current user: public




Query: 1erv_A mol:protein length:105 THIOREDOXIN, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELVLast
1 -71.5001erv_A mol:protein length:105 THIOREDOXIN  ali model  100  1MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
2 -71.5003trx_A mol:protein length:105 THIOREDOXIN  ali model   98  1MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCTPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
3 -71.4003e3e_A mol:protein length:105 Thioredoxin  ali model   98  1MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPSKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKRMPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
4 -71.4003kd0_A mol:protein length:105 Thioredoxin  ali model   97  1MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPSKMIKPFFHSLSEKYSNVIFLEVDVDDSQDVASESEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
5 -71.4001aiu_A mol:protein length:105 THIOREDOXIN  ali model   98  1MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
6 -71.4001cqg_A mol:protein length:105 THIOREDOXIN  ali model   95  1MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPAKMIKPFFHSLSEKYSNVIFLEVDVDDAQDVASEAEVKATPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
7 -71.3001erw_A mol:protein length:105 THIOREDOXIN  ali model   97  1MVKQIESKTAFQEALDAAGDKLVVVDFSATWSGPSKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
8 -69.8003ZZX Entity 1(prereleased)  ali follow..  50  1MVYQVKDQEDFTKQLNEAGNKLVVIDFYATWCGPCKMIAPKLEELSQSMSDVVFLKVDVDECEDIAQDNQIACMPTFLFMKNGQKLDSLSGANYDKLLELVEKN. 104
9 -69.8003qfa_C mol:protein length:116 Thioredoxin  ali model   99  7.VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPSKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV 110
10 -69.8001gh2_A mol:protein length:107 THIOREDOXIN-LIKE PROTEIN  ali model   40  2GVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFQFFRNKVRIDQYQGADAVGLEEKIKQHL 106
11 -67.5001xwa_A mol:protein length:111 thioredoxin  ali model   51  6MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFDNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKANI 111
12 -67.3002vim_A mol:protein length:104 THIOREDOXIN  ali model   37  1.MRVLATAADLEKLINENKGRLIVVDFFAQWCGPCRNIAPKVEALAKEIPEVEFAKVDVDQNEEAAAKYSVTAMPTFVFIKDGKEVDRFSGANETKLRETITRH. 103
13 -65.9002xbi_A mol:protein length:108 THIOREDOXIN  ali model   43  6.LIELKQDGDLESLLEQHKNKLVVVDFFATWCGPCKTIAPLFKELSEKY-DAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIAKVEDMIKKFI 108
14 -65.3002xbq_A mol:protein length:117 THIOREDOXIN  ali model   43  15.LIELKQDGDLESLLEQHKNKLVVVDFFATWCGPCKTIAPLFKELSEKY-DAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIAKVEDMIKKFI 117
15 -65.0003f3q_A mol:protein length:109 Thioredoxin-1  ali model   46  1MVTQFKTASEFDSAIAQ--DKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAIAAN. 102
16 -64.6001m7t_A mol:protein length:107 Chimera of Human and E. coli thioredoxin  ali model   70  1MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDAQDVAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDANL 106
17 -64.3002vm1_A mol:protein length:118 THIOREDOXIN H ISOFORM 1.  ali model   40  8.VIACHTKQEFDTHMANGTGKLVIIDFTASWCGPCRVIAPVFAEYAKKFPGAIFLKVDVDELKDVAEAYNVEAMPTFLFIKDGEKVDSVVGGRKDDIHTKIVALM 113
18 -64.1002diy_A mol:protein length:130 Thioredoxin-like protein 2  ali model   27  20.VEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHA 123
19 -64.1001syr_A mol:protein length:112 thioredoxin  ali model   39  3MVKIVTSQAEFDSIISQ--NELVIVDFFAEWCGPCKRIAPFYEECSKTYTKMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGANDSALKQLIEKYA 105
20 -63.8001xfl_A mol:protein length:124 Thioredoxin h1  ali model   43  12.VIACHTVETWNEQLQKASKTLVVVDFTASWCGPCRFIAPFFADLAKKLPNVLFLKVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAKHL 117
21 -63.7001ti3_A mol:protein length:113 thioredoxin H  ali model   42  6.VIACHTVDTWKEHFEKGSQKLIVVDFTASWCPPCKMIAPIFAELAKKFPNVTFLKVDVDELKAVAEEWNVEAMPTFIFLKDGKLVDKTVGADKDGLPTLVAKHA 111
22 -63.5001ep7_A mol:protein length:112 THIOREDOXIN CH1, H-TYPE  ali model   46  4.VIVIDSKAAWDAQLAKGEHKPIVVDFTATWCGPCKMIAPLFETLSNDYGKVIFLKVDVDAVAAVAEAAGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHA 110
23 -62.9001wmj_A mol:protein length:130 Thioredoxin H-type  ali model   39  15VVIACHNKDEFDAQMTKAAGKVVIIDFTASWCGPCRFIAPVFAEYAKKFPGAVFLKVDVDELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTIVKHV 121
24 -62.9002fa4_A mol:protein length:111 Thioredoxin II  ali model   48  2MVTQLKSASEYDSALASG-DKLVVVDFFATWCGPCKMIAPMIEKFAEQYSDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAIASNV 105
25 -62.7002oe0_A mol:protein length:114 Thioredoxin-3  ali model   42  8.ITKLTNLTEFRNLIKQ--NDKLVIDFYATWCGPCKMMQPHLTKLIQAYPDVRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPTALEKGIKDL. 108
26 -62.7002wz9_A mol:protein length:153 GLUTAREDOXIN-3  ali model   27  14.VEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHA 117
27 -62.3002iwt_A mol:protein length:125 THIOREDOXIN H ISOFORM 2  ali model   38  17.VISVHSLEQWTMQIEEAAKKLVVIDFTASWCGPSRIMAPVFADLAKKFPNAVFLKVDVDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTAKVGLHA 122
28 -61.9001faa_A mol:protein length:124 THIOREDOXIN F  ali model   39  24......NKDTFWPIVKAAGDKPVVLDMFTQWCGPCKAMAPKYEKLAEEYLDVIFLKLDCNENKTLAKELGIRVVPTFKILKENSVVGEVTGAKYDKLLEAIQAAR 123
29 -61.8001r26_A mol:protein length:125 Thioredoxin  ali model   31  15.VVDVYSVEQFRNIMSE--DILTVAWFTAVWCGPCKTIERPMEKIAYEFPTVKFAKVDADNNSEIVSKCRVLQLPTFIIARSGKMLGHVIGANPGMLRQKLRDII 116
30 -61.0002j23_A mol:protein length:121 THIOREDOXIN  ali model   46  11.VQVISSYDQFKQVTG--GDKVVVIDFWATWCGPCKMIGPVFEKISDTPDKVGFYKVDVDEQSQIAQEVGIRAMPTFVFFKNGQKIDTVVGADPSKLQAAITQHS 114
31 -61.0003d21_A mol:protein length:139 Thioredoxin H-type  ali model   41  26.VHLITTKERWDQKLSEADGKIVLANFSARWCGPCKQIAPYYIELSENYPSLMFLVIDVDELSDFSASWEIKATPTFFFLRDGQQVDKLVGANKPELHKKITAIL 131
32 -61.0003cxg_A mol:protein length:133 Putative thioredoxin  ali model   23  15IYIELKNTGSLNQVFSSTQNSSIVIKFGAVWCKPCNKIKEYFKNQLNYY-YVTLVDIDVDIHPKLNDQHNIKALPTFEFYFNLNNVHTVEGANQNDIEKAFQKYC 122
33 -60.9003d22_A mol:protein length:139 Thioredoxin H-type  ali model   39  26.VHLITTKERWDQKLSEADGKIVLANFSARWCGPSRQIAPYYIELSENYPSLMFLVIDVDELSDFSASWEIKATPTFFFLRDGQQVDKLVGANKPELHKKITAIL 131
34 -60.2003d6i_A mol:protein length:112 Monothiol glutaredoxin-3  ali model   31  2.VIEINDQEQFTYLTTTAGDKLIVLYFHTSWAEPCKALKQVFEAISNEPSNVSFLSIDADENSEISELFEISAVPYFIIIHKGTILKELSGADPKEYVSLLEDCK 108
35 -56.8002f51_A mol:protein length:118 thioredoxin  ali model   33  5IVHFNGTHEALLNRIKEA-PGLVLVDFFATWCGPCQRLGQILPSIAEANKDVTFIKVDVDKNGNAADAYGVSSIPALFFVKKEKTLDQFVGADVSRIKADIEKF. 111
36 -56.7003hhv_A mol:protein length:110 Thioredoxin (TrxA-2)  ali model   34  12......NSKNFDEFITK--NKIVVVDFWAEWCAPCLILAPVIEELANDYPQVAFGKLNTEESQDIAMRYGIMSLPTIMFFKNGELVDQILGAPREEIEVRLKSLL 109
37 -56.1002e0q_A mol:protein length:104 thioredoxin  ali model   36  5......DSKNFDSFLAS--HEIAVVDFWAEWCAPCLILAPIIEELAEDYPQVGFGKLNSDENPDIAARYGVMSLPTVIFFKDGEPVDEIIGAPREEIEIRIKNLL 102
38 -53.9002o7k_A mol:protein length:107 Thioredoxin  ali model   35  4MAIVKVTDADFDSKVESG---VQLVDFWATWCGPCKMIAPVLEELAADYGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFPKENLAEVLDKHL 107
39 -53.8002o89_A mol:protein length:107 Thioredoxin  ali model   33  4MAIVKVTDADFDSKVESG---VQLVDFWATWCGTSKMIAPVLEELAADYGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFPKENLAEVLDKHL 107
40 -53.8003tco_A mol:protein length:109 Thioredoxin (TrxA-1)  ali model   34  10......TEENFDEVIRN--NKLVLVDCWAEWCAPCHLYEPIYKKVAEKYGKAVFGRLNVDENQKIADKYSVLNIPTTLIFVNGQLVDSLVGADEDTLESTVNKYL 108
41 -53.6001dby_A mol:protein length:107 CHLOROPLAST THIOREDOXIN M CH2  ali model   29  1MEAGAVNDDTFKNVVLES-SVPVLVDFWAPWCGPCRIIAPVVDEIAGEYDKLKCVKLNTDESPNVASEYGIRSIPTIMVFKGGKKCETIIGAPKATIVQTVEKYL 106
42 -53.6002cvk_A mol:protein length:110 Thioredoxin  ali model   35  8......TDQNFDETLGQ--HPLVLVDFWAEWCAPCRMIAPILEEIAKEYGKLLVAKLDVDENPKTAMRYRVMSIPTVILFKDGQPVEVLVGAPKRNYQAKIEKHL 106
43 -53.5002voc_A mol:protein length:112 THIOREDOXIN  ali model   30  1MAIVKATDQSFSAET---SEGVVLADFWAPWCGPSKMIAPVLEELDQEMDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKDGEVVETSVGFPKEALQELVNKHL 104
44 -53.4003gnj_A mol:protein length:111 Thioredoxin domain protein  ali model   22  4MSLEKLDTNTFEQLIYDE-GKACLVMFSRKNCHVCQKVTPVLEELRLNYESFGFYYVDVEEEKTLFQRFSLKGVPQILYFKDGEYKGKMAGDEDDEVEQMIADVL 109
45 -53.0003dyr_A mol:protein length:111 Thioredoxin-1  ali model   28  9......TDDSFDTDVLKA-DGAILVDFWAEWCGPCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGTPTLLLFKNGEVAATKVGASKGQLKEFLDANL 108
46 -52.9002i1u_A mol:protein length:121 Thioredoxin  ali model   34  18......TDASFATDVLSS-NKPVLVDFWATWCGPCKMVAPVLEEIATERTDLTVAKLDVDTNPETARNFQVVSIPTLILFKDGQPVKRIVGAGKAALLRELSDVV 117
47 -52.9001nsw_A mol:protein length:105 THIOREDOXIN  ali model   34  6......TDANFQQAIQG--DGPVLVDFWAAWCGPCRMMAPVLEEFAEAHDKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGRPVKQLIGYPKEQLEAQLADVL 104
48 -52.8001srx_A mol:protein length:108 THIOREDOXIN  ali model   29  8......TDDSFDTDLVKA-DGAILVDFWAEWCGPCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYIERGIPTLLLFKNGEVAATKVGASKGQLKEFLDANL 107
49 -52.8001nw2_A mol:protein length:105 THIOREDOXIN  ali model   35  6......TDANFQQAIQG--DKPVLVDFWAAWCGPCRMMAPVLEEFAEAHDKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGEPVKQLIGYPKEQLEAQLADVL 104
50 -52.8002eir_A mol:protein length:108 Thioredoxin 1  ali model   28  8......TDDSFDTDVLKA-DGAILVDFWAEWCGPCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKCFLDCNL 107
51 -52.7001t00_A mol:protein length:112 Thioredoxin  ali model   26  11......TDDSFEQDVLKN-DKPVLVDFWAAWCGPCRQIAPSLEAIAAEYDKIEIVKLNIDENPGTAAKYGVMSIPTLNVYQGGEVAKTIVGAPKAAIVRDLEDFI 110
52 -52.7001thx_A mol:protein length:115 THIOREDOXIN  ali model   22  13......TDAEFESEVLKA-EQPVLVYFWASWCGPCQLMSPLINLAANTYDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVSKDKLLSFLDTHL 112
53 -52.7002puk_C mol:protein length:106 Thioredoxin M-type, chloroplast (TRX-M)  ali model   29  6......NDSSWKEFVLES-EVPVMVDFWAPWCGPSKLIAPVIDELAKEYGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAPKSTLTDSIEKYL 105
54 -52.7001keb_A mol:protein length:108 Thioredoxin 1  ali model   26  8......TDDSFDTDVLKA-DGAILVDFWAEWCGPCKLIASILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDANL 107
55 -52.6001uvz_A mol:protein length:119 THIOREDOXIN  ali model   36  7TTFNIQDGPDFQDRVVNS-ETPVVVDFHAQWCGPCKILGPRLEKMVAKQGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIDEDQLEAFLKKLI 112
56 -52.5003VFI Entity 1(prereleased)  ali follow..  27  5......SDSDFQLEVRQH-PDPIIIMFTGSWCQPCKKMKPTFEEMASQMGDIRFAYMDAEDAEKTMAELNIRTLPSLALFVDGMIREVFSGTNKSDLRYWINNNI 104
57 -52.5001txx_A mol:protein length:108 PROTEIN (THIOREDOXIN)  ali model   26  8......TDDSFDTDVLKA-DGAILVDFWAEWCVWCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDANL 107
58 -52.5001zcp_A mol:protein length:108 Thioredoxin 1  ali model   25  8......TDDSFDTDVLKA-DGAILVDFWAEWCACAKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDANL 107
59 -52.5002o8v_B mol:protein length:128 Thioredoxin 1  ali model   27  22......TDDSFDTDVLKA-DGAILVDFWAEWCGPAKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDANL 121
60 -52.4002l6c_A mol:protein length:110 Thioredoxin  ali model   21  8......TTEAGMAHFE--GLSDAIVFFHKNLCPHCKNMEKVLDKFGARAPQVAISSVDSEARPELMKELGFERVPTLVFIRDGKVAKVFSGINPRELQALYASI. 104
61 -52.2002i4a_A mol:protein length:107 thioredoxin  ali model   32  8......SDSSFDQDVLKA-SGLVLVDFWAEWCGPCKMIGPALGEIGKEFGKVTVAKVNIDDNPETPNAYQVRSIPTLMLVRDGKVIDKKVGAPKSQLKAWVESA. 106
62 -52.2003emx_A mol:protein length:135 Thioredoxin  ali model   17  23...........PEEFRQLLQGDAILAVYSKTCPHCHRDWPQLIQASKEVDGSLIGERELSAARLEMNKAGVEGTPTLVFYKEGRIVDKLVGAPWSLKVEKAREIY 125
63 -52.0003hxs_A mol:protein length:141 Thioredoxin  ali model   32  35...KIADYENHSKEWKYLGDKPAIVDFYADWCGPCKMVAPILEELSKEYGKIYIYKVNVDKEPELARDFGIQSIPTIWFVPMKGEPQVNMGASKEQLKGYIDKVL 138
64 -51.8002l5l_A mol:protein length:136 Thioredoxin  ali model   29  20LAKVYNFEKNPEEWKYEG-DKPAIVDFYADWCGPCKMVAPILDELAKEYGQIVIYKVDTEKEQELAGAFGIRSIPSILFIPMEGKPEMAQGAPKASFKKAIDEFL 125
65 -51.7003hz4_A mol:protein length:140 Thioredoxin  ali model   25  12......EDMTWSQQVEDS-KKPVVVMFYSPACPYCKAMEPYFEEYAKEYSSAVFGRINIATNPWTAEKYGVQGTPTFKFFCHGRPVWEQVGQYPSILKNAVRDML 111
66 -51.6003ul3_B mol:protein length:128 Thioredoxin  ali model   22  24VPRLQQNGSNIINGVNMK-NTVIVLYFFAKWCQACTMQSTEMDKLQKYYKRIYLLKVDLDKNESLARKFSVKSLPTIILLKNKTMLARKDHFSSNDLIALIKKH. 128
67 -50.9002dj0_A mol:protein length:137 Thioredoxin-related transmembrane protein 2  ali model   27  13......NDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYTGLNFGKVDVGRYTDVSTRYKVKQLPTLILFQGGKEAMRRPQIDKKG......... 110
68 -48.9002av4_A mol:protein length:160 Thioredoxin-like protein 4A (DIM1)  ali model   18  16MLQHLNSGWAVDQAIVNEDERLVCIRFGHDYDPDCMKMDELLYKVADDIKNCVIYLVDITEVPDFNTMYELYDPVSVMFFYRNKHMMIDLGTNNNKINWPMNN.. 120
69 -47.9001oaz_A mol:protein length:123 THIOREDOXIN 1  ali model   28  9......TDDSFDTDVLKA-DGAILVDFWAEWCGPCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDANL 122
70 -47.5003p2a_A mol:protein length:148 Putative thioredoxin-like protein  ali model   24  44......TAETLDKLLQD--DLPMVIDFWAPWCGPCRSFAPIFAETAAERGKVRFVKVNTEAEPALSTRFRIRSIPTIMLYRNGKMIDMLNGAPKAPFDNWLDEQL 142
71 -47.5001qgv_A mol:protein length:142 SPLICEOSOMAL PROTEIN U5-15KD  ali model   21  4MLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTNNNKINWAMEDK. 109
72 -46.8001v98_A mol:protein length:140 thioredoxin  ali model   29  39......DEKGFAQEVAGAP--LTLVDFFAPWCGPCRLVSPILEELARDHGRLKVVKVNVDEHPGLAARYGVRSVPTLVLFRRGAPVATWVGAPRRVLEERLRPYL 137
73 -45.8002ppt_A mol:protein length:155 thioredoxin-2  ali model   25  52......IDPAILARAERD-DLPLLVDFWAPWCGPCRQMAPQFQAAAATLGQVRLAKIDTQAHPAVAGRHRIQGIPAFILFHKGRELARAAGAPASELVGFVRGKL 151
74 -45.7002l57_A mol:protein length:126 Uncharacterized protein  ali model   19  7KQINFQSINVVENLEEAKEGIPTIIMFKTDTCPYCVEMQKELSYVSKERENIYYARLEEEKNIDLAYKYDANIVPTTVFLKEGNKFYVHQGLRKNNIETILNSLG 116
75 -45.2003aps_A mol:protein length:122 DnaJ homolog subfamily C member 10  ali model   22  9......TPQTFNEKVLQG-KTHWVVDFYAPWCGPCQNFAPEFELLARMIGKVRAGKVDCQAYPQTCQKAGIKAYPSVKLYQYERAKKSIWEEDAKTIAALIYGKL 112

FFAS is supported by the NIH grant R01-GM087218-01
6 6 2 0 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Plewczynski D, Tkacz A, Wyrwicz LS, Godzik A, Kloczkowski A, Rychlewski L. Support-vector-machine classification of linear functional motifs in proteins. J Mol Model 2006 Aug;12(4):453-61. Epub 2005 Dec 10.