current user: public




Query: 1fyz_E mol:protein length:170 METHANE MONOOXYGENASE COMPONENT A, GAMMA CHAI, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170
# Score Template Links and tools%idFirst MAKLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQSPHLast
1 -118.0001fyz_E mol:protein length:170 METHANE MONOOXYGENASE COMPONENT A, GAMMA CHAI  ali model  100  1MAKLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQSPH 170
2 -110.0001mmo_G mol:protein length:162 METHANE MONOOXYGENASE HYDROLASE (GAMMA CHAIN)  ali model follow..  98  1...LGIHSNDTRDAWVNKIAHVNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVH..... 162
3 -110.0001mhy_G mol:protein length:169 METHANE MONOOXYGENASE HYDROXYLASE  ali model follow..  52  1MAKREIHDNSIRTEWEAKIAKLTSVDQATKFIQDFRLAYTSPFRKSYDIDVDYQYIERKIEEKLSVLKTEKLPVADLITKATTGEDAAAVEATWIAKIKAAKSKYEAEAIHIEFRQLYKPPVLPVNVFLRTDAALGTVLMEIRNTDYYGTPLEGLRKERGVKVLHLQA.. 169
4 -7.7601vpq_A mol:protein length:273 hypothetical protein TM1631  ali model follow..  12  34...................................FLKYYWAVLGFRIVELNFTYYTQPSWRSFVQMLRKTPPDFYFTVKTKEGKDPKEDMENFTRQIEPLIEEQRLKMTLAQFPFSFKFSRKNVEYLEKLRESYPYELVEFRHYSWDREETYEFLRNHGITFVVVDEP. 177
5 -7.3901s2x_A mol:protein length:206 Cag-Z  ali model follow..  16  30......NANEVRDKFIQNYASLKDSNDPQDFLRRVQELRINMQKNFISFDAYYNYLNNLVLASYNRCKQEKFAESTIKNELTLGEFVAEISDNF-NNFTCDEVARISDLVASYLPREYLPPFIDGNMMGVAFQILG--------IDDFGKKLNEIVQDIGTKYIILS... 183
6 -6.3402dlx_A mol:protein length:153 UBX domain-containing protein 7  ali model follow..  10  1....................GSSGSSGIDKKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNFACQCLNRDVWSNEAVKNIIREHFIFWQVYHDSEEGQRY----IQFYKLGDFPYVSILDPRTGQKLVEWHQLDVSSFLDQVTGFLGEHG.......... 139
7 -6.3303kb4_A mol:protein length:225 Alr8543 protein  ali model follow..  15  72...............LEQLHQLPNYTLGYMYADHMIRNQLTPPPVNENVNHPFMFLAAHLGE-----------THDIWH-VVTGCDTDKPGEVKLEAFYTAQLIPDRLFLALLAKNLLKTAMYEVELCEQILDGLAKPLFGIEWNKLWETPLEELQTSLNIV........ 215
8 -6.3203lwa_A mol:protein length:183 Secreted thiol-disulfide isomerase  ali model follow..  58..........................ENQVVILNAWGQWCAPCRSESD---------QIIHEELQAAGNGDTPGGTVLGINVRDYSRDIAQDFVTDNGLDYPSIYDPPFMTAASLGGVPASVIPTTIVLDKQHRPAAVFLREVTSKDVLDVALPLVDE............ 182
9 -6.2201ujo_A mol:protein length:144 Transgelin  ali model follow..  11  17......................................................WIVVQCGPDVGRPDQVWLKNGVILSKLVNSLYPEGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVD------LYEGKDMAAVQRTLMALGS............. 119
10 -6.2103d31_A mol:protein length:348 Sulfate/molybdate ABC transporter, ATP-bindin  ali model follow..  12  39...........KTLFLELIAGFHVPDSGRILLDGKDVTDLSPEKHDIAFQNYSLFPHMNVKKNLEFMRMKKIKDPKRVLDTARDLKIEHLLDRNPLTLSGG----EQQRVALARALVTNPKILLL------DEPLSALDPRTQEN--AREMLSVLHKKNKLTVLHIT... 185

FFAS is supported by the NIH grant R01-GM087218-01
5 7 2 4 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;