current user: public




Query: 1fyz_E mol:protein length:170 METHANE MONOOXYGENASE COMPONENT A, GAMMA CHAI, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170
# Score Template Links and tools%idFirst MAKLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQSPHLast
1 -113.0001fyz_E mol:protein length:170 METHANE MONOOXYGENASE COMPONENT A, GAMMA CHAI  ali model  100  1MAKLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQSPH 170
2 -105.0001mhy_G mol:protein length:169 METHANE MONOOXYGENASE HYDROXYLASE  ali model follow..  51  4..REPIHDNSIRTEWEAKIAKLTSVDQATKFIQDFRLAYTSPFRKSYDIDVDYQYIERKIEEKLSVLKTEKLPVADLITKATTGEDAAAVEATWIAKIKAAKSKYEAEAIHIEFRQLYKPPVLPVNVFLRTDAALGTVLMEIRNTDYYGTPLEGLRKERGVKVLHLQA.. 169
3 -104.0001mmo_G mol:protein length:162 METHANE MONOOXYGENASE HYDROLASE (GAMMA CHAIN)  ali model follow..  98  3.....IHSNDTRDAWVNKIAHVNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVH..... 162
4 -7.3501dk8_A mol:protein length:147 AXIN  ali model follow..  11.............KWAESLHSLLDDQDGISLFRTF-------LKQEGCADLLDFWFAC---TGFRKLEPCDSNEEKRLKL------ARAIYRKYILDNNGIVSRQTKPATKSFIKGCIMKQLIDPAMFDQAQTEIQATMEENTYPSFLKSDI.................. 133
5 -7.0203kb4_A mol:protein length:225 Alr8543 protein  ali model follow..  13  72...............LEQLHQLPNYTLGYMYADHMIRNQLTPPPVNENVNHPFMFLAAHLGETHDIWH------------VVTGCDTDKPGEVKLEAFYTAQLIPDRLFLALLAKNLLKTAMYEVELCEQILDGLAKPLFGIEWNKLWETPLEELQTSLNIV........ 215
6 -6.8701vpq_A mol:protein length:273 hypothetical protein TM1631  ali model follow..  12  65......................................................MLRKTPPDFYFTVKTPGSVTHVLWKEG---KDPKEDMENFTRQIEPLIEEQRLKMTLAQFPFSFKFSRKNVEYLEKLRESYPYELVEFRHYSWDREETYEFLRNHGITFVVVDEPK 178
7 -6.6902eua_A mol:protein length:431 Menaquinone-specific isochorismate synthase  ali model follow..  13  181........KTIAEGELDKVVLARATDNAAAMMAASRRLNLNCYHFYMAFDGENAFLGSSPE-RLWRRRDKALRTEALAGTVANNPDDKQAQQLGEWLMADDKNQRENMLVVEDICQRLQADTQTLDV--------PPQVLRLRKVQHLRRCIWSLNKADDVICLHQLQP. 341
8 -6.3002qv0_A mol:protein length:143 Protein mrkE  ali model follow..  12  18........................................................EFLAQQELSWL-INTHSQMEIVGSFDDGLDVLKFLQHNKVDAIFLDINIPSLDGVLLAQNISQFAHKPFIVFITAWKEHAVEAFELEAFDYILKPYQESRIINMLQKLT..... 125
9 -6.2902lht_A mol:protein length:122 Cellophane-induced protein 1  ali model follow..  14  3.....VFDPPTQYGYDGKPLDASFCRTAGSREKDCRKDVQACDKK-YDDQGRETACAKGIREKYKPAVVYGYDGKPLDLGFCTLAGIREV--DCRKDAQTCDKKYESDKCLNAIKEKYKPVVDP.............................................. 118
10 -6.2803msq_A mol:protein length:224 Putative ubiquinone biosynthesis protein  ali model follow..  11  77...............LDDLAKLPEGTLGHVYAREMKARGFDPFYKKVPVVDDISYLKMLWRSTHDIYH------------VVAGFDTNVFGEIGLQAFFLAQ-SFGMVMISLYQPTNFKALMTEISRGYRVGSHTPGKLIAQKWDQLWDVQVSEIRERLGVN........ 221

FFAS is supported by the NIH grant R01-GM087218-01
8 2 8 4 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Jaroszewski L, Godzik A. Clustering of highly homologous sequences to reduce the size of large protein databases. Bioinformatics. 2001 Mar;17(3):282-3.