current user: public




1f6yA
Query: 1f6y_A mol:protein length:262 5-METHYLTETRAHYDROFOLATE CORRINOID/IRON SULFU, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst MLIIGERINGMFGDIKRAIQERDPAPVQEWARRQEEGGARALDLNVGPAVQDKVSAMEWLVEVTQEVSNLTLCLDSTNIKAIEAGLKKCKNRAMINSTNAEREKVEKLFPLAVEHGAALIGLTMNKTGIPKDSDTRLAFAMELVAAADEFGLPMEDLYIDPLILPANVAQDHAPEVLKTLQQIKMLADPAPKTVLGLSNVSQNCQNRPLINRTFLAMAMACGLMSAIADACDEALIETAATAEILLNQTVYCDSFVKMFKTRLast
1 -105.0001f6y_A mol:protein length:262 5-METHYLTETRAHYDROFOLATE CORRINOID/IRON SULFU  ali model  100  1MLIIGERINGMFGDIKRAIQERDPAPVQEWARRQEEGGARALDLNVGPAVQDKVSAMEWLVEVTQEVSNLTLCLDSTNIKAIEAGLKKCKNRAMINSTNAEREKVEKLFPLAVEHGAALIGLTMNKTGIPKDSDTRLAFAMELVAAADEFGLPMEDLYIDPLILPANVAQDHAPEVLKTLQQIKMLADPAPKTVLGLSNVSQNCQNRPLINRTFLAMAMACGLMSAIADACDEALIETAATAEILLNQTVYCDSFVKMFKTR 262
2 -105.0002ogy_A mol:protein length:262 5-methyltetrahydrofolate corrinoid/iron sulfu  ali model follow..  98  1MLIIGERINGMFGDIKRAIQERDPAPVQEWARRQEEGGARALDLNVGPAVQDKVSAMEWLVEVTQEVSNLTLCLDSTNIKAIEAGLKKCKNRAMINSTNAEREKVEKLFPLAVEHGAALIGLTMNKTGIPKDSDTRLAFAMELVAAADEFGLPMEDLYIDPLILPANVAQDHAPEVLKTLQQIKMLADPAPKTVLGLSAVSQNCQNRPLINRTFLAMAMACGLDAAIADACDEALIETAATAEILLNQTVYCDSFVKMFKTR 262
3 -101.0002yck_X mol:protein length:272 5-METHYLTETRAHYDROFOLATE CORRINOID/IRON SULFU  ali model follow..  61  11FIMIGERINGMFKDIREAILNKDPRPIQEWARRQAEKGAHYLDVNTGPTADDPVRVMEWLVKTIQEVVDLPCCLDSTNPDAIEAGLKVHRGHAMINSTSADQWKMDIFFPMAKKYEAAIIGLTMNEKGVPKDANDRSQLAMELVANADAHGIPMTELYIDPLILPVNVAQEHAVEVLETIRQIKLMANPAPRTVLGLSNVSQKCPDRPLINRTYLVMAMTAGLDAAIMDVDDDALVDAAATAHILLNKEIYCDSYLKTFRQK 272
4 -82.8003k13_A mol:protein length:300 5-methyltetrahydrofolate-homocysteine methylt  ali model follow..  20  12FVNIGERCNVAGSRFLRLVNEKKYDEALSIARQQVEDGALVIDVNMDDGLLDARTEMTTFLNLIPEIARVPVMIDSSKWEVIEAGLKCLQGKSIVNSISLKEEVFLEHARIIKQYGAATVVMAFDEKGQADTAARKIEVCERAYRLVDKVGFNPHDIIFDPNVLAVATGEEHNNYAVDFIEATGWIRKPGAHVSGGVSNLSFSFRIREAMHAVFLYHAIQQGMDMGIVNPGTSVLYSDIKIEDVVLNRRPDAAERLIELAEA 293
5 -72.4001q7m_A mol:protein length:566 5-methyltetrahydrofolate S-homocysteine methy  ali model follow..  28  315FVVIGERINPAGRKLWAEMQKGNEEIVIKEAKTQVEKGAEVLDVNFGIESQIDVRYVEKIVQTLPYVSNVPLSLDIQNVDLTERALRAYPGRSLFNSAKVDEEELEMKINLLKKYGGTLIVLLMGK-DVPKSFEERKEYFEKALKILERHDFS-DRVIFDPGVLPLGAEGK----PVEVLKTIEFISSKGFNTTVGLSNLSFGLPDRSYYNTAFLVLGISKGLSSAIMNPLDETLMKTLNATLVILEKKELPRAEVK..... 566
6 -41.3003kow_A mol:protein length:763 D-ornithine aminomutase E component  ali model follow..  216AQIDGAHANATAREMVQHALNSIFSLKVGMKKSNICLSVPPTAPPAPSMYLDLPYAVARMRAQMNTKYMEASTREATVTHVLNLLISKLTRADIQSTITPDENVPWHIYNIEACDTAKQALIGMDGLMDMVQLKREGVLGDTVRELKERVLFMEEIIEAGGYFNAVEQGFFV-DSGYYPERNGDGIARNGGIGAGTVFERDEDY--MAPVTAHFGYNNVKQYDEALVSEPSKLIDGCTLEVPEKILDENDNVNVRMEETKEF 502
7 -37.8002k4m_A mol:protein length:153 UPF0146 protein MTH_1000  ali model follow..  11  1...MGSSLVPRGSHM--------WNDLAVYIIRCSGPGTRVVEVGAGRFLYVSDYIRKHSKVDLVLTDIKPSHGGIVRDDITSPRMEIYRGAALIYSIRPPAEIHSSLMRVADAVGARLIIKPLTGEDIVTERKMKLVNYGRTYFYEYIAEVRSR........................................................................................................... 147
8 -35.5004djd_D mol:protein length:323 Corrinoid/iron-sulfur protein small subunit  ali model follow..  13  57GMEVQDIVPDWPDVLKDPFTDVINEPGRWAQKCVAEYGADLIYLKLDGADPESVDQCVATVKEVLQAVGVPLVVVEKDHEVLEAVAEAAAGELLLGNAE--QENYKSLTAACMVHKHNIIARSPLDINI----------CKQLNILINEMNLPLDHIVIDPSIGGLGYGIEYSFSIMERIRLGA----LQGDKMLSMPVICTVGYEAWRAKEASAPVSEYPGWGKETERGILWEAVTAQAGAHILLMRHPEAVARVKENIDQ 316
9 -34.6002h9a_A mol:protein length:445 Carbon monoxide dehydrogenase corrinoid/iron-  ali model follow..  14  88.FEHPCGLAILVEDLSEGEIKERVEKINKLVFDRVGQMHS-VNLVALKGSSQDAATFAKAVATAREVTDLPFILIGTPEQLAAALETEGANNPLLYAAT--ADNYEQMVELAKKYNVPLTVSAKGLDAL-----------AELVQKITALGY--KNLILDPQPENISEG-------LFYQTQIRRLAIKKLFRPFGYPTIAFALDENPYQAVMEASVYIAKYAGIIVLNTVEPADILPLITLRLNIYTDPQKPIAVEP.... 322
10 -34.4002h9a_B mol:protein length:310 CO dehydrogenase/acetyl-CoA synthase, iron-su  ali model follow..  10  48.RFALEVFDTPPTDWPDILVKDVINDPVAWAKKCVEYGADIVALRLVSAHPDSGAELAEVCKAVADAIDVPLMIEEKDAEIFPVIGEALSGRCLLSSAT--KDNYKPIVATCMVHGHSVVASAPLD----------INLSKQLNIMIMEMNLAPNRIIMDPLIGALGYGIEYSYSIIERMRALTGDKILAMPVVCFIGQEAWKAKEAKDPEVAEWGDYALRAIHWETV----TTVALIQAGGHLFVMRHPKSLAEVKEHLKR 307
11 -28.2004djd_C mol:protein length:446 Corrinoid/iron-sulfur protein large subunit  ali model follow..  13  88..FYHETAIAIQSDNLSSEELKAKVEAINGLNFDRVGQHYTIQAIAIRHDADDPAAFKAAVASVAAATQLNLVLMADDPDVLKEALAGVADKPLLYAAT--GANYEAMTALAKENNCPLAVYGNGLEE-----------LAELVDKIVALGH--KQLVLDPGARETSRA-------IADFTQIRRLAIKKRFRSFGYPIIALTTAANPLDEVLQAVNYVTKYASLVVLRTDAKEHLLPLLSWRQNLYTDPQVPIRVEE.... 323
12 -21.5002vef_A mol:protein length:314 DIHYDROPTEROATE SYNTHASE  ali model follow..  17  11.VICG--INVTPDSFSDGGQFFALEQALQQARKLIAEGASMLDIGSYVEIEEEIQRVVPVIKAIRKESDVLISIDTWKSQVAEAALAA--GADLVNDITGLMGD-EKMPHVVAEARAQVVIMFNPVMGQAFTEEELEAFFERALARAAEAGIAPENILLDPGI------GLTKKENLLLLRDLDKLHQKGYPIFLGVSRKRFELGFRNRDTASAHVTSIAARQGVEVVRVHDASHRMAVEIASAIRLADEAENLDLKQYK.. 314
13 -21.1001tws_A mol:protein length:297 DHPS, Dihydropteroate synthase  ali model follow..  12  35.LIMG--LNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEA--GAHIINDIWGAKAE-PKIAEVAAHYDVPIILMHNRDNMNYRNLMADMADLYDSIKIAKDAGVRDENIILDPGI------AKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFDLPVEERLEGTGATVCLGIEKGCEFVRVHDKEMSRMAKMMDAMIGK.............. 288
14 -20.8001aj0_A mol:protein length:282 DIHYDROPTEROATE SYNTHASE  ali model follow..  16  17..VMG--LNVTPDSFSDGGTHNSLIDAVKHANLMINAGATIIDVGAEVSVEEELQRVIPVVEAIAQRFEVWISVDTSKPEVIRESAKV--GAHIINDIRSLSE--PGALEAAAETGLPVCLMHM--QGNPKTMQEANRYFIEQIARCEQAGIAKEKLLLDPGF------GKNLSHNYSLLARLAEFHHFNLPLLVGMSRKSMNVGPSERLSGSLACAVIAAMQGAHIIRVHDKETVEAMRVVEATLSAKE............ 277
15 -20.7003tyu_A mol:protein length:280 7,8-dihydropteroate synthase  ali model follow..  15  20..VMG--LNVTPDSFSDGGCHNNLDQALQHAQRMLSAGATLIDIGAEVSEQEELDRVVPVVEALAQRFDVWLSVDTSKAAVITESAHA--GAHLINDIRSLQE--PGALEAAAKTGLPVCLMHM--QGQPKNMQHSNRFFQHHIERCVAAGIAKNKLLLDP--------GKNLAHNYQLLAHLSELHHFELPLLVGMSRKSMNVPPQQRVIGSVACAVIAAMQGAQIIRVHDKETVEAMCIVEATRSAK............. 279
16 -20.4001ad1_A mol:protein length:266 DIHYDROPTEROATE SYNTHETASE  ali model follow..  13  4.KIMG--LNVTPDSFSDGGKFNNVESAVTRVKAMMDEGADIIDVG-GHEMITVEEELNRVLPVVEAIVDVKISVDTFRSEVAEACLKL--GVDIINDQWAGLYD-HRMFQVVAKYDAEIVLMHNGNGNRDEPVVEEMTSLLAQAHQAKIAGIPSNKIWLDPGI------AKTRNEEAEVMARLDELVATEYPVLLATSRKRFDTTPVERDEVTAATTAYGIMKGVRAVRVHNELNAKLAKGIDFLKENEN............ 260
17 -20.1002y5j_A mol:protein length:294 DIHYDROPTEROATE SYNTHASE  ali model follow..  16  24.LVMG--LNATPDSFSDGGRFLARDDALRRAERMIAEGADLLDIG-GAPPVPLDEELARVIPLVEALLNVPLSIDTYKPAVMRAALAA--GADLINDIWGFRQ--PGAIDAVRDGNSGLCAMHM--LGEPQTMQVGRDFLAARAQALRDAGVAAERICVDPGFGFGKAVVDDNYALLAALPDTAPARGRAYPILAGMSRKSMGKPPLERVAASVAAALCAVERGAAIVRVHDAATVDALSVWNAVRAAARQ........... 293
18 -19.6003tr9_A mol:protein length:314 Dihydropteroate synthase  ali model follow..  13  30..VMG--INVSPNSFYHP--HLDLNSALRTAEKMVDEGADILDIGDSPSTQIELDRLLPVIDAIKKRFPQLISVDTSRPRVMREAVNT--GADMINDQRA---QLDDALTTVSALKTPVCLMHF--PSETRKPGSTKKELQESIQRCKKAGISEDRIIIDP--FGQGNYGKNVSENFYLLNKLPEFVAMGLPVLSGWSRKSMNQPPENRLFGSIAADVLAVYHGASIIRTHDKATREAIKIATYTRSVDT............ 294
19 -19.0001eye_A mol:protein length:280 DIHYDROPTEROATE SYNTHASE I  ali model follow..  15  8..VMG--LNVTDDSFSDGGCYLDLDDAVKHGLAMAAAGAGIVDVG-GATRVDPAVETSRVIPVVKELAGITVSIDTMRADVARAALQN--GAQMVNDVSGGRAD-PAMGPLLAEADVPWVLMHW--RAVSADTPHVRADLLASVADAVAAGVDPARLVLDPGL------AKTAQHNWAILHALPELVATGIPVLVGASRKRFMRPTDGRDTATAVISALAALHGAWGVRVHDRASVDAIKVVEAWMGAERIERD........ 279
20 -18.5002dqw_A mol:protein length:294 Dihydropteroate synthase  ali model follow..  19  31..LLG--LNLTPDSFSDGGRYLDPERALERAREMVAEGADILDLG-GAAPVPVEEEKRRLLPVLEAVLGVPVSVDTRKPEVAEEALKL--GAHLLNDVTGLRD--ERMVALAARHGVAAVVMHM-PVPDPATMMAHKAFLEAQARRALSAGV--PQVVLDPGF------GKLLEHNLALLRRLDEIVALGHPVLVGLSRKRTDPAQRVHGSVAAHLFAVMKGVRLLRVHDV-RAHREALGVWEALYGGDR............ 290
21 -18.5002vp8_A mol:protein length:318 DIHYDROPTEROATE SYNTHASE 2  ali model follow..  15  43.LIMA--VNRTPDSFYDKGATFSDAAARDAVHRAVADGADVIDVGERVDVDTEITRLVPFIEWLGAYPDQLISVDTWRAQVAKAACAA--GADLINDTWGGVD--PAMPEVAAEFGAGLVCAHTGGTTTRGVVDAVISQVTAAAERAVAAGVAREKVLIDP--------GKNTFHGLLLLRHVADLVMTGWPVLMALSNKDVGVDLTERLEGTLAATALAAAAGARMFRVHEAATRRVLEMVASIQGVRP............ 309
22 -15.7003mcm_A mol:protein length:442 2-amino-4-hydroxy-6-hydroxymethyldihydropteri  ali model follow..  13  186.IRMG--VNLSNQSFSDG--NFDDNQRKLNLDELIQSGAEIIDIG-DAKPISIEEEFNKLNEFLEYFYKPLVSIDTRKLEVMQKILAK----WMINDVEC---NIEQKAQLIAKYNKKYVII--HNLGITDRNQYLCDYIEQKKQILLKHGIAQQNIYFDI--FGFGKKSDTARYLLENIIEIK--RRLELKALVGHSRKPSNLATLDRATRELSRKLEKLDIDIIRVH................................. 434
23 -14.6002bmb_A mol:protein length:545 FOLIC ACID SYNTHESIS PROTEIN FOL1  ali model follow..  10  226.YIMA--FNATPDSFSDG---ADIESQLNDIIKLCKDASVIIDVG-NSIQASEEEEIRRSIPLIKAIRKVILSIDTYRSNVAKEAIKV--GVDIINDISGGLFDSNMFAVIAENPEICYILSHT--RGDISTMNRLGQEIGERYIKAIDNGVKRWQILIDP--LGFAKTWKQNLQIIRHIPILKNY--RNMPVLLGPSRKKFDAKQRDFATGAVVASCIGFGSDMVRVHDV-KNCSKSIKLADAIYK............... 542
24 -13.1003cwo_X mol:protein length:237 beta/alpha-barrel protein based on 1THF and 1  ali model follow..  4................RVLIVDDATNGREAVEKYKELKPDIVTMDITMPEMNGIDAIK-EIMKIDPNAKIIVCSAMGQQAMVIEAIKAGAKDFIVNTAAVENPSL--ITQIAQTFGSQAVVVAIDYSGKKNTGILLRDWVVEVEKRGAG----------EILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKME-------------FLEAFLAGADAALAAS................................ 204
25 -12.1001lt7_A mol:protein length:406 BETAINE-HOMOCYSTEINE METHYLTRANSFERASE  ali model follow..  356RIASGRPYNPSMSKDGWGVTKGTAELMQQKEATTEQQLKELFEKQKFKS..................................................................................................................................................................................................................... 405
26 -12.0002lle_A mol:protein length:234 Chemotaxis protein CheY, Imidazole glycerol p  ali model follow..  9.....................DDATNGREAVEKYKELKPDIVTMDI-TMPEMNGIDAIKEIMKIDPNAKIIVCSAMGQQAMVIEAIKAGAKGFIVNTAAVENPSL--ITQLAQTFGSQAVVVAIDAKGKKNTGILLRDWVVEVEKRGAG----------EILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKMEH------------FLEAFLAGADAAAA.................................. 202
27 -11.5001umy_A mol:protein length:407 BETAINE--HOMOCYSTEINE S-METHYLTRANSFERASE  ali model follow..  356RIASGRPYNPSMSKDAWGVTKGAAELMQQKEATTEQQLRALFEKQKFKSAQ................................................................................................................................................................................................................... 407
28 -10.9003og3_A mol:protein length:251 Imidazole glycerol phosphate synthase subunit  ali model follow..  11.....KRVDGEFMVFTHSGKKNTGILLRDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGKMEHFLEAFLAGADKVSINTAAVENPSL--ITQIAQTFGSQAVVVAIDHSGKKNTGILLRDWVVEVEKRGAG----------EILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKME-------------FLEAFLAGADKVSINTAAVENPSLITQIAQTFGSLE............ 245
29 -10.5001ka9_F mol:protein length:252 imidazole glycerol phosphtate synthase  ali model follow..  15  1.MSLAKRIDVHAGRVVKGVN-RDAGDPVEAARAYDEAGADFLDISATH---EERAILLDVVARVAERVFIPLTVGGRSLEDARKLLLSGADKVSVNSAAVRRPEL--IRELADHFGAQAVVLAIDAGGRVPTGLHAVEWAVKGVELGAG----------EILLTSMDRDGTKEGYDLRLTRMVAEAVGVPVIASGGAGRME-------------FLEAFQAGAEAALAAS................................ 226
30 -9.8701h5y_A mol:protein length:253 HISF  ali model follow..  13  16....GAKVVVKGVNFQGIREVGD----VEMAVRYEEEGADILDITAAP---EGRATFIDSVKRVAEAVSIPVLVGGRSLEDATTLFRAGADKVSVNTAAVRNPQL--VALLAREFGSQSTVVAIDAKGREATGLDAVKWAKEVEELGAG----------EILLTSIDRDGTGLGYDVELIRRVADSVRIPVIASGGAGRVEH------------FYEAAAAGADAVLA.................................. 226
31 -9.6603iiv_A mol:protein length:263 KE7 KE7_R7_1/3H  ali model follow..  12  27.....................RDSGDPVELGKFYSEIGIDFWDITASV---EKRKTMLELVEKVAEQIDIPITVGGYDFETASELILRGADKVEINTAAVENPSL--ITQIAQTFGSQAVVVYIAAKGTKNTGILLRDWVVEVEKRGAG----------EIVLGSIDRLGTKSGYDTEMIRFVRPLTTLPIIAHRGAGKTEH------------FLEAFLAGADAAKA.................................. 223
32 -9.6401vh7_A mol:protein length:265 Imidazole glycerol phosphate synthase subunit  ali model follow..  13  29.....................RDSGDPVELGKFYSEIGIDFLDITASV---EKRKTMLELVEKVAEQIDIPFTVGGHDFETASELILRGADKVSINTAAVENPSL--ITQIAQTFGSQAVVVAIDAKGKKNTGILLRDWVVEVEKRGAG----------EILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKMEH------------FLEAFLAGADAALA.................................. 225
33 -9.6003iio_A mol:protein length:262 KE07  ali model follow..  12  28.....................RDSGDPVELGKFYSEIGIDFWDITASV---EKRKTMLELVEKVAEQIDIPFTVGGHDFETASELILRGADKVEINTAAVENPSL--ITQIAQTFGSQAVVVYIAAKGEKNTGILLRDWVVEVEKRGAG----------EIVLGSIDRLGTKSGYDTEMIRFVRPLTTLPIIAHRGAGKMEH------------FLEAFLAGADAAKA.................................. 224
34 -9.6002rkx_A mol:protein length:255 Cyclase subunit of imidazoleglycerol_evolvedc  ali model follow..  12  27.....................RDSGDPVELGKFYSEIGIDFWDITASV---EKRKTMLELVEKVAEQIDIPFTVGGHDFETASELILRGADKVEINTAAVENPSL--ITQIAQTFGSQAVVVYIAAKGKKNTGILLRDWVVEVEKRGAG----------EIVLGSIDRLGTKSGYDTEMIRFVRPLTTLPIIAHGGAGKMEH------------FLEAFLAGADAAKA.................................. 223
35 -9.5402a0n_A mol:protein length:265 Imidazole glycerol phosphate synthase subunit  ali model follow..  13  33.....................RDSGDPVELGKFYSEIGIDFLDITASV---EKRKTMLELVEKVAEQIDIPFTVGGHDFETASELILRGADKVSINTAAVENPSL--ITQIAQTFGSQAVVVAIDAKGKKNTGILLRDWVVEVEKRGAG----------EILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKMEH------------FLEAFLAGADAALA.................................. 229
36 -9.0902yr1_A mol:protein length:257 3-dehydroquinate dehydratase  ali model follow..  12  14......WIGGTEPCICAPVVGEDDRKVLREAEEVCRKQPDLLEWRADFRAIDDQERVLATANGLRNIAEIPILFIPLNEAEVRRLIEAICRSGAIDLVDYEGERIADVRRMTEECSVWLVVSRHYFDGTPRKET-----LLADMRQAERYGAD---------IAKVAVMPKSPEDVLVLLQATEEARRELAIPLITMAMGGLGAITR-LAGWLFGSAVTFAVGNQSSA-PGQIPIDDVRTVLSIL................. 252

FFAS is supported by the NIH grant R01-GM087218-01
6 0 8 9 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Rychlewski L, Jaroszewski L, Li W, Godzik A. Comparison of sequence profiles. Strategies for structural predictions using sequence information. Protein Sci. 2000 Feb;9(2):232-41.