLRRLAEPAEIASIYAFLASDDASYVNGVAIEASGGMSL......... 246
11 -91.2004iin_A mol:protein length:271 3-ketoacyl-acyl carrier protein reductase (Fa  ali model follow..  37  20...QFTGKNVLITGASKGIGAEIAKTLASMGLKVWINYRSNAEVADALKNELEEKGYKAAVIKFDAASESDFIEAIQTIVQSDGGLSYLVNNAGVVRDKLAIKMKTEDFHHVIDNNLTSAFIGCREALKVMSKSR-FGSVVNVASIIGERGNMGQTNYSASKGGMIAMSKSFAYEGALRNIRFNSVTPGFIETDMNANL--KDELKADYVKNIPLNRLGSAKEVAEAVAFLLSDHSSYITGETLKVNGGLYM......... 265
12 -91.1004iiu_A mol:protein length:267 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  29  14FQSNAMSRSVLVTGASKGIGRAIARQLAADGFNIGVHYHRDAAGAQETLNAIVANGGNGRLLSFDVANREQCREVLEHEIAQHGAWYGVVSNAGIARDAAFPALSNDDWDAVIHTNLDSFYNVIQPCIMPMIGARQGGRIITLSSVSGVMGNRGQVNYSAAKAGIIGATKALAIELAKRKITVNCIAPGLIDTGMIEME---ESALKEAMSMIPMKRMGQAEEVAGLASYLMSDIAGYVTRQVISINGGML.......... 261
13 -91.0004nim_A mol:protein length:277 Versicolorin reductase  ali model follow..  27  3MGGQLKGKIAVITGSTQGLGAATARLFAERGAQGLVICGRSAEKGRAQAAGLEELGAKAVFVQVDLENVEDCRRIVAEADRAFGRLDILVNAAGLTDRGTILDTSPELFDRLFAVNTRAPFFLIQEAIKLFRRDRVEGAIVNVSSMSSMGGQPFIAAYCASKGALDTLTRNVAYSVLRNRIRVNSLNIGWMASDGEDRIQREANWLEEAVKTQPFGRLLDPAKVARAIAFLASEESGLMTGAIVNFDQSVWG......... 259
14 -90.8003woh_A mol:protein length:251 SiaM  ali model follow..  33  5GPGALSGKVALVTGGSRGLGRAMALRLARDGAAVAIVYVSDDSSAKETQGEIERLGGTARSYRCDVSDAEQVTRCVKAVTADLGPVDILVNNAGIIRDGLAASIKDEDYDAVMNTNLKGAFLFIKACYFGFIRKR-SGSIINISSVSGVFGSAGQANYASAKAGLIGLTKSIAKELAERNVRCNAVAPGLIATDMTQDLVDDSK----RLDPVPMRRFGRPDEVAGLVAFLAGDESSYITGQVVCVDGGMAM......... 251
15 -90.2004cr6_A mol:protein length:271 N-ACYLMANNOSAMINE 1-DEHYDROGENASE  ali model follow..  27  9RPGRLAGKAAIVTGAAGGIGRATVEAYLREGASVVAMD------LAPRLAATRYEEPGAIPIACDLADRAAIDAAMADAVARLGGLDILVAGGALKGGGNFLDLSDADWDRYVDVNMTGTFLTCRAGARAMVAAGRSARIITIGSVNSFMAEPEAAAYVAAKGGVAMLTRAMAVDLARHGILVNMIAPGPVDVTGNNTGYSEPRLAEQVLDEVALGRPGLPEEVATAAVFLAEDGSSFITGSTITIDGGLSAFGGMREGR. 270
16 -89.9004mow_A mol:protein length:256 Glucose 1-dehydrogenase  ali model follow..  38  4..SKLAGKVAIVTGASKGIGAAIAKALADEGAAVVVNYASSKAGADAVVSAITEAGGRAVAVGGDVSKAADAQRIVDTAIETYGRLDVLVNNSGVYEFAPIEAITEEHYRRQFDTNVFGVLLTTQAAVKHLGE---GASIINISSVVTSITPPASAVYSGTKGAVDAITGVLALELGPRKIRVNAINPGMIVTEGTHSAIIGSDLEAQVLGQTPLGRLGEPNDIASVAVFLASDDARWMTGEHLVVSGGL........... 249
17 -89.4004cql_A mol:protein length:261 ESTRADIOL 17-BETA-DEHYDROGENASE 8  ali model follow..  31  5LQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACD-LDRAAAQETVRLLGGPGGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKV--PQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM......... 261
18 -89.3004rzh_A mol:protein length:247 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  37  2..TALTAQVALVTGASRGIGKATALALAATGMKVVVNYAQSSTAADAVVAEIIANGGEAIAVQANVANADEVDQLIKTTLDKFSRIDVLVNNAGITRDTLLLRMKLEDWQAVIDLNLTGVFLCTKAVSKLMLKQK-SGRIINITSVAGMMGNPGQANYSAAKAGVIGFTKTVAKELASRGVTVNAVAPGFIATDMTENLNA-----EPILQFIPLARYGQPEEVAGTIRFLATDPAAYITGQTFNVDGGMVMF........ 247
19 -89.2004nbu_A mol:protein length:250 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  36  1MMSRLQDKVAIITGAANGIGLEAARVFMKEGAKVVIADFN-----EAAGKEAVEANPGVVFIRVDVSDRESVHRLVENVAERFGKIDILINNAGITRDSMLSKMTVDQFQQVINVNLTGVFHCTQAVLPYMAEQG-KGKIINTSSVTGTYGNVGQTNYAAAKAGVIGMTKTWAKELARKGINVNAVAPGFTETAMVAEV--PEKVIEKMKAQVPMGRLGKPEDIANAYLFLASHESDYVNGHVLHVDGGIMM......... 244
20 -89.0002pd6_A mol:protein length:264 Estradiol 17-beta-dehydrogenase 8  ali model follow..  32  1MQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACD-LDRAAAQETVRLLGGPGGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKV--PQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM......... 257
21 -88.7003gaf_A mol:protein length:256 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  33  9...HLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDL-KSEGAEAVAAAIRQAGGKAIGLECNVTDEQHREAVIKAALDQFGKITVLVNNAGGGGPKPF-DMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAG-GGAILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDALATVL-TPEIERAMLKHTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGGGVQ......... 253
22 -88.7001ahh_A mol:protein length:255 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  34  8...RLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDI-NADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPF-DMPMADFRRAYELNVFSFFHLSQLVAPEMEKNG-GGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVI-TPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQ......... 252
23 -88.6002p68_A mol:protein length:248 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  32  1MEIKLQGKVSLVTGSTRGIGRAIAEKLASAGSTVIITGTSGERAKAVAEEIANKYGVKAHGVEMNLLSEESINKAFEEIYNLVDGIDILVNNAGITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQR-WGRIVNISSVVGFTGNVGQVNYSTTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDMTAVL--SEEIKQKYKEQIPLGRFGSPEEVANVVLFLCSELASYITGEVIHVNGGM........... 247
24 -88.4002ph3_A mol:protein length:245 3-oxoacyl-[acyl carrier protein] reductase  ali model follow..  34  2.......RKALITGASRGIGRAIALRLAEDGFALAIHYGQNREKAEEVAEEARRRGSPLVAVGANLLEAEAATALVHQAAEVLGGLDTLVNNAGITRDTLLVRMKDEDWEAVLEANLSAVFRTTREAVKLMMKAR-FGRIVNITSVVGILGNPGQANYVASKAGLIGFTRAVAKEYAQRGITVNAVAPGFIETEMTERL--PQEVKEAYLKQIPAGRFGRPEEVAEAVAFLVSEKAGYITGQTLCVDGGLTPH........ 245
25 -88.3003ezl_A mol:protein length:256 Acetoacetyl-CoA reductase  ali model follow..  31  1MAMVMSQRIAYVTGGMGGIGTSICQRLHKDGFRVVAGCGPNSPRRVKWLEDQKALGFDFYASEGNVGDWDSTKQAFDKVKAEVGEIDVLVNNAGITRDVVFRKMTREDWQAVIDTNLTSLFNVTKQVIDGMVERGW-GRIINISSVNGQKGQFGQTNYSTAKAGIHGFTMSLAQEVATKGVTVNTVSPGYIGTDMVKAI--RPDVLEKIVATIPVRRLGSPDEIGSIVAWLASEESGFSTGADFSLNGGLHM......... 249
26 -88.2005epo_A mol:protein length:262 7-alpha-hydroxysteroid deydrogenase  ali model follow..  30  2..KRLEGKVAIVTSSTRGIGRASAEALAKEGALVYLAAR-SEELANEVIADIKKQGGVAKFVYFNAREEETYTSMVEKVAEAEGRIDILVNNYGGTNVNLLTAGDTDEFFRILKDNVQSVYLPAKAAIPHMEKVG-GGSIVNISTIGSVVPDISRIAYCVSKSAINSLTQNIALQYARKNIRCNAVLPGLIGTRAALENMTD-EFRDSFLGHVPLNRVGRPEDIANAVLYYASDDSGYVTGMIHEVAGGFAL......... 251
27 -88.2003pk0_A mol:protein length:262 Short-chain dehydrogenase/reductase SDR  ali model follow..  33  7...DLQGRSVVVTGGTKGIGRGIATVFARAGANVAVAGRSTADIDACVADLDQLGSGKVIGVQTDVSDRAQCDALAGRAVEEFGGIDVVCANAGVFPDAPLATMTPEQLNGIFAVNVNGTFYAVQACLDALIASG-SGRVVLTSSITGITGYPGWSHYGATKAAQLGFMRTAAIELAPHKITVNAIMPGNIMTEGLLEN--GEEYIASMARSIPAGALGTPEDIGHLAAFLATKEAGYITGQAIAVDGGQVL......... 253
28 -88.0003ak4_A mol:protein length:263 NADH-dependent quinuclidinone reductase  ali model follow..  32  9...DLSGRKAIVTGGSKGIGAAIARALDKAGATVAIADL-DVMAAQAVVAGL---ENGGFAVEVDVTKRASVDAAMQKAIDALGGFDLLCANAGVSTMRPAVDITDEEWDFNFDVNARGVFLANQIACRHFLASNTKGVIVNTASLAAKVGAPLLAHYSASKFAVFGWTQALAREMAPKNIRVNCVCPGFVKTAMQEREIIPEAVRAEYVSLTPLGRIEEPEDVADVVVFLASDAARFMTGQGINVTGGVRM......... 262
29 -87.9004ni5_A mol:protein length:254 Oxidoreductase, short-chain dehydrogenase/red  ali model follow..  36  1MAMRFKDKVVIVTGGASGIGEATARAFIREGAKVVI--ADFSDHGQQLADERAGAHEQALFIKTDVADTRAVQALIARTVENYGRLDIMFANAGIAADAPIDELDEAAWQKTIDINLTGVYLCDKYAIDQMRSQG-GGVIVNCGSIHSHVGKSGVTAYAAAKGGVKLLTQTLAIDYGPQNIRVNAVCPGYIDTPLLKNI--PDDKKQALVALHPMGRLGRAEEVANAVLFLASDEASFVNGASLLVDGGYTA......... 247
30 -87.8004is2_A mol:protein length:268 Bile acid 3-alpha hydroxysteroid dehydrogenas  ali model follow..  32  15..NLVQDKVTIITGGTRGIGFAAAKIFIDNGAKVSIFG-ETQEEVDTALAQLKELYPEVLGFAPDLTSRDAVMAAVGQVAQKYGRLDVMINNAGITSNNVFSRVSEEEFKHIMDINVTGVFNGAWCAYQCMKDAK-KGVIINTASVTGIFGSLSGVGYPASKASVIGLTHGLGREIIRKNIRVVGVAPGVVNTDMTNGN--PPEIMEGYLKALPMKRMLEPEEIANVYLFLASDLASGITATTVSVDGAY........... 260
31 -87.8004dml_A mol:protein length:269 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  39  18..LPLTDRIALVTGASRGIGRAIALELAAAGAKVAVNYASSAGAADEVVAAIAAAGGEAFAVKADVSQESEVEALFAAVIERWGRLDVLVNNAGITRDTLLLRMKRDDWQSVLDLNLGGVFLCSRAAAKIMLKQR-SGRIINIASVVGEMGNPGQANYSAAKAGVIGLTKTVAKELASRGITVNAVAPGFIATDMTSELAA-----EKLLEVIPLGRYGEAAEVAGVVRFLAADPAAYITGQVINIDGGLVM......... 262
32 -87.8003ndr_A mol:protein length:247 3-oxoacyl-(Acyl-carrier protein) reductase  ali model follow..  31  2..ERLAGKTALVTGAAQGIGKAIAARLAADGATVIVSDINA----EGAKAAAASIGKKARAIAADISDPGSVKALFAEIQALTGGIDILVNNASIVPFVAWDDVDLDHWRKIIDVNLTGTFIVTRAGTDQMRAAGKAGRVISIASNTFFAGTPNMAAYVAAKGGVIGFTRALATELGKYNITANAVTPGLIESDGVKAS-PHNEAFGFVEMLQAMKGKGQPEHIADVVSFLASDDARWITGQTLNVDAGMVRH........ 247
33 -87.7005er6_A mol:protein length:251 Oxidoreductase, short chain dehydrogenase/red  ali model follow..  30  3..ELLKEKLVLVTGAGRGLGAAISSGAAEQGARVILVDI-DGTAAKAQADALTAKGFVAEGHALDVTDRDAVAALADDILSRFGGLDVLVNNAGVARAAFDQPEAVEVWDRVIGVNLEGAFNVSHALVPALKAAK--GNVVHLCSVAGFVSGGSTAGYVVSKGAIRSLTQVMARDLAPHGIRVNAVAPGIMMSEMAVAQLNRPGGTDWFMNRVMMKRIGETSEVVDPVVFLASPMASYITGTILPVDGGFLA......... 250
34 -87.7004nbw_A mol:protein length:257 Short-chain dehydrogenase/reductase SDR  ali model follow..  31  2...STDKRVAIITGAANGIGRATALEFAQAGYHV-VAWDLAEEAGAALIAEIADAGGSADFARVDVSAAESVEAAVAEIIAEHGRVDVLVNNAGILHDGQLVKMAEAQFDAVISVNLKGVFLCTQAVAPHMIAAK-YGRILNASSVVGLYGNFGQTNYVAAKSGVIGMTKVWARELGRYGITVNAIAPGFIATEMVQQM--PERVLEAMVARTPVGRIGDPVDIARAYLFLASEESGFISGTTLSVDGGMVV......... 255
35 -87.6004yqy_A mol:protein length:270 Putative Dehydrogenase  ali model follow..  36  18...DLKGKTAIVTGGRGDIGRACVLELAARGANVAINYMASSEGADSAVAEIKAAGGNAFALQGDMTKEADVAALVEKTVKEFGQVDTLVHVGGLIARVTMSEMTLDHWQSVMDVNLTSFVLMVRECLPHMTEG---SSIVGLASQAGRDGGPGASAYGASKGALMTLTRGLAKELGPK-IRVNSLCPGMIDTDFHNIF-TKPEVRTHVANVSPVKREGTSEDVAKLAVFLASDDAAFITGANVDINGGMLF......... 263
36 -87.5003afm_A mol:protein length:258 Carbonyl reductase  ali model follow..  29  1MFPDLKGKRVLITGSSQGIGLATARLFARAGAKVGLHGRKAPANIDETIASMRADGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAAGQTSAVISTGSIAGHTGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDTAFHADK--TQDVRDRISNGIPMGRFGTAEEMAPAFLFFASHLASYITGQVLDINGGQYKH........ 258
37 -87.4004w7h_A mol:protein length:258 Carbonyl reductase  ali model follow..  29  1MFPDLKGKRVLITGSTEGIGLATARLFARAGAKVGLNSHVDPANIDETIASMRADGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAAGQTSAVISTGSIAGHTGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDTAFHADK--TQDVRDRISNGIPMGRFGTAEEMAPAFLFFASHLASYITGQVLDINGGQYKH........ 258
38 -87.4001zem_A mol:protein length:262 xylitol dehydrogenase  ali model follow..  30  1MSKKFNGKVCLVTGAGGNIGLATALRLAEEGTAIALLDM-NREALEKAEASVREKGVEARSYVCDVTSEEAVIGTVDSVVRDFGKIDFLFNNAGYQGAAPVQDYPSDDFARVLTINVTGAFHVLKAVSRQMITQN-YGRIVNTASMAGVKGPPNMAAYGTSKGAIIALTETAALDLAPYNIRVNAISPGYMGPGFMWERQVEKVVAQQMIGSVPMRRYGDINEIPGVVAFLLGDDSSFMTGVNLPIAGG............ 262
39 -87.4003lyl_A mol:protein length:247 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  33  2...SLNEKVALVTGASRGIGFEVAHALASKGATV-VGTATSQASAEKFENSMKEKGFKARGLVLNISDIESIQNFFAEIKAENLAIDILVNNAGITRDNLMMRMSEDEWQSVINTNLSSIFRMSKECVRGMMKKR-WGRIISIGSVVGSAGNPGQTNYCAAKAGVIGFSKSLAYEVASRNITVNVVAPGFIATDMTDKL--TDEQKSFIATKIPSGQIGEPKDIAAAVAFLASEEAKYITGQTLHVNGGMYM......... 246
40 -87.3001h5q_A mol:protein length:265 NADP-DEPENDENT MANNITOL DEHYDROGENASE  ali model follow..  30  11...SFVNKTIIVTGGNRGIGLAFTRAVAAAGANVAVIYRSAADAVEVTEKVGKEFGVKTKAYQCDVSNTDIVTKTIQQIDADLGPISGLIANAGVSVVKPATELTHEDFAFVYDVNVFGVFNTCRAVAKLWLQKQQKGSIVVTSSMSSQIGSLTQVFYNSSKAACSNLVKGLAAEWASAGIRVNALSPGYVNTDQTAHM--DKKIRDHQASNIPLNRFAQPEEMTGQAILLLSDHATYMTGGEYFIDGGQLIW........ 265
41 -87.3004k6c_A mol:protein length:255 Acetoacetyl-CoA reductase  ali model follow..  31  2...AMTKRIAVVTGGMGGLGEAVSIRLNDAGHRVVVTYSPNNTGADRWLTEMHAAGREFHAYPVDVADHDSCQQCIEKIVRDVGPVDILVNNAGITRDMTLRKLDKVNWDAVIRTNLDSVFNMTKPVCDGMVERGW-GRIVNISSVNGSKGSVGQTNYAAAKAGMHGFTKSLALEIARKGVTVNTVSPGYLATKMVTAI-PQDILDTKILPQIPAGRLGKPEEVAALVAYLCSEEAGFVTGSNIAINGGQHMH........ 249
42 -87.3003i4f_A mol:protein length:264 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  27  1MSLGRFVRHALITAGTKGLGKQVTEKLLAKGYSVTVTYHSDTTAMETMKETYKDVEERLQFVQADVTKKEDLHKIVEEAMSHFGKIDFLINNAGVFERKKLVDYEEDEWNEMIQGNLTAVFHLLKLVVPVMRKQNF-GRIINYGGADSAPGWIYRSAFAAAKVGLVSLTKTVAYEEAEYGITANMVCPGDIIGEMKEAT--IQEARQLKEHNTPIGRSGTGEDIARTISFLCEDDSDMITGTIIEVTGAVDV......... 253
43 -87.2003rih_A mol:protein length:293 short chain dehydrogenase or reductase  ali model follow..  31  29VMFDLSARSVLVTGGTKGIGRGIATVFARAGANVAVAARSPRELSSVTAELGELGAGNVIGVRLDVSDPGSCADAARTVVDAFGALDVVCANAGIFPEARLDTMTPEQLSEVLDVNVKGTVYTVQACLAPLTASG-RGRVILTSSITGVTGYPGWSHYGASKAAQLGFMRTAAIELAPRGVTVNAILPGNILTEGLVDM--GEEYISGMARSIPMGMLGSPVDIGHLAAFLATDEAGYITGQAIVVDGGQVL......... 278
44 -87.2003edm_A mol:protein length:259 Short chain dehydrogenase  ali model follow..  32  4..QRFTNRTIVVAGAGRDIGRACAIRFAQEGANVVLTYNGAAEGAATAVAEIEKLGRSALAIKADLTNAAEVEAAISAAADKFGEIHGLVHVAGLIARKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAK---GGAIVTFSSQAGRDGGPGALAYATSKGAVMTFTRGLAKEVGPK-IRVNAVCPGMISTTFHDTF-TKPEVRERVAGATSLKREGSSEDVAGLVAFLASDDAAYVTGACYDINGGVLFSEG...... 253
45 -87.1003vzp_A mol:protein length:257 Acetoacetyl-CoA reductase  ali model follow..  31  6....STQRIAYVTGGMGGIGTAICQRLAKDGFRVVAGCGPNSPRREKWLEQQKALGFDFIASEGNVADWDSTKTAFDKVKSEVGEVDVLINNAGITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMADRGW-GRIVNISSVNGQKGQFGQTNYSTAKAGLHGFTMALAQEVATKGVTVNTVSPGYIATDMVKAI--RQDVLDKIVATIPVKRLGLPEEIASICAWLSSEESGFSTGADFSLNGGLHM......... 250
46 -87.1004qec_A mol:protein length:248 ElxO  ali model follow..  28  2......KKNVLITGGFKGIGKQVALEFLKNDYHVCITS-RYFEKEKRIPHLFSSYEENISFYQLDVTDEEQVNEIINKIVKKFGRLDVLVNNAGISSDGLLTETKTTDFNKMINTNILGTYFCMKYALKHMQKVS-CGAIVNISSITGLSGFPYSILYGSTKHAVIGLTKGAAVEFADKGIKINAVAPGIIKTETLQKEIDSGESEDSISSIHPMQKLGTTLDVAKGIYFLANEDNNFITGHVLSIDGGYLS......... 247
47 -87.0002c07_A mol:protein length:285 3-OXOACYL-(ACYL-CARRIER PROTEIN) REDUCTASE  ali model follow..  29  28YYYCGENKVALVTGAGRGIGREIAKMLAKSVSHV-ICISRTQKSCDSVVDEIKSFGYESSGYAGDVSKKEEISEVINKILTEHKNVDILVNNAGITRDNLFLRMKNDEWEDVLRTNLNSLFYITQPISKRMINNR-YGRIINISSIVGLTGNVGQANYSSSKAGVIGFTKSLAKELASRNITVNAIAPGFISSDMTDKI--SEQIKKNIISNIPAGRMGTPEEVANLACFLSSDKSGYINGRVFVIDGGLS.......... 274
48 -87.0004npc_A mol:protein length:265 Sorbitol dehydrogenase  ali model follow..  32  15...PLSEKVAIVTGGASGIGAAISKAFIAKGAKVAVLDIS----ADIAKAKAEELGENAKPFVCDVSSQQSVNDAITAVISQFGKIDIAVNSAGVVYLAPAEDISLDYWDKTININLKGSFLVTQAVGRAMIAAGNGGKIINLASQAGTVAIEEHVAYCASKFGVIGMSKTFAAEWGKYGICVNTLSPTIVLTELGKKAWAG-EKGEAAKKRIPAGRFAYPEEIAAAAVFLASAGADMITGADLLIDGGYTI......... 258
49 -86.9001k2w_A mol:protein length:256 SORBITOL DEHYDROGENASE  ali model follow..  26  2...RLDGKTALITGSARGIGRAFAEAYVREGARVAIADI-NLEAARATAAEI---GPAACAIALDVTDQASIDRCVAELLDRWGSIDILVNNAALFDLAPIVEITRESYDRLFAINVSGTLFMMQAVARAMIAGGRGGKIINMASQAGRRGEALVGVYCATKAAVISLTQSAGLNLIRHGINVNAIAPGVVDGEHWDGVDAKGEKKRQVGAAVPFGRMGRAEDLTGMAIFLATPEADYIVAQTYNVDGGNWM......... 255
50 -86.9004weo_A mol:protein length:266 Putative acetoin(Diacetyl) reductase  ali model follow..  30  3MTAPLEGQVAIVTGGARGIGRGIALTLAGAGANILLADL-LDDALDATAREVRALGRRAAIAKVDVTQAAQVDAMVAQALADLGGLDILVNCAGVISIHPVAELTERDWDFVMNVNAKGTFLGCRAALAHLKAQG-RGRIINVASIAGKEGFPNLAHYSASKFAVVGFTNALAKELARDGVTVNAICPGIVRTYMWDRLSDEQSWQRHQLTLIPQGRAQTPEDMGRLALFFATM--DNVTGQAVNVDGGFTFH........ 260
51 -86.8003qiv_A mol:protein length:253 short-chain dehydrogenase or 3-oxoacyl-[acyl-  ali model follow..  30  6...RFENKVGIVTGSGGGIGQAYAEALAREGAAVVVADI-NAEAAEAVAKQIVADGGTAISVAVDVSDPESAKAMADRTLAEFGGIDYLVNNAAIMKLDFLLTIDPEYYKKFMSVNLDGALWCTRAVYKKMTKRG-GGAIVNQSST---AAWLYSNYYGLAKVGINGLTQQLSRELGGRNIRINAIAPGPIDTEANRTTT-PKEMVDDIVKGLPLSRMGTPDDLVGMCLFLLSDEASWITGQIFNVDGGQII......... 251
52 -86.8004e6p_A mol:protein length:259 Probable sorbitol dehydrogenase (L-iditol 2-d  ali model follow..  28  2MMKRLEGKSALITGSARGIGRAFAEAYVREGATVAIADI-DIERARQAAAEI---GPAAYAVQMDVTRQDSIDAAIAATVEHAGGLDILVNNAALFDLAPIVEITRESYEKLFAINVAGTLFTLQAAARQMIAQGRGGKIINMASQAGRRGEALVAIYCATKAAVISLTQSAGLDLIKHRINVNAIAPGVVDGEHWDGVRPRGEKKRLVGEAVPFGRMGTAEDLTGMAIFLASAESDYIVSQTYNVDGGNWM......... 258
53 -86.7004nbt_A mol:protein length:240 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  38  2..KKLEGKVAVITGGAKGLGQAIALAYAEEGAKVIAGDLG----------DLTYSHPNVEGMYLNVTDVTGVEKFYQSVIDKYGKIDILVNNAGITKDAMTRKMTEAQWDAVIDVNLKGVFNLTRLVGPQMQTNG-YGSIINISSVVGVFGNIGQANYAATKAGVIGLTMTWAKEFALKGVRVNAIAPGYIMTDILKTV--PQDLLDKFAALTMLNRLGQPEEIAKVALFLASDDASYVTGQTINVNGGMRL......... 240
54 -86.7002d1y_A mol:protein length:256 hypothetical protein TT0321  ali model follow..  34  2..GLFAGKGVLVTGGARGIGRAIAQAFAREGALVALCDLR--PEGKEVAEAI-----GGAFFQVDLEDERERVRFVEEAAYALGRVDVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVG-GGAIVNVASVQGLFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAIDPERTRRDWEDLHALRRLGKPEEVAEAVLFLASEKASFITGAILPVDGGMTA......... 247
55 -86.5002ew8_A mol:protein length:249 (S)-1-Phenylethanol dehydrogenase  ali model follow..  28  1MTQRLKDKLAVITGGANGIGRAIAERFAVEGADIAIADL---VPAPEAEAAIRNLGRRVLTVKCDVSQPGDVEAFGKQVISTFGRCDILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNG-WGRIINLTSTTYWLKIEAYTHYISTKAANIGFTRALASDLGKDGITVNAIAPSLVRTATTEASALSAMFDVLPNMLQAIPRLQVPLDLTGAAAFLASDDASFITGQTLAVDGGMVRH........ 249
56 -86.5004tkl_A mol:protein length:258 NADH-dependent reductase for 4-deoxy-L-erythr  ali model follow..  29  1MFSDLKGKRILITGSTEGIGMATAIELARYGAVVGLNSHVDPADPALLLGKLREAGGDGAFFRADITKTAECQRLVSAFVERFDGIDVLINNAGLAGRSNLENIDDAFYDRVMDLNGRSVLMMTKFAIPHLRASGTTSAVISTGSIAAREGGIGAGVYAASKAWLHDIHRNWVKEFTKDSIRFNIVAPGTVDTAFHADK--SDELKTRIANSIPMGRFGTVQELAPAYVFFASHAASYITGQILDVNGGQIC......... 257
57 -86.4004w7i_A mol:protein length:258 4-deoxy-L-erythro-5-hexoseulose uronate reduc  ali model follow..  29  1MFSDLKGKRILITGSSQGIGMATAIELARYGAVVGLHGRKAPADPALLLGKLREAGGDGAFFRADITKTAECQRLVSAFVERFDGIDVLINNAGLAGRSNLENIDDAFYDRVMDLNGRSVLMMTKFAIPHLRASGTTSAVISTGSIAAREGGIGAGVYAASKAWLHDIHRNWVKEFTKDSIRFNIVAPGTVDTAFHADK--SDELKTRIANSIPMGRFGTVQELAPAYVFFASHAASYITGQILDVNGGQIC......... 257
58 -86.3004n5l_A mol:protein length:270 Acetoacetyl-CoA reductase  ali model follow..  30  15FQGAMTQRIAYVTGGMGGIGTAICQRLAKDGFRVVAGCGPNSPRREKWLEQQKALGFDFIASEGNVADWDSTKTAFDKVKSEVGEVDVLINNAGITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMADRGW-GRIVNISSVNGQKGQFGQTNYSTAKAGLHGFTMALAQEVATKGVTVNTVSPGYIATDMVKAI--RQDVLDKIVATIPVKRLGLPEEIASICAWLSSEESGFSTGADFSLNGGLHM......... 263
59 -86.2002cfc_A mol:protein length:250 2-(R)-HYDROXYPROPYL-COM DEHYDROGENASE  ali model follow..  31  2......SRVAIVTGASSGNGLAIATRFLARGDRVAALDLSAETLEETARTHWHAYADKVLRVRADVADEGDVNAAIAATMEQFGAIDVLVNNAGITGNGVLHTTPVEQFDKVMAVNVRGIFLGCRAVLPHMLLQG-AGVIVNIASVASLVAFPGRSAYTTSKGAVLQLTKSVAVDYAGSGIRCNAVCPGMIETPMTQWRLDQPELRDQVLARIPQKEIGTAAQVADAVMFLAGEDATYVNGAALVMDGAYT.......... 248
60 -86.2003ftp_A mol:protein length:270 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  36  16MDKTLDKQVAIVTGASRGIGRAIALELARRGAMV-IGTATTEAGAEGIGAAFKQAGLEGRGAVLNVNDATAVDALVESTLKEFGALNVLVNNAGITQDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKAR-GGRIVNITSVVGSAGNPGQVNYAAAKAGVAGMTRALAREIGSRGITVNCVAPGFIDTDMTKGL--PQEQQTALKTQIPLGRLGSPEDIAHAVAFLASPQAGYITGTTLHVNGGMFM......... 263
61 -86.2003o38_A mol:protein length:266 Short chain dehydrogenase  ali model follow..  31  20....LKGKVVLVTAAATGIGSTTARRALLEGADVVISDY-HERRLGETRDQLADLGGRVEAVVCDVTSTEAVDALITQTVEKAGRLDVLVNNAGLGGQTPVVDMTDEEWDRVLNVTLTSVMRATRAALRYFRGVDHGGVIVNNASVLGWRAQHSQSHYAAAKAGVMALTRCSAIEAVEFGVRINAVSPSIARHKFLEKT-SSSELLDRLASDEAFGRAAEPWEVAATIAFLASDYSSYMTGEVVSVSSQRA.......... 266
62 -86.1003wtc_A mol:protein length:262 Putative oxidoreductase  ali model follow..  28  5...SLSGKIAAVTGAAQGIGKAIALRLAKDGADVILLDV-KQDTLAETAKEVEALGRRAVALTADISNRDQFRSTLADAAKTLGGLDIMVNNAGICQVKPILDIEPAEIEKIFSINVQGVLWGMQAAATLFKEKGTKGKIINACSIAGHEGYPLLGAYSATKFAVRALTQSAAKELASSGITVNSYCPGIVGTDMWVTIDKRGATYKKYVEGIALGRVETADDVAGFVAYLSSSDADYMTGQSVLIDGGLVF......... 261
63 -86.1004afn_A mol:protein length:269 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE FA  ali model follow..  31  15QSMSLQGKVALVTGASRGIGQAIALELGRLGAVV-IGTATSASGAEKIAETLKANGVEGAGLVLDVSSDESVAATLEHIQQHLGQPLIVVNNAGITRDNLLVRMKDDEWFDVVNTNLNSLYRLSKAVLRGMTKAR-WGRIINIGSVVGAMGNAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTREL--PEAQREALLGQIPLGRLGQAEEIAKVVGFLASDGAAYVTGATVPVNGGMYM......... 262
64 -86.1004m8s_A mol:protein length:248 Putative 3-oxoacyl-[acyl-carrier protein] red  ali model follow..  31  5...DLSGKIALVTGASRGIGAAIADTLAAAGAKV-IGTATSESGAAAISERLAQWGGEGRVL--NSAEPETVENLIADIEKTFGKLDILVNNAGITRDNLLMRMKEEEWDDIMQVNLKSVFRASKAVLRGMMKQR-AGRIINITSVVGVMGNAGQTNYAAAKAGLIGFSKSMAREVGSRGITVNCVAPGFIDTDMTRAL--PEETRQTFTAQTALGRFGDAQDIADAVLFLASDQAKYITGQTLHVNGGMLM......... 247
65 -86.0001geg_A mol:protein length:256 ACETOIN REDUCTASE  ali model follow..  33  2......KKVALVTGAGQGIGKAIALRLVKDGFAVAIADY-NDATAKAVASEINQAGGHAVAVKVDVSDRDQVFAAVEQARKTLGGFDVIVNNAGVAPSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKEGHGGKIINACSQAGHVGNPELAVYSSSKFAVRGLTQTAARDLAPLGITVNGYCPGIVKTPMWAEIDRQGYGTAEFAKRITLGRLSEPEDVAACVSYLASPDSDYMTGQSLLIDGGMVF......... 255
66 -86.0003awd_A mol:protein length:260 Putative polyol dehydrogenase  ali model follow..  29  10...RLDNRVAIVTGGAQNIGLACVTALAEAGARVIIADL-DEAMATKAVEDLRMEGHDVSSVVMDVTNTESVQNAVRSVHEQEGRVDILVACAGICSEVKAEDMTDGQWLKQVDINLNGMFRSCQAVGRIMLEQK-QGVIVAIGSMSGLIVNQQQAAYNASKAGVHQYIRSLAAEWAPHGIRANAVAPTYIETTLTRFGMEKPELYDAWIAGTPMGRVGQPDEVASVVQFLASDAASLMTGAIVNVDAGFTVW........ 260
67 -85.7004egf_A mol:protein length:266 L-xylulose reductase  ali model follow..  29  17...RLDGKRALITGATKGIGADIARAFAAAGARLVLSGRDVSELDAARRALGEQFGTDVHTVAIDLAEPDAPAELARRAAEAFGGLDVLVNNAGISHPQPVVDTDPQLFDATIAVNLRAPALLASAVGKAMVAAGEGGAIITVASAAALAPLPDHYAYCTSKAGLVMATKVLARELGPHGIRANSVCPTVVLTEMGQRVWGDEAKSAPMIARIPLGRFAVPHEVSDAVVWLASDAASMINGVDIPVDGGYTM......... 265
68 -85.7003gk3_A mol:protein length:269 Acetoacetyl-CoA reductase  ali model follow..  31  17....QAKRVAFVTGGMGGLGAAISRRLHDAGMAVAVSHSERNDHVSTWLMHERDAGRDFKAYAVDVADFESCERCAEKVLADFGKVDVLINNAGITRDATFMKMTKGDWDAVMRTDLDAMFNVTKQFIAGMVERRF-GRIVNIGSVNGSRGAFGQANYASAKAGIHGFTKTLALETAKRGITVNTVSPGYLATAMVEAV-PQDVLEAKILPQIPVGRLGRPDEVAALIAFLCSDDAGFVTGADLAINGGMHM......... 262
69 -85.6003uxy_A mol:protein length:266 Short-chain dehydrogenase/reductase SDR  ali model follow..  27  19...GFEGKVALVTGAAGGIGGAVVTALRAAGARVAVADRAVAG------------IAADLHLPGDLREAAYADGLPGAVAAGLGRLDIVVNNAGVISRGRITETTDADWSLSLGVNVEAPFRICRAAIPLMAAAG-GGAIVNVASCWGLRPGPGHALYCLTKAALASLTQCMGMDHAPQGIRINAVCPNEVNTPMLRTGFDPDRAVAELGRTVPLGRIAEPEDIADVVLFLASDAARYLCGSLVEVNGGKAV......... 259
70 -85.4003wye_A mol:protein length:256 Diacetyl reductase [(S)-acetoin forming], L-2  ali model follow..  32  2......KKVALVTGAGQGIGKAIALRLVKDGFAVAIADY-NDATAKAVASEINQAGGHAVAVKVDVSDRDQVFAAVEQARKTLGGFDVIVNNAGIAQIKPLLEVTEEDLKQIYSVNVFSVFFGIQAAVEAFKKEGHGGKIINAASIAAIQGFPILSAYSTTKFAVRGLTQTAARDLAPLGITVNGYCPGIVGTGMWEQIDAEGENFKEYSSSIALGRPSVPEDVAGLVSFLASPDSDYMTGQSLLIDGGMVF......... 255
71 -85.4003imf_A mol:protein length:257 Short chain dehydrogenase  ali model follow..  37  4....MKEKVVIITGGSSGMGKGMATRFAKEGARVVITGR-TKEKLEEAKLEIEQFPGQILTVQMDVRNTDDIQKMIEQIDEKFGRIDILINNAAGNFICPAEDLSVNGWNSVINIVLNGTFYCSQAIGKYWIEKGIKGNIINMVATYAWDAGPGVIHSAAAKAGVLAMTKTLAVEWGRKGIRVNAIAPGPIERTGGDKLWISEEMAKRTIQSVPLGRLGTPEEIAGLAYYLCSDEAAYINGTCMTMDGGQHLHQ....... 254
72 -85.3003a28_C mol:protein length:258 L-2.3-butanediol dehydrogenase  ali model follow..  29  2......SKVAMVTGGAQGIGRGISEKLAADGFDIAVALPQQEEQAAETIKLIEAADQKAVFVGLDVTDKANFDSAIDEAAEKLGGFDVLVNNAGIAQIKPLLEVTEEDLKQIYSVNVFSVFFGIQAASRKFDELGVKGKIINAASIAAIQGFPILSAYSTTKFAVRGLTQAAAQELAPKGHTVNAYAPGIVGTGMWEQIDAEGENFKEYSSSIALGRPSVPEDVAGLVSFLASENSNYVTGQVMLVDGGMLY......... 257
73 -85.1002zat_A mol:protein length:260 Dehydrogenase/reductase SDR family member 4  ali model follow..  28  11...PLENKVALVTASTDGIGLAIARRLAQDGAHVVVSSR-KQENVDRTVATLQGEGLSVTGTVCHVGKAEDRERLVAMAVNLHGGVDILVSNAAVNPFGNIIDATEEVWDKILHVNVKATVLMTKAVVPEMEKRG-GGSVLIVSSVGAYHPFPNLGPYNVSKTALLGLTKNLAVELAPRNIRVNCLAPGLIKTNFSQVLWMDKARKEYMKESLRIRRLGNPEDCAGIVSFLCSEDASYITGETVVVGGGTAS......... 258
74 -85.0001uls_A mol:protein length:245 putative 3-oxoacyl-acyl carrier protein reduc  ali model follow..  34  2...RLKDKAVLITGAAHGIGRATLELFAKEGARLVACDI-EEGPLREAAEAV-----GAHPVVMDVADPASVERGFAEALAHLGRLDGVVHYAGITRDNFHWKMPLEDWELVLRVNLTGSFLVAKAASEAMREKN-PGSIVLTASRVY-LGNLGQANYAASMAGVVGLTRTLALELGRWGIRVNTLAPGFIETRMTAKV--PEKVREKAIAATPLGRAGKPLEVAYAALFLLSDESSFITGQVLFVDGGRTI......... 240
75 -85.0004one_A mol:protein length:262 3-oxoacyl-(Acyl-carrier protein) reductase  ali model follow..  25  1MAMSRQRPVALVTGGRRGIGLGIARALAAKGFDLAITDRES---DEAVIHELRGLGGKVAFFKSDLAAVKTHEATVFAVLDAFGGIDCLVNNAGMVERGDFLALKPENFDTIMDVNLRGTVFFTQAVVKAMLAADEVRSIVTISSVSSVMTSPERLDYCISKAGLTAFVQGLALRLAEARIGVFEVRPGIIRTDMTAKVAARYDAL--EGGLVPMKRWGEASDVGAIVAGLAGGDFIFATGSAIHADGGLSI......... 253

FFAS is supported by the NIH grant R01-GM087218-01
8 5 6 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.