current user: public




1fvaA
Query: 1fva_A mol:protein length:217 PEPTIDE METHIONINE SULFOXIDE REDUCTASE, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .
# Score Template Links and tools%idFirst HSLFPIPRMGDSAAKIVSPQEALPGRKEPLVVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWTLKGVYSTQVGFAGGYTPNPTYKEVCSGKTGHAEVVRVVFQPEHISFEELLKVFWENHDPTQGMRQGNDHGSQYRSAIYPTSAEHVGAALKSKEDYQKVLSEHGFGLITTDIREGQTFYYAEDYHQQYLSKDPDGYCGLGGTGVSCPLLast
1 -128.0001fva_A mol:protein length:217 PEPTIDE METHIONINE SULFOXIDE REDUCTASE  ali model  100  1HSLFPIPRMGDSAAKIVSPQEALPGRKEPLVVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWTLKGVYSTQVGFAGGYTPNPTYKEVCSGKTGHAEVVRVVFQPEHISFEELLKVFWENHDPTQGMRQGNDHGSQYRSAIYPTSAEHVGAALKSKEDYQKVLSEHGFGLITTDIREGQTFYYAEDYHQQYLSKDPDGYCGLGGTGVSCPL 217
2 -123.0002l90_A mol:protein length:212 Peptide methionine sulfoxide reductase  ali model follow..  85  2..........DSASKVISAEEALPGRTEPIPVTAKHHVSGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGHTRNPTYKEVCSEKTGHAEVVRVVYRPEHISFEELLKVFWENHDPTQGMRQGNDFGTQYRSAVYPTSAVQMEAALRSKEEYQKVLSKHNFGPITTDIREGQVFYYAEDYHQQYLSKNPDGYCGLGGTGVSCPM 208
3 -119.0002gt3_A mol:protein length:212 Methionine Sulfoxide Reductase A  ali model follow..  58  1.......MSLFDKKHLVSPADALPGRNTPMPVATLHAVNGHSMT-NVPDGMEIAIFAMGCFWGVERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWENHDPAQGMRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAADDDHITTEIANATPFYYAEDDHQQYLHKNPYGYCGIGGIGVCLP. 209
4 -102.0002j89_A mol:protein length:261 METHIONINE SULFOXIDE REDUCTASE A  ali model follow..  39  55...........KPPMANILSKLGFGTRSPDPSTMDPTIPQGPDDDLPAPGQQFAQFGAGCFWGVELAFQRVPGVTKTEVGYTQGLLHNPTYEDVCTGTTNHNEVVRVQYDPKECSFDTLIDVLWARHDPTTLNRQGNDVGTQYRSGIYYYTPEQEKAAKESLERQQKLLNR----KIVTEILPAKKFYRAEEYHQQYLAKGGRGFMQSAEKGCNDPI 257
5 -97.7003bqe_A mol:protein length:194 Peptide methionine sulfoxide reductase msrA/m  ali model follow..  35  2.................................................NTRTIYLAGGCFWGLEAYFQRIDGVVDAVSGYANGNTKNPSYEDVSYRHTGHAETVKVTYDADKLSLDDILQYFFRVVDPTSLNKQGNDTGTQYRSGVYYTDPAEKAVIAAALKREQQKYQL----PLVVENEPLKNFYDAEEYHQDYLIKNPNGYCHIDIRKADEPL 165
6 -97.3001nwa_A mol:protein length:203 Peptide methionine sulfoxide reductase msrA  ali model follow..  35  1....................................MGSSGHIEGRHMTSNQKAILAGGCFWGLQDLIRNQPGVVSTRVGYSGGNIPNATYRNHG----THAEAVEIIFDPTVTDYRTLLEFFFQIHDPTTKDRQGNDRGTSYRSAIFYFDEQQKRIALDTIADVEA--SGLWPGKVVTEVSPAGDFWEAEPEHQDYLQRYPNGYCHFVRPGWRLPR 176
7 -95.6003pim_A mol:protein length:187 Peptide methionine sulfoxide reductase  ali model follow..  34  3..................................HGSSLISKTIKYDPAKDKLITLACGCFWGTEHMYRKYDRIVDCKVGYANGEESKKSYKRVCGGDTDFAEVLQVSYNPKVITLRELTDFFFRIHDPTTSNSQGPDKGTQYRSGLFAHSDADLKELAKIKEEWQPKWG----NKIATVIEPIKNFYDAEEYHQLYLDKNPQGYA........... 178
8 -94.3003pin_B mol:protein length:183 Peptide methionine sulfoxide reductase  ali model follow..  34  2.....................................SLISKTIKYDPAKDKLITLASGSFWGTEHMYRKYDRIVDSKVGYANGEESKKSYKRVSGGDTDFAEVLQVSYNPKVITLRELTDFFFRIHDPTTSNSQGPDKGTQYRSGLFAHSDADLKELAKIKEEWQPKWG----NKIATVIEPIKNFYDAEEYHQLYLDKNPQGYA........... 174
9 -75.4003e0m_A mol:protein length:313 Peptide methionine sulfoxide reductase msrA/m  ali model follow..  33  1.................................................HMAEIYLAGGCFWGLEEYFSRISGVLETSVGYANGQVETTNYQLLKE--TDHAETVQVIYDEKEVSLREILLYYFRVIDPLSINQQGNDRGRQYRTGIYYQDEADLPAIYTVVQEQERMLGR----KIAVEVEQLRHYILAEDYHQDYLRKNPSGYCHIDVTDADKPL 162
10 -10.2002ofg_X mol:protein length:111 Zinc-transporting ATPase  ali model follow..  15  20.........................................................TSCKLKIEGSLERLKGVAEASVTVA-------------------TGRLTVTYDPKQVSEITIQERI-------------AALGYTLAEPKSSVTLNGHKHPHSHREEGHSHSHGAGEFNLKQEL.................................... 111

FFAS is supported by the NIH grant R01-GM087218-01
6 0 5 4 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Li Z, and Godzik A. Modeling and Analyzing Three-Dimensional Structures of Human Disease Proteins Pacific Symposium on Biocomputing 11:439-450(2006) [PDF]