current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

1g6kA
Query: 1g6k_A mol:protein length:261 GLUCOSE 1-DEHYDROGENASE, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst MYKDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLANPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKFADPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMTQYPSFQAGRGLast
1 -108.0001g6k_A mol:protein length:261 GLUCOSE 1-DEHYDROGENASE  ali model  100  1MYKDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLANPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKFADPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMTQYPSFQAGRG 261
2 -108.0001rwb_A mol:protein length:261 Glucose 1-dehydrogenase  ali model follow..  98  1MYKDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTKTLALEYAPKGIRVNNIGPGAINTPINAEKFADPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMTLYPSFQAGRG 261
3 -107.0003aus_A mol:protein length:269 Glucose 1-dehydrogenase 4  ali model follow..  81  3MYTDLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNNEEEALDAKKEVEEAGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIKGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKFADPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQASYVTGITLFADGGMTKYPSFQAGRG 263
4 -106.0003AY6 Entity 1(prereleased)  ali follow..  81  3MYTDLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNNEEEALDAKKEVEEAGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIKGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKFADPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQASYVTGITLFADGGMTKYPSFQFGRG 263
5 -96.9003oic_A mol:protein length:258 Enoyl-[acyl-carrier-protein] reductase [NADPH  ali model follow..  28  2....EQNKCALVTGSSRGVGKAAAIRLAENGYNIVINYARSKKAALETAEEIEKLGVKVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKNG-GGHIVSISSLGSIRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDALKHFPNREDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSKADMIRGQTIIVDGGRSL......... 248
6 -95.4002ew8_A mol:protein length:249 (S)-1-Phenylethanol dehydrogenase  ali model follow..  28  1MTQRLKDKLAVITGGANGIGRAIAERFAVEGADIAIADLVP---APEAEAAIRNLGRRVLTVKCDVSQPGDVEAFGKQVISTFGRCDILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNG-WGRIINLTSTTYWLKIEAYTHYISTKAANIGFTRALASDLGKDGITVNAIAPSLVRTATTEASALSAMFDVLPNMLQAIPRLQVPLDLTGAAAFLASDDASFITGQTLAVDGGMVRH........ 249
7 -95.0002cfc_A mol:protein length:250 2-(R)-HYDROXYPROPYL-COM DEHYDROGENASE  ali model follow..  30  2......SRVAIVTGASSGNGLAIATRFLARGDRVAALDLSAETLEETARTHWHAYADKVLRVRADVADEGDVNAAIAATMEQFGAIDVLVNNAGITGNGVLHTTPVEQFDKVMAVNVRGIFLGCRAVLPHMLLQG-AGVIVNIASVASLVAFPGRSAYTTSKGAVLQLTKSVAVDYAGSGIRCNAVCPGMIETPMTQWRLDQPELRDQVLARIPQKEIGTAAQVADAVMFLAGEDATYVNGAALVMDGAYTA......... 249
8 -94.3003ndr_A mol:protein length:247 3-oxoacyl-(Acyl-carrier protein) reductase  ali model follow..  31  1.TERLAGKTALVTGAAQGIGKAIAARLAADGATVIVSDINA----EGAKAAAASIGKKARAIAADISDPGSVKALFAEIQALTGGIDILVNNASIVPFVAWDDVDLDHWRKIIDVNLTGTFIVTRAGTDQMRAAGKAGRVISIASNTFFAGTPNMAAYVAAKGGVIGFTRALATELGKYNITANAVTPGLIESDGVKAS-PHNEAFGFVEMLQAMKGKGQPEHIADVVSFLASDDARWITGQTLNVDAGMVRH........ 247
9 -92.7002p68_A mol:protein length:248 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  32  1MEIKLQGKVSLVTGSTRGIGRAIAEKLASAGSTVIITGTSGERAKAVAEEIANKYGVKAHGVEMNLLSEESINKAFEEIYNLVDGIDILVNNAGITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQR-WGRIVNISSVVGFTGNVGQVNYSTTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDMTAVL--SEEIKQKYKEQIPLGRFGSPEEVANVVLFLCSELASYITGEVIHVNGGM........... 247
10 -92.6001geg_A mol:protein length:256 ACETOIN REDUCTASE  ali model follow..  33  2......KKVALVTGAGQGIGKAIALRLVKDGFAVAIADY-NDATAKAVASEINQAGGHAVAVKVDVSDRDQVFAAVEQARKTLGGFDVIVNNAGVAPSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKEGHGGKIINACSQAGHVGNPELAVYSSSKFAVRGLTQTAARDLAPLGITVNGYCPGIVKTPMWAEIDRQGYGTAEFAKRITLGRLSEPEDVAACVSYLASPDSDYMTGQSLLIDGGMVF......... 255
11 -92.6003a28_C mol:protein length:258 L-2.3-butanediol dehydrogenase  ali model follow..  29  2......SKVAMVTGGAQGIGRGISEKLAADGFDIAVDLPQQEEQAAETIKLIEAADQKAVFVGLDVTDKANFDSAIDEAAEKLGGFDVLVNNAGIAQIKPLLEVTEEDLKQIYSVNVFSVFFGIQAASRKFDELGVKGKIINAASIAAIQGFPILSAYSTTKFAVRGLTQAAAQELAPKGHTVNAYAPGIVGTGMWEQIDAEGENFKEYSSSIALGRPSVPEDVAGLVSFLASENSNYVTGQVMLVDGGMLY......... 257
12 -92.5002uvd_A mol:protein length:246 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE  ali model follow..  38  2....LKGKVALVTGASRGIGRAIAIDLAKQGANVVVNYAGNEQKANEVVDEIKKLGSDAIAVRADVANAEDVTNMVKQTVDVFGQVDILVNNAGVTKDNLLMRMKEEEWDTVINTNLKGVFLCTKAVSRFMMRQR-HGRIVNIASVVGVTGNPGQANYVAAKAGVIGLTKTSAKELASRNITVNAIAPGFIATDMTDVL--DENIKAEMLKLIPAAQFGEAQDIANAVTFFASDQSKYITGQTLNVDGGMVM......... 246
13 -92.4003sj7_A mol:protein length:252 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  34  2....SMTKSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQANVADADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQR-SGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDAL--SDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGMYM......... 246
14 -92.1002hq1_A mol:protein length:247 Glucose/ribitol dehydrogenase  ali model follow..  34  1..MQLKGKTAIVTGSSRGLGKAIAWKLGNMGANIVLNGSPASTSLDATAEEFKAAGINVVVAKGDVKNPEDVENMVKTAMDAFGRIDILVNNAGITRDTLMLKMSEKDWDDVLNTNLKSAYLCTKAVSKIMLKQK-SGKIINITSIAGIIGNAGQANYAASKAGLIGFTKSIAKEFAAKGIYCNAVAPGIIKTDMTDVL--PDKVKEMYLNNIPLKRFGTPEEVANVVGFLASDDSNYITGQVINIDGGLVM......... 247
15 -92.1003pk0_A mol:protein length:262 Short-chain dehydrogenase/reductase SDR  ali model follow..  33  5.MFDLQGRSVVVTGGTKGIGRGIATVFARAGANVAVAGRSTADIDACVADLDQLGSGKVIGVQTDVSDRAQCDALAGRAVEEFGGIDVVCANAGVFPDAPLATMTPEQLNGIFAVNVNGTFYAVQACLDALIASG-SGRVVLTSSITGITGYPGWSHYGATKAAQLGFMRTAAIELAPHKITVNAIMPGNIMTEGLLEN--GEEYIASMARSIPAGALGTPEDIGHLAAFLATKEAGYITGQAIAVDGGQVL......... 253
16 -92.1003ak4_A mol:protein length:263 NADH-dependent quinuclidinone reductase  ali model follow..  31  7.IFDLSGRKAIVTGGSKGIGAAIARALDKAGATVAIADL-DVMAAQAVVAGL---ENGGFAVEVDVTKRASVDAAMQKAIDALGGFDLLCANAGVSTMRPAVDITDEEWDFNFDVNARGVFLANQIACRHFLASNTKGVIVNTASLAAKVGAPLLAHYSASKFAVFGWTQALAREMAPKNIRVNCVCPGFVKTAMQEREIIPEAVRAEYVSLTPLGRIEEPEDVADVVVFLASDAARFMTGQGINVTGGVRM......... 262
17 -91.9001k2w_A mol:protein length:256 SORBITOL DEHYDROGENASE  ali model follow..  26  1..MRLDGKTALITGSARGIGRAFAEAYVREGARVAIADI-NLEAARATAAEI---GPAACAIALDVTDQASIDRCVAELLDRWGSIDILVNNAALFDLAPIVEITRESYDRLFAINVSGTLFMMQAVARAMIAGGRGGKIINMASQAGRRGEALVGVYCATKAAVISLTQSAGLNLIRHGINVNAIAPGVVDGEHWDGVLPRGEKKRQVGAAVPFGRMGRAEDLTGMAIFLATPEADYIVAQTYNVDGGNWM......... 255
18 -91.6003i4f_A mol:protein length:264 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  27  1MSLGRFVRHALITAGTKGLGKQVTEKLLAKGYSVTVTYHSDTTAMETMKETYKDVEERLQFVQADVTKKEDLHKIVEEAMSHFGKIDFLINNAGVFERKKLVDYEEDEWNEMIQGNLTAVFHLLKLVVPVMRKQNF-GRIINYQGADSAPGWIYRSAFAAAKVGLVSLTKTVAYEEAEYGITANMVCPGDIIGEMKEAT--IQEARQLKEHNTPIGRSGTGEDIARTISFLCEDDSDMITGTIIEVTGAVDV......... 253
19 -91.4003lyl_A mol:protein length:247 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  32  1..MSLNEKVALVTGASRGIGFEVAHALASKGATV-VGTATSQASAEKFENSMKEKGFKARGLVLNISDIESIQNFFAEIKAENLAIDILVNNAGITRDNLMMRMSEDEWQSVINTNLSSIFRMSKECVRGMMKKRW-GRIISIGSVVGSAGNPGQTNYCAAKAGVIGFSKSLAYEVASRNITVNVVAPGFIATDMTDKL--TDEQKSFIATKIPSGQIGEPKDIAAAVAFLASEEAKYITGQTLHVNGGMYM......... 246
20 -91.3003ezl_A mol:protein length:256 Acetoacetyl-CoA reductase  ali model follow..  31  1MAMVMSQRIAYVTGGMGGIGTSICQRLHKDGFRVVAGCGPNSPRRVKWLEDQKALGFDFYASEGNVGDWDSTKQAFDKVKAEVGEIDVLVNNAGITRDVVFRKMTREDWQAVIDTNLTSLFNVTKQVIDGMVERGW-GRIINISSVNGQKGQFGQTNYSTAKAGIHGFTMSLAQEVATKGVTVNTVSPGYIGTDMVKAI--RPDVLEKIVATIPVRRLGSPDEIGSIVAWLASEESGFSTGADFSLNGGLHM......... 249
21 -91.2003o38_A mol:protein length:266 Short chain dehydrogenase  ali model follow..  29  16GHGLLKGKVVLVTAAATGIGSTTARRALLEGADVVISDYHERRLGETRDQLADLGLGRVEAVVCDVTSTEAVDALITQTVEKAGRLDVLVNNAGLGGQTPVVDMTDEEWDRVLNVTLTSVMRATRAALRYFRGVDHGGVIVNNASVLGWRAQHSQSHYAAAKAGVMALTRCSAIEAVEFGVRINAVSPSIARHKFLEKTS-SSELLDRLASDEAFGRAAEPWEVAATIAFLASDYSSYMTGEVVSVSSQRA.......... 266
22 -91.1002d1y_A mol:protein length:256 hypothetical protein TT0321  ali model follow..  33  1.MGLFAGKGVLVTGGARGIGRAIAQAFAREGALVALCDLRPEGKE-------VAEAIGGAFFQVDLEDERERVRFVEEAAYALGRVDVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVG-GGAIVNVASVQGLFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAIDPERTRRDWEDLHALRRLGKPEEVAEAVLFLASEKASFITGAILPVDGGMTA......... 247
23 -91.1004dml_A mol:protein length:269 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  38  16TALPLTDRIALVTGASRGIGRAIALELAAAGAKVAVNYASSAGAADEVVAAIAAAGGEAFAVKADVSQESEVEALFAAVIERWGRLDVLVNNAGITRDTLLLRMKRDDWQSVLDLNLGGVFLCSRAAAKIMLKQR-SGRIINIASVVGEMGNPGQANYSAAKAGVIGLTKTVAKELASRGITVNAVAPGFIATDMTSEL-----AAEKLLEVIPLGRYGEAAEVAGVVRFLAADPAAYITGQVINIDGGLVM......... 262
24 -91.0003gk3_A mol:protein length:269 Acetoacetyl-CoA reductase  ali model follow..  30  14.GSMQAKRVAFVTGGMGGLGAAISRRLHDAGMAVAVSHSERNDHVSTWLMHERDAGRDFKAYAVDVADFESCERCAEKVLADFGKVDVLINNAGITRDATFMKMTKGDWDAVMRTDLDAMFNVTKQFIAGMVERRF-GRIVNIGSVNGSRGAFGQANYASAKAGIHGFTKTLALETAKRGITVNTVSPGYLATAMVEAV-PQDVLEAKILPQIPVGRLGRPDEVAALIAFLCSDDAGFVTGADLAINGGMHM......... 262
25 -90.9001ahh_A mol:protein length:255 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  34  6.NLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDI-NADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPF-DMPMADFRRAYELNVFSFFHLSQLVAPEMEKNG-GGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVI-TPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQ......... 252
26 -90.9003gaf_A mol:protein length:256 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  32  7.PFHLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDL-KSEGAEAVAAAIRQAGGKAIGLECNVTDEQHREAVIKAALDQFGKITVLVNNAGGGGPKPF-DMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAG-GGAILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDALATVL-TPEIERAMLKHTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGGGVQ......... 253
27 -90.8002q2q_A mol:protein length:255 Beta-D-hydroxybutyrate dehydrogenase  ali model follow..  28  1...TLKGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGD---PAPALAEIARHGVKAVHHPADLSDVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNW-GRIINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGWLA......... 254
28 -90.8001zem_A mol:protein length:262 xylitol dehydrogenase  ali model follow..  30  1MSKKFNGKVCLVTGAGGNIGLATALRLAEEGTAIALLDM-NREALEKAEASVREKGVEARSYVCDVTSEEAVIGTVDSVVRDFGKIDFLFNNAGYQGAAPVQDYPSDDFARVLTINVTGAFHVLKAVSRQMITQN-YGRIVNTASMAGVKGPPNMAAYGTSKGAIIALTETAALDLAPYNIRVNAISPGYMGPGFMWERQVEKVVAQQMIGSVPMRRYGDINEIPGVVAFLLGDDSSFMTGVNLPIAGG............ 262
29 -90.6003tsc_A mol:protein length:277 Putative oxidoreductase  ali model follow..  29  5MAGKLEGRVAFITGAARGQGRAHAVRMAAEGADIIAVDPASPDDLSETVRLVEAANRRIVAAVVDTRDFDRLRKVVDDGVAALGRLDIIVANAGVAAPQAWDDITPEDFRDVMDINVTGTWNTVMAGAPRIIEGGRGGSIILISSAAGMKMQPFMIHYTASKHAVTGLARAFAAELGKHSIRVNSVHPGPVNTPMGSGDMVTNPQLSHVLTPFLPDWVAEPEDIADTVCWLASDESRKVTAAQIPVDQGSTQY........ 277
30 -90.6004dqx_A mol:protein length:277 Probable oxidoreductase protein  ali model follow..  32  15QSMDLNQRVCIVTGGGSGIGRATAELFAKNGAYVVVADV-NEDAAVRVANEI---GSKAFGVRVDVSSAKDAESMVEKTTAKWGRVDVLVNNAGFGTTGNVVTIPEETWDRIMSVNVKGIFLCSKYVIPVMRRNG-GGSIINTTSYTATSAIADRTAYVASKGAISSLTRAMAMDHAKEGIRVNAVAPGTIDSPYFTKIFDPAKLRSDFNARAVMDRMGTAEEIAEAMLFLASDRSRFATGSILTVDGGSSI......... 265
31 -90.5001pr9_A mol:protein length:244 L-XYLULOSE REDUCTASE  ali model follow..  24  1MELFLAGRRVLVTGAGKGIGRGTVQALHATGARVVAVSRTQAD-----LDSLVRECPGIEPVCVDLGDWEATERAL----GSVGPVDLLVNNAAVALLQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLIARGVPGAIVNVSSQCSQRAVTNHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEGGFWA......... 243
32 -90.4001cyd_A mol:protein length:244 CARBONYL REDUCTASE  ali model follow..  23  1MKLNFSGLRALVTGAGKGIGRDTVKALHASGAKVVAVTRTNSD-----LVSLAKECPGIEPVCVDLGDWDATEKAL----GGIGPVDLLVNNAALVIMQPFLEVTKEAFDRSFSVNLRSVFQVSQMVARDMINRGVPGSIVNVSSMVAHVTFPNLITYSSTKGAMTMLTKAMAMELGPHKIRVNSVNPTVVLTDMGKKVSADPEFARKLKERHPLRKFAEVEDVVNSILFLLSDRSASTSGGGILVDAGYLA......... 243
33 -90.4001edo_A mol:protein length:244 BETA-KETO ACYL CARRIER PROTEIN REDUCTASE  ali model follow..  37  1......SPVVVVTGASRGIGKAIALSLGKAGCKVLVNYARSAKAAEEVSKQIEAYGGQAITFGGDVSKEADVEAMMKTAIDAWGTIDVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATKIMMKKR-KGRIINIASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDMTAKL--GEDMEKKILGTIPLGRTGQPENVAGLVEFLASPAASYITGQAFTIDGGIAI......... 244
34 -90.3003enn_A mol:protein length:249 GLUCOSE/RIBITOL DEHYDROGENASE  ali model follow..  31  4SMFDLTGRKALVTGATGGLGEAIARALHAQGAIVGLHGTRE----EKLKELAAELGERIFVFPANLSDREAVKALGQKAEEEMGGVDILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMRRR-NGRIINITSIVGVTGNPGQANYCASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIESAMTGKL--NEKQKDAIMGNIPMKRMGVGADIAAAVVYLASDEAAYVTGQTLHVNGGMAM......... 248
35 -90.3002zat_A mol:protein length:260 Dehydrogenase/reductase SDR family member 4  ali model follow..  28  9.RKPLENKVALVTASTDGIGLAIARRLAQDGAHVVVSSR-KQENVDRTVATLQGEGLSVTGTVCHVGKAEDRERLVAMAVNLHGGVDILVSNAAVNPFGNIIDATEEVWDKILHVNVKATVLMTKAVVPEMEKRG-GGSVLIVSSVGAYHPFPNLGPYNVSKTALLGLTKNLAVELAPRNIRVNCLAPGLIKTNFSQVLWMDKARKEYMKESLRIRRLGNPEDCAGIVSFLCSEDASYITGETVVVGGGTAS......... 258
36 -90.2001nxq_A mol:protein length:251 R-alcohol dehydrogenase  ali model follow..  33  3...RLDGKVAIITGGTLGIGLAIATKFVEEGAKVMITGR-HSDVGEKAAKSVGT-PDQIQFFQHDSSDEDGWTKLFDATEKAFGPVSTLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPSLGAYNASKGAVRIMSKSAALDCALKDVRVNTVHPGYIKTPLVDDL-PGAEEAMSQRTKTPMGHIGEPNDIAYICVYLASNESKFATGSEFVVDGGYTA......... 250
37 -90.2001wmb_A mol:protein length:260 D(-)-3-hydroxybutyrate dehydrogenase  ali model follow..  29  2....LKGKVAVVTGSTSGIGLGIATALAAQGADIVLNGFGDAAEIEKVRAGLAQHGVKVLYDGADLSKGEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGF-GRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRTPLVEKQISETAARELLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGWTA......... 259
38 -90.1003rro_A mol:protein length:251 3-ketoacyl-(acyl-carrier-protein) reductase  ali model follow..  33  7.FMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSE----SGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQ-GRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKAL--NDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYM......... 250
39 -90.0003VM3 Entity 1(prereleased)  ali follow..  32  10...RLDGQTALITGASAGIGLAIAHELAGFGADLMIVGR-DIDMLETARDELLDVQMQVHALAADVSDDEDRRQILDWVEDHSDGLHILVNNAGGNVTKAATEYSEDEWRKIFETNLFSAFELSRYAHPLLARHA-SSSIVNVGSVSGLTHVRSGVVYGMSKAAMHQMTRNLAVEWAEDGIRVNAVAPWYIRTRRTSGPLSDPDYYEEVINRTPMRRIGEPEEVAAAVGFLCLPAASYVTGECIAVDGGFLRY........ 259
40 -90.0001i01_A mol:protein length:244 BETA-KETOACYL [ACP] REDUCTASE  ali model follow..  32  1..MNFEGKIALVTGASRGIGRAIAETLAARGAKVIGTATSE----NGAQAISDYLGANGKGLMLNVTDPASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRH-GRIITIGSVVGTMGNGGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRAL--SDDQRAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGMYM......... 243
41 -89.8001hdc_A mol:protein length:254 3-ALPHA, 20 BETA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  35  1..NDLSGKTVIITGGARGLGAEAARQAVAAGARVVLADVLDEEGAATA----RELGDAARYQHLDVTIEEDWQRVVAYAREEFGSVDGLVNNAGISTGMFLETESVERFRKVVEINLTGVFIGMKTVIPAMKDAG-GGSIVNISSAAGLMGLALTSSYGASKWGVRGLSKLAAVELGTDRIRVNSVHPGMTYTPMTAET--GIRQGEGNYPNTPMGRVGEPGEIAGAVVKLLSDTSSYVTGAELAVDGGWTTGPTVKYVMG 253
42 -89.8003ftp_A mol:protein length:270 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  36  16MDKTLDKQVAIVTGASRGIGRAIALELARRGAMV-IGTATTEAGAEGIGAAFKQAGLEGRGAVLNVNDATAVDALVESTLKEFGALNVLVNNAGITQDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKAR-GGRIVNITSVVGSAGNPGQVNYAAAKAGVAGMTRALAREIGSRGITVNCVAPGFIDTDMTKGL--PQEQQTALKTQIPLGRLGSPEDIAHAVAFLASPQAGYITGTTLHVNGGMFM......... 263
43 -89.8002yz7_A mol:protein length:260 D-3-hydroxybutyrate dehydrogenase  ali model follow..  30  2....LKGKKAVVTGSTSGIGLAMATELAKAGADVVINGFGQPEDIERERSTLSKFGVKAYYLNADLSDAQATRDFIAKAAEALGGLDILVNNAGIQHTAPIEEFPVDKWNAIIALNLSAVFHGTAAALPIMQKQGW-GRIINIASAHGLVASVNKSAYVAAKHGVVGLTKVTALENAGKGITCNAICPGWVRTPLVEKQIEEAAARELLAEKQPSLQFVTPEQLGGAAVFLSSAAADQMTGTTLSLDGGWTA......... 259
44 -89.7003o4r_A mol:protein length:261 Dehydrogenase/reductase SDR family member 4  ali model follow..  30  10.RDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSR-KQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRG-GGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPS......... 259
45 -89.6003pgx_A mol:protein length:280 carveol dehydrogenase  ali model follow..  29  9QAGSLQGRVAFITGAARGQGRSHAVRLAAEGADIIACAPASPEDLDETARLVEDQGRKALTRVLDVRDDAALRELVADGMEQFGRLDVVVANAGVLSWGRVWELTDEQWDTVIGVNLTGTWRTLRATVPAMIEAGNGGSIVVVSSSAGLKATPGNGHYSASKHGLTALTNTLAIELGEYGIRVNSIHPYSVETPMIEPARHPSFVHSFPPMPVQPNGFMTADEVADVVAWLAGDGSGTLTGTQIPVDKGALKY........ 280
46 -89.5003sju_A mol:protein length:279 Keto reductase  ali model follow..  26  12GSHMSRPQTAFVTGVSSGIGLAVARTLAARGIAVYGCA-RDAKNVSAAVDGLRAAGHDVDGSSCDVTSTDEVHAAVAAAVERFGPIGILVNSAGRNGGGETADLDDALWADVLDTNLTGVFRVTREVLRAGMREAGWGRIVNIASTGGKQGVMYAAPYTASKHGVVGFTKSVGFELAKTGITVNAVCPGYVETPMAERVREEQEVHERFNAKIPLGRYSTPEEVAGLVGYLVTDAAASITAQALNVCGGLGNY........ 273
47 -89.5003ai1_A mol:protein length:263 NADPH-sorbose reductase  ali model follow..  28  1MDMGISGKVAVITGSSSGIGLAIAEGFAKEGAHIVLVARQVDRLHEAARSLKEKFGVRVLEVAVDVATPEGVDAVVESVRSSFGGADILVNNAGTGSNETIMEAADEKWQFYWELHVMAAVRLARGLVPGMRARG-GGAIIHNASICAVQPLWYEPIYNVTKAALMMFSKTLATEVIKDNIRVNCINPGLILTPDWIKTAKKGYLQSVADEHAPIKRFASPEELANFFVFLCSERATYSVGSAYFVDGGMLK......... 261
48 -89.4003uxy_A mol:protein length:266 Short-chain dehydrogenase/reductase SDR  ali model follow..  27  17.MQGFEGKVALVTGAAGGIGGAVVTALRAAGARVAVADRAVAG------------IAADLHLPGDLREAAYADGLPGAVAAGLGRLDIVVNNAGVISRGRITETTDADWSLSLGVNVEAPFRICRAAIPLMAAAG-GGAIVNVASCWGLRPGPGHALYCLTKAALASLTQCMGMDHAPQGIRINAVCPNEVNTPMLRTGFDPDRAVAELGRTVPLGRIAEPEDIADVVLFLASDAARYLCGSLVEVNGGKAV......... 259
49 -89.4003n74_A mol:protein length:261 3-ketoacyl-(acyl-carrier-protein) reductase  ali model follow..  36  3GSMSLEGKVALITGAGSGFGEGMAKRFAKGGAKVVIVDR-DKAGAERVAGEI---GDAALAVAADISKEADVDAAVEAALSKFGKVDILVNNAGIGHKPNAELVEPEEFDRIVGVNVRGVYLMTSKLIPHFKENGAKCVILNVASTGAGRPRPNLAWYNATKGWVVSVTKALAIELAPAKIRVVALNPVAGETPLLTTFMGSEEIRKKFRDSIPMGRLLKPDDLAEAAAFLCSPQASMITGVALDVDGGRSI......... 256
50 -89.2003v2h_A mol:protein length:281 D-beta-hydroxybutyrate dehydrogenase  ali model follow..  29  13YFQSMMTKTAVITGSTSGIGLAIARTLAKAGANIVLNGFGAPDEIRTVTDEVAGSSGTVLHHPADMTKPSEIADMMAMVADRFGGADILVNNAGVQFVEKIEDFPVEQWDRIIAVNLSSSFHTIRGAIPPMKKKGW-GRIINIASAHGLVASPFKSAYVAAKHGIMGLTKTVALEVAESGVTVNSICPGYVLTPLVEKQIPDQVINEVMLKGQPTKKFITVEQVASLALYLAGDDAAQITGTHVSMDGGWTA......... 274
51 -89.2001w4z_A mol:protein length:281 KETOACYL REDUCTASE  ali model follow..  30  15.MATQDSEVALVTGATSGIGLEIARRLGKEGLRVFVCAR-GEEGLRTTLKELREAGVEADGRTCDVRSVPEIEALVAAVVERYGPVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAGMLERGTGRIVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVVSTEEAFDRITARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGGLGNY........ 275
52 -89.2004DBZ Entity 1(prereleased)  ali follow..  30  15.MATQDSEVALVTGATSGIGLEIARRLGKEGLRVFVCAR-GEEGLRTTLKELREAGVEADGRTCDVRSVPEIEALVAAVVERYGPVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAGMLERGTGRIVNIASTGGKQGLVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVVSTEEAFDRITARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGGLGNY........ 275
53 -89.1002fwm_X mol:protein length:250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogena  ali model follow..  26  2.HMDFSGKNVWVTGAGKGIGYATALAFVEAGAKVTGFDQA-----------FTQEQYPFATEVMDVADAAQVAQVCQRLLAETERLDALVNAAGILRMGATDQLSKEDWQQTFAVNVGGAFNLFQQTMNQFRRQR-GGAIVTVASDAAHTPRIGMSAYGASKAALKSLALSVGLELAGSGVRCNVVSPGSTDTDMQRTLWVSDDFGEQFKLGIPLGKIARPQEIANTILFLASDLASHITLQDIVVDGGSTL......... 248
54 -89.0003awd_A mol:protein length:260 Putative polyol dehydrogenase  ali model follow..  29  8.KLRLDNRVAIVTGGAQNIGLACVTALAEAGARVIIADL-DEAMATKAVEDLRMEGHDVSSVVMDVTNTESVQNAVRSVHEQEGRVDILVACAGICSEVKAEDMTDGQWLKQVDINLNGMFRSCQAVGRIMLEQK-QGVIVAIGSMSGLIVNQQQAAYNASKAGVHQYIRSLAAEWAPHGIRANAVAPTYIETTLTRFGMEKPELYDAWIAGTPMGRVGQPDEVASVVQFLASDAASLMTGAIVNVDAGFTVW........ 260
55 -89.0002ph3_A mol:protein length:245 3-oxoacyl-[acyl carrier protein] reductase  ali model follow..  33  2.......RKALITGASRGIGRAIALRLAEDGFALAIHYGQNREKAEEVAEEARRRGSPLVVLGANLLEAEAATALVHQAAEVLGGLDTLVNNAGITRDTLLVRMKDEDWEAVLEANLSAVFRTTREAVKLMMKAR-FGRIVNITSVVGILGNPGQANYVASKAGLIGFTRAVAKEYAQRGITVNAVAPGFIETEMTERL--PQEVKEAYLKQIPAGRFGRPEEVAEAVAFLVSEKAGYITGQTLCVDGGLTPH........ 245
56 -88.9003gvc_A mol:protein length:277 Probable short-chain type dehydrogenase/reduc  ali model follow..  30  18.HPDLAGKVAIVTGAGAGIGLAVARRLADEGCHVLCADI-DGDAADAAATKI---GCGAAACRVDVSDEQQIIAMVDACVAAFGGVDKLVANAGVVHLASLIDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERG-GGAIVNLSSLAGQVAVGGTGAYGMSKAGIIQLSRITAAELRSSGIRSNTLLPAFVDTPMQQTAMAMGAGGARSMIARLQGRMAAPEEMAGIVVFLLSDDASMITGTTQIADGGTIA......... 268
57 -88.9003grp_A mol:protein length:266 3-oxoacyl-(Acyl carrierprotein) reductase  ali model follow..  30  16.MFKLTGRKALVTGATGGIGEAIARCFHAQGAIVGLHGTRE----DKLKEIAADLGKDVFVFSANLSDRKSIKQLAEVAEREMEGIDILVNNAGITRDGLFVRMQDQDWDDVLAVNLTAASTLTRELIHSMMRRRY-GRIINITSIVGVVGNPGQTNYCAAKAGLIGFSKALAQEIASRNITVNCIAPGFIKSAMTDKL--NEKQKEAIMAMIPMKRMGIGEEIAFATVYLASDEAAYLTGQTLHINGGMAM......... 259
58 -88.8003ucx_A mol:protein length:264 Short chain dehydrogenase  ali model follow..  27  5MGGLLTDKVVVISGVGPALGTTLARRCAEQGADLVLAAR-TVERLEDVAKQVTDTGRRALSVGTDITDDAQVAHLVDETMKAYGRVDVVINNAFVPSMKPFANTTFEHMRDAIELTVFGALRLIQGFTPALEES--KGAVVNVNSMVVRHSQAKYGAYKMAKSALLAMSQTLATELGEKGIRVNSVLPGYIWGGTLKSYFEHEDIYNAAAAGSDLKRLPTEDEVASAILFMASDLASGITGQALDVNCGEYK......... 263
59 -88.7001h5q_A mol:protein length:265 NADP-DEPENDENT MANNITOL DEHYDROGENASE  ali model follow..  30  8FTISFVNKTIIVTGGNRGIGLAFTRAVAAAGANVAVIYRSAADAVEVTEKVGKEFGVKTKAYQCDVSNTDIVTKTIQQIDADLGPISGLIANAGVSVVKPATELTHEDFAFVYDVNVFGVFNTCRAVAKLWLQKQQKGSIVVTSSMSSQIGSLTQVFYNSSKAACSNLVKGLAAEWASAGIRVNALSPGYVNTDQTAHM--DKKIRDHQASNIPLNRFAQPEEMTGQAILLLSDHATYMTGGEYFIDGGQLIW........ 265
60 -88.4003cxr_A mol:protein length:291 Dehydrogenase with different specificities  ali model follow..  30  23.QFSLKGKIALVTGASYGIGFAIASAYAKAGATIVFNDI-NQELVDRGMAAYKAAGINAHGYVCDVTDEDGIQAMVAQIESEVGIIDILVNNAGIIRRVPMIEMTAAQFRQVIDIDLNAPFIVSKAVIPSMIKKG-HGKIINICSMMSELGRETVSAYAAAKGGLKMLTKNIASEYGEANIQCNGIGPGYIATPQTAPLRELHPFDQFIIAKTPAARWGEAEDLMGPAVFLASDASNFVNGHILYVDGGILAY........ 278
61 -88.3002a4k_A mol:protein length:263 3-oxoacyl-[acyl carrier protein] reductase  ali model follow..  36  1.MGRLSGKTILVTGAASGIGRAALDLFAREGASLVAVDREE----RLLAEAVAALEAEAIAVVADVSDPKAVEAVFAEALEEFGRLHGVAHFAGVAHSALSWNLPLEAWEKVLRVNLTGSFLVARKAGEVLEE---GGSLVLTGSVAG-LGAFGLAHYAAGKLGVVGLARTLALELARKGVRVNVLLPGLIQTPMTAGL--PPWAWEQEVGASPLGRAGRPEEVAQAALFLLSEESAYITGQALYVDGGRSI......... 241
62 -88.3003r1i_A mol:protein length:276 Short-chain type dehydrogenase/reductase  ali model follow..  35  21.LFDLSGKRALITGASTGIGKKVALAYAEAGAQVAVAAR-HSDALQVVADEIAGVGGKALPIRCDVTQPDQVRGMLDQMTGELGGIDIAVCNAGIVSVQAMLDMPLEEFQRIQDTNVTGVFLTAQAAARAMVDQGLGGTIITTASMSGHIINIPQSHYCTSKAAVVHLTKAMAVELAPHQIRVNSVSPGYIRTELVEPL---ADYHALWEPKIPLGRMGRPEELTGLYLYLASAASSYMTGSDIVIDGGYTC......... 269
63 -88.2003tox_A mol:protein length:280 Short chain dehydrogenase  ali model follow..  38  2VMSRLEGKIAIVTGASSGIGRAAALLFAREGAKVVVTAR-NGNALAELTDEIAGGGGEAAALAGDVGDEALHEALVELAVRRFGGLDTAFNNAGAGAMGEISSLSVEGWRETLDTNLTSAFLAAKYQVPAIAALG-GGSLTFTSSFVGHTGFAGVAPYAASKAGLIGLVQALAVELGARGIRVNALLPGGTDTPANFANLPAPETRGFVEGLHALKRIARPEEIAEAALYLASDGASFVTGAALLADGGASV......... 255
64 -88.2001iy8_A mol:protein length:267 LEVODIONE REDUCTASE  ali model follow..  31  7PTTRFTDRVVLITGGGSGLGRATAVRLAAEGAKLSLVDV-SSEGLEASKAAVLETAAEVLTTVADVSDEAQVEAYVTATTERFGRIDGFFNNAGIEKQNPTESFTAAEFDKVVSINLRGVFLGLEKVLKIMREQG-SGMVVNTASVGGIRGIGNQSGYAAAKHGVVGLTRNSAVEYGRYGIRINAIAPGAIWTPMVENSMKPRKAAEEFIQVNPSKRYGEAPEIAAVVAFLLSDDASYVNATVVPIDGGQSA......... 265
65 -88.1003svt_A mol:protein length:281 Short-chain type dehydrogenase/reductase  ali model follow..  24  5MQLSFQDRTYLVTGGGSGIGKGVAAGLVAAGASVMIVGR-NPDKLAGAVQELEALGANIRYEPTDITNEDETARAVDAVTAWHGRLHGVVHCAGGSENGPITQVDSEAWRRTVDLNVNGTMYVLKHAAREMVRGG-GGSFVGISSIAASNTHRWFGAYGVTKSAVDHLMQLAADELGASWVRVNSIRPGLIRTDLVAAITESAELSSDYAMCTPLPRQGEVEDVANMAMFLLSDAASFVTGQVINVDGGQML......... 258
66 -88.0003icc_A mol:protein length:255 Putative 3-oxoacyl-(acyl carrier protein) red  ali model follow..  31  2.NSMLKGKVALVTGASRGIGRAIAKRLANDGALVAIHYGNRKEEAEETVYEIQSNGGSAFSIGANLESLHGVEALYSSLDNELTKFDILINNAGIGPGAFIEETTEQFFDRMVSVNAKAPFFIIQQALSRLRD---NSRIINISSAATRISLPDFIAYSMTKGAINTMTFTLAKQLGARGITVNAILPGFVKTDMNAELLSDPMMKQYATTISAFNRLGEVEDIADTAAFLASPDSRWVTGQLIDVSGGSCL......... 255
67 -87.8001doh_A mol:protein length:283 TRIHYDROXYNAPHTHALENE REDUCTASE  ali model follow..  31  23QSASLEGKVALVTGAGRGIGREMAMELGRRGCKVIVNYANSTESAEEVVAAIKKNGSDAACVKANVGVVEDIVRMFEEAVKIFGKLDIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEI---GGRLILMGSITGAKAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYHAVSNEEVDEYAAVQWSPLRRVGLPIDIARVVCFLASNDGGWVTGKVIGIDGGACM......... 283
68 -87.8001nff_A mol:protein length:260 Putative oxidoreductase Rv2002  ali model follow..  35  1MSGRLTGKVALVSGGARGMGASHVRAMVAEGAKVVFGDI-LDEEGKAMAAEL---ADAARYVHLDVTQPAQWKAAVDTAVTAFGGLHVLVNNAGILNIGTIEDYALTEWQRILDVNLTGVFLGIRAVVKPMKEAG-RGSIINISSIEGLAGTVACHGYTATKFAVRGLTKSTALELGPSGIRVNSIHPGLVKTPMTDWVPED-------IFQTALGRAAEPVEVSNLVVYLASDESSYSTGAEFVVDGGTVA......... 240
69 -87.5002ae1_A mol:protein length:260 TROPINONE REDUCTASE-II  ali model follow..  31  6...NLEGCTALVTGGSRGIGYGIVEELASLGASVYTCSR-NQKELNDCLTQWRSKGFKVEASVCDLSSRSERQELMNTVANHFGKLNILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASE-RGNVVFISSVSGALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSLVEMTIQDPENLNKLIDRCALRRMGEPKELAAMVAFLCFPAASYVTGQIIYVDGGLMANCGF..... 260
70 -87.5003afm_A mol:protein length:258 Carbonyl reductase  ali model follow..  29  1MFPDLKGKRVLITGSSQGIGLATARLFARAGAKVGLHGRKAPANIDETIASMRADGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAAGQTSAVISTGSIAGHTGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDTAFHADK--TQDVRDRISNGIPMGRFGTAEEMAPAFLFFASHLASYITGQVLDINGGQYKH........ 258
71 -87.5003v8b_A mol:protein length:283 Putative dehydrogenase, possibly 3-oxoacyl-[a  ali model follow..  29  17.MMNQPSPVALITGAGSGIGRATALALAADGVTVGALGR-TRTEVEEVADEIVGAGGQAIALEADVSDELQMRNAVRDLVLKFGHLDIVVANAGINGVAPIDDLKPFEWDETIAVNLRGTFLTLHLTVPYLKQRG-GGAIVVVSSINGTFTTPGATAYTATKAAQVAIVQQLALELGKHHIRVNAVCPGAIETNISDNTKLRHEEETAIQVPITDGQPGRSEDVAELIRFLVSERARHVTGSPVWIDGGQGL......... 275
72 -87.4001uls_A mol:protein length:245 putative 3-oxoacyl-acyl carrier protein reduc  ali model follow..  33  1..MRLKDKAVLITGAAHGIGRATLELFAKEGARLVACDI-EEGPLREAAEAVGAHP-----VVMDVADPASVERGFAEALAHLGRLDGVVHYAGITRDNFHWKMPLEDWELVLRVNLTGSFLVAKAASEAMREKN-PGSIVLTASRVY-LGNLGQANYAASMAGVVGLTRTLALELGRWGIRVNTLAPGFIETRMTAKV--PEKVREKAIAATPLGRAGKPLEVAYAALFLLSDESSFITGQVLFVDGGRTI......... 240
73 -87.4001x1e_A mol:protein length:239 2-deoxy-D-gluconate 3-dehydrogenase  ali model follow..  30  2......ERKALVTGGSRGIGRAIAEALVARGYRVAIASRNPEEAAQ---------SLGAVPLPTDLEK-DDPKGLVKRALEALGGLHVLVHAAAVNVRKPALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAEAG-WGRVLFIGSVTTFTGPVPIPAYTTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETEFTLPLRQNPELYEPITARIPMGRWARPEEIARVAAVLCGDEAEYLTGQAVAVDGGFLAY........ 239
74 -87.3003edm_A mol:protein length:259 Short chain dehydrogenase  ali model follow..  32  3.LQRFTNRTIVVAGAGRDIGRACAIRFAQEGANVVLTYNGAAEGAATAVAEIEKLGRSALAIKADLTNAAEVEAAISAAADKFGEIHGLVHVAGLIARKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAK---GGAIVTFSSQAGRDGGPGALAYATSKGAVMTFTRGLAKEVGPK-IRVNAVCPGMISTTFHDTF-TKPEVRERVAGATSLKREGSSEDVAGLVAFLASDDAAYVTGACYDINGGVLFSEG...... 253
75 -87.2002c07_A mol:protein length:285 3-OXOACYL-(ACYL-CARRIER PROTEIN) REDUCTASE  ali model follow..  29  28YYYCGENKVALVTGAGRGIGREIAKMLAKSVSHVICIS-RTQKSCDSVVDEIKSFGYESSGYAGDVSKKEEISEVINKILTEHKNVDILVNNAGITRDNLFLRMKNDEWEDVLRTNLNSLFYITQPISKRMINNR-YGRIINISSIVGLTGNVGQANYSSSKAGVIGFTKSLAKELASRNITVNAIAPGFISSDMTDKI--SEQIKKNIISNIPAGRMGTPEEVANLACFLSSDKSGYINGRVFVIDGGLS.......... 274

FFAS is supported by the NIH grant R01-GM087218-01
6 1 0 4 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.