current user: public




Query: 1f6y_A mol:protein length:262 5-METHYLTETRAHYDROFOLATE CORRINOID/IRON SULFU, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst MLIIGERINGMFGDIKRAIQERDPAPVQEWARRQEEGGARALDLNVGPAVQDKVSAMEWLVEVTQEVSNLTLCLDSTNIKAIEAGLKKCKNRAMINSTNAEREKVEKLFPLAVEHGAALIGLTMNKTGIPKDSDTRLAFAMELVAAADEFGLPMEDLYIDPLILPANVAQDHAPEVLKTLQQIKMLADPAPKTVLGLSNVSQNCQNRPLINRTFLAMAMACGLMSAIADACDEALIETAATAEILLNQTVYCDSFVKMFKTRLast
1 -113.0001f6y_A mol:protein length:262 5-METHYLTETRAHYDROFOLATE CORRINOID/IRON SULFU  ali model  100  1MLIIGERINGMFGDIKRAIQERDPAPVQEWARRQEEGGARALDLNVGPAVQDKVSAMEWLVEVTQEVSNLTLCLDSTNIKAIEAGLKKCKNRAMINSTNAEREKVEKLFPLAVEHGAALIGLTMNKTGIPKDSDTRLAFAMELVAAADEFGLPMEDLYIDPLILPANVAQDHAPEVLKTLQQIKMLADPAPKTVLGLSNVSQNCQNRPLINRTFLAMAMACGLMSAIADACDEALIETAATAEILLNQTVYCDSFVKMFKTR 262
2 -113.0002ogy_A mol:protein length:262 5-methyltetrahydrofolate corrinoid/iron sulfu  ali model follow..  98  1MLIIGERINGMFGDIKRAIQERDPAPVQEWARRQEEGGARALDLNVGPAVQDKVSAMEWLVEVTQEVSNLTLCLDSTNIKAIEAGLKKCKNRAMINSTNAEREKVEKLFPLAVEHGAALIGLTMNKTGIPKDSDTRLAFAMELVAAADEFGLPMEDLYIDPLILPANVAQDHAPEVLKTLQQIKMLADPAPKTVLGLSAVSQNCQNRPLINRTFLAMAMACGLDAAIADACDEALIETAATAEILLNQTVYCDSFVKMFKTR 262
3 -112.0002yck_X mol:protein length:272 5-METHYLTETRAHYDROFOLATE CORRINOID/IRON SULFU  ali model follow..  61  11FIMIGERINGMFKDIREAILNKDPRPIQEWARRQAEKGAHYLDVNTGPTADDPVRVMEWLVKTIQEVVDLPCCLDSTNPDAIEAGLKVHRGHAMINSTSADQWKMDIFFPMAKKYEAAIIGLTMNEKGVPKDANDRSQLAMELVANADAHGIPMTELYIDPLILPVNVAQEHAVEVLETIRQIKLMANPAPRTVLGLSNVSQKCPDRPLINRTYLVMAMTAGLDAAIMDVDDDALVDAAATAHILLNKEIYCDSYLKTFRQK 272
4 -107.0004o0q_A mol:protein length:290 Dihydropteroate synthase DHPS  ali model follow..  32  16LIIIGEKINGTIPSVKKAIEAKDEKLIRDLALRQSEAGADYIDVCASTSPELEVETLQWLMDIVQEATDTPLCIDSPNPRAIQQVLLYAKRPGLINSVSLEGDKCEVIFPLIQGTSWQVIALTCDNSGIPQDVQSRVEIAQALVEKAQSYDIAQERIHIDPLVIALSADNGALLKFAEATRQIKA-NYPMINVTSGLSNISFGMPLRKVVNQNFLTLAMFAGMDSAILDPLNRDLLAALLATEALLGRDKHCRNFANAYRKN 276
5 -65.4001q7m_A mol:protein length:566 5-methyltetrahydrofolate S-homocysteine methy  ali model follow..  28  315FVVIGERINPAGKKLWAEMQKGNEEIVIKEAKTQVEKGAEVLDVNFGIESQIDVRYVEKIVQTLPYVSNVPLSLDIQNVDLTERALRAYPGRSLFNSAKVDEEELEMKINLLKKYGGTLIVLLMGK-DVPKSFEERKEYFEKALKILERHDFS-DRVIFDPGVLPLGAEGKP----VEVLKTIEFISSKGFNTTVGLSNLSFGLPDRSYYNTAFLVLGISKGLSSAIMNPLDETLMKTLNATLVILEKKELPRAEVK..... 566
6 -42.1003k13_A mol:protein length:300 5-methyltetrahydrofolate-homocysteine methylt  ali model follow..  20  12FVNIGERCNVAGRKFLRLVNEKKYDEALSIARQQVEDGALVIDVNMDDGLLDARTEMTTFLNLIMEIARVPVMIDSSKWEVIEAGLKCLQGKSIVNSISLKEEVFLEHARIIKQYGAATVVMAFDEKGQADTAARKIEVCERAYR-VDKVGFNPHDIIFDPNVLAVATGNNYAVDFIEATGWIRKN--PGAHVSGGVSNLSFSFYIREAMHAVFLYHAIQQGMDMGIVNPGTSVLYSDIKIEDVVLNRRPDAAERLIELAEA 293
7 -36.2004ccz_A mol:protein length:644 METHIONINE SYNTHASE  ali model follow..  23  358FVNIGERCNVAGRKFAKLIMAGNYEEALCVAKVQVEMGAQVLDVNMDDGMLDGPSAMTRFCNLIADIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEDDFLEKARKIKKYGAAMVVMAFDEEGQATETDTKIRVCTRAYH-VKKLGFNPNDIIFDPNILTIGTGNLYAINFIHATKVIKET--PGARISGGLSNLSFSFAIREAMHGVFLYHAIKSGMDMGIVNAGNLPVYDDILCEDLIWNKDPEATEKLLRYAQT 639
8 -32.9002k4m_A mol:protein length:153 UPF0146 protein MTH_1000  ali model follow..  11  3..SSSSGLVPRGSHMWNDLAV--------YIIRCSGPGTRVVEVGAGRFLYVSDYIRKHSKVDLVLTDIKPSHGGIVRDDITSPRMEIYRGAALIYSIRPPAEIHSSLMRVADAVGARLIIKPLTGEDIVTERKMKLVNYGRTYFYEYIAEVRSR........................................................................................................... 147
9 -26.1004djd_D mol:protein length:323 Corrinoid/iron-sulfur protein small subunit  ali model follow..  13  58.MEVQDIVPDWPDVLKDPFTDVINEPGRWAQKCVAEYGADLIYLKLDGADPESVDQCVATVKEVLQAVGVPLVVVEKDHEVLEAVAEAAAGNLLLGNAE--QENYKSLTAACMVHKHNIIARSPLD----------INICKQLNILINEMNLPLDHIVIDPSIGGLGYGIEYSFSIMERIRLGALQGD----KMLSMPVICTVGYEAWRAKEASAPVSEYPGWGKETERGILWEAVTAQAGAHILLMRHPEAVARVKENIDQ 316
10 -21.6002h9a_B mol:protein length:310 CO dehydrogenase/acetyl-CoA synthase, iron-su  ali model follow..  11  51.LEVFDTPPTDWPDILVEPFKDVINDPVAWAKKCVEYGADIVALRLVSAHPDSGAELAEVCKAVADAIDVPLMIEEKDAEIFPVIGEALSGNCLLSSAT--KDNYKPIVATCMVHGHSVVASAPLD----------INLSKQLNIMIMEMNLAPNRIIMDPLIGALGYGIEYSYSIIERMRLLTGDKILAMPVVCFIGQEAWKAKEAIHWETVTTVALIQAGGHLFVMRHPKSLAEVKEHLKRIL................. 309
11 -19.5001tws_A mol:protein length:297 DHPS, Dihydropteroate synthase  ali model follow..  12  35.LIMG--LNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEA--GAHIINDIWGAKAE-PKIAEVAAHYDVPIILM--DNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGI------AKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFDLPVEERLEGTGATVCLGIEKGCEFVRVHDKEMSRMAKMMDAMIGK.............. 288
12 -19.4002vp8_A mol:protein length:318 DIHYDROPTEROATE SYNTHASE 2  ali model follow..  15  43.LIMA--VNRTPDSFYDKGATFSDAAARDAVHRAVADGADVIDVGERVDVDTEITRLVPFIEWLGAYPDQLISVDTWRAQVAKAACAA--GADLINDTWGGVD--PAMPEVAAEFGAGLV-CAHTGGALPRTRPFRISQVTAAAERAVAAGVAREKVLIDP--------GKNTFHGLLLLRHVADLVMTGWPVLMALSNKDVGVDLTERLEGTLAATALAAAAGARMFRVHEAATRRVLEMVASIQGV.............. 307
13 -19.1002vef_A mol:protein length:314 DIHYDROPTEROATE SYNTHASE  ali model follow..  16  11.VICG--INVTPDSFSDGGQFFALEQALQQARKLIAEGASMLDIGSYVEIEEEIQRVVPVIKAIRKESDVLISIDTWKSQVAEAALAA--GADLVNDITGLMGD-EKMPHVVAEARAQVVIMFNPVMGQAFTEEELEAFFERALARAAEAGIAPENILLDP--------GLTKKENLLLLRDLDKLHQKGYPIFLGVSRKRFELGFRNRDTASAHVTSIAARQGVEVVRVHDASHRMAVEIASAIRLADEAENLDLKQYK.. 314
14 -18.9001ad1_A mol:protein length:266 DIHYDROPTEROATE SYNTHETASE  ali model follow..  14  4.KIMG--LNVTPDSFSDGGKFNNVESAVTRVKAMMDEGADIIDVG-GHEMITVEEELNRVLPVVEAIFDVKISVDTFRSEVAEACLKL--GVDIINDQWAGLYD-HRMFQVVAKYDAEIVLM--NGNRDEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGI------AKTRNEEAEVMARLDELVATEYPVLLATSRMGYDTTPVERDEVTAATTAYGIMKGVRAVRVHNELNAKLAKGIDFLKENEN............ 260
15 -18.9004hb7_A mol:protein length:270 Dihydropteroate synthase  ali model follow..  14  8.KIMG--LNVTPDSFSDGGKFNNVETAINRVKAMIDEGADIIDVG-GHEMVTLEEELNRVLPVVEAIFDVKISVDTFRSEVAEACLKL--GVDMINDQWAGLYD-HRMFQIVAKYDAEIILM--NGNRDEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGI------AKTRNEEAEVMARLDELVATEYPVLLATSRMGYDTTPVERDEVTAATTAYGIMKGVRAVRVHNELNAKLAKGIDFLKENEN............ 264
16 -17.9003tr9_A mol:protein length:314 Dihydropteroate synthase  ali model follow..  14  30..VMG--INVSPNSFYHP---LDLNSALRTAEKMVDEGADILDIDIKTDSPSTQIELDRLLPVIDAIFPQLISVDTSRPRVMREAVNT--GADMINDQRA---QLDDALTTVSALKTPVC--LMHFPSETRKPGSTKKELQESIQRCKKAGISEDRIIIDP--FGQGNYGKNVSENFYLLNKLPEFVAMGLPVLSGWSRKSMNQPPENRLFGSIAADVLAVYHGASIIRTHDKATREAIKIATYTRSVDT............ 294
17 -17.5003tyu_A mol:protein length:280 7,8-dihydropteroate synthase  ali model follow..  15  20..VMG--LNVTPDSFSDGGCHNNLDQALQHAQRMLSAGATLIDIGAEVSEQEELDRVVPVVEALAQRFDVWLSVDTSKAAVITESAHA--GAHLINDIRSLQE--PGALEAAAKTGLPVCLMHM--QGQPKNMQHSNRFFQHHIERCVAAGIAKNKLLLDP--------GKNLAHNYQLLAHLSELHHFELPLLVGMSRKSMNVPPQQRVIGSVACAVIAAMQGAQIIRVHDKETVEAMCIVEATRS............... 277
18 -17.5001aj0_A mol:protein length:282 DIHYDROPTEROATE SYNTHASE  ali model follow..  16  17..VMG--LNVTPDSFSDGGTHNSLIDAVKHANLMINAGATIIDVGAEVSVEEELQRVIPVVEAIAQRFEVWISVDTSKPEVIRESAKV--GAHIINDIRSLSE--PGALEAAAETGLPVCLMHM--QGNPKTMQEANRYFIEQIARCEQAGIAKEKLLLDP--------GKNLSHNYSLLARLAEFHHFNLPLLVGMSRKSMNVGPSERLSGSLACAVIAAMQGAHIIRVHDKETVEAMRVVEATLSAKE............ 277
19 -17.3001eye_A mol:protein length:280 DIHYDROPTEROATE SYNTHASE I  ali model follow..  16  7.QVMG--LNVTDDSFSDGGCYLDLDDAVKHGLAMAAAGAGIVDVG-GATRVDPAVETSRVIPVVKELAGITVSIDTMRADVARAALQN--GAQMVNDVSGGRAD-PAMGPLLAEADVPWV--LMHWRAVSADTPHVPVRYGNVVADAVAAGVDPARLVLDP--------AKTAQHNWAILHALPELVATGIPVLVGASRKRF-TDGRDTATAVISALAALHGAWGVRVHDV-RASVDAIKVVEAWMGAER............ 275
20 -16.1002y5j_A mol:protein length:294 DIHYDROPTEROATE SYNTHASE  ali model follow..  15  25..VMG--LNATPDSFSDGGRFLARDDALRRAERMIAEGADLLDIG-GAPPVPLDEELARVIPLVEALLNVPLSIDTYKPAVMRAALAA--GADLINDIWGFRQ--PGAIDAVRDGNSGLCAMHM--LGEPQTMQVGEPDYGDVVTDVRDFGVAAERICVDPGFGFGKAVVDDNYALLAALPDTAPADGRAYPILAGMSRKSM-PLERVAASVAAALCAVERGAAIVRVHDVAATV........................... 278
21 -15.1002dqw_A mol:protein length:294 Dihydropteroate synthase  ali model follow..  19  31..LLG--LNLTPDSFSDGGRYLDPERALERAREMVAEGADILDLG-GAAPVPVEEEKRRLLPVLEAVLGVPVSVDTRKPEVAEEALKL--GAHLLNDVTGLRD--ERMVALAARHGVAAVVMHM-PVPDPATMMAHKAFLEAQARRALSAGV--PQVVLDP--------GKLLEHNLALLRRLDEIVALGHPVLVGLSRKRT-PAQRVHGSVAAHLFAVMKGVRLLRVHDV-RAHREALGVWEALYGGDR............ 290
22 -14.9003mcm_A mol:protein length:442 2-amino-4-hydroxy-6-hydroxymethyldihydropteri  ali model follow..  13  187..RMG--VNLSNQSFSDG--NFDDNQRKLNLDELIQSGAEIIDIG-DAKPISIEEEFNKLNEFLEYFKKPLVSIDTRKLEVMQKILAKHHD-WMINDVEC---NIEQKAQLIAKYNKKYV--IIHNLGITDRNQYLCDYIEQKKQILLKHGIAQQNIYFDI--FGFGKKSDTARYLLENIIEIKR--RLELKALVGHSRKPSNLATLDRATRELSRKLEKLDIDIIRVH................................. 434
23 -13.0002bmb_A mol:protein length:545 FOLIC ACID SYNTHESIS PROTEIN FOL1  ali model follow..  10  227..IMA--FNATPDSFSDGGEHADIESQLNDIIKLCKDASVIIDVG-NSIQASEEEEIRRSIPLIKAIDKVILSIDTYRSNVAKEAIKV--GVDIINDISGGLFDSNMFAVIAENPEICYI--LSHTRGDISTMNRLAHYIGERYIKAIDNGVKRWQILIDP--LGFAKTWKQNLQIIRHIPILKNYSFTNMPVLLGPSRKKF-AKQRDFATGAVVASCIGFGSDMVRVHDVKNCSKSIKLADAIYKGLE............. 545
24 -10.6004m3p_A mol:protein length:406 Betaine--homocysteine S-methyltransferase 1  ali model follow..  356RIASGRPYNPSMSKDGWGVTKGTAELMQQKEATTEQQLKELFEKQKFKSQ.................................................................................................................................................................................................................... 406
25 -9.6001umy_A mol:protein length:407 BETAINE--HOMOCYSTEINE S-METHYLTRANSFERASE  ali model follow..  356RIASGRPYNPSMSKDAWGVTKGAAELMQQKEATTEQQLRALFEKQKFKSA.................................................................................................................................................................................................................... 406

FFAS is supported by the NIH grant R01-GM087218-01
8 5 8 4 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zmasek CM, Zhang Q, Ye Y, Godzik A. Surprising complexity of the ancestral apoptosis network. Genome Biol. 2007 Oct 24;8(10):R226 [Epub ahead of print]