current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

1ervA
Query: 1erv_A mol:protein length:105 THIOREDOXIN, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELVLast
1 -71.5001erv_A mol:protein length:105 THIOREDOXIN  ali model  100  1MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
2 -71.5003trx_A mol:protein length:105 THIOREDOXIN  ali model follow..  98  1MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCTPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
3 -71.4003e3e_A mol:protein length:105 Thioredoxin  ali model follow..  98  1MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPSKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKRMPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
4 -71.4003kd0_A mol:protein length:105 Thioredoxin  ali model follow..  97  1MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPSKMIKPFFHSLSEKYSNVIFLEVDVDDSQDVASESEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
5 -71.4001aiu_A mol:protein length:105 THIOREDOXIN  ali model follow..  98  1MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
6 -71.4001cqg_A mol:protein length:105 THIOREDOXIN  ali model follow..  95  1MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPAKMIKPFFHSLSEKYSNVIFLEVDVDDAQDVASEAEVKATPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
7 -71.3001erw_A mol:protein length:105 THIOREDOXIN  ali model follow..  97  1MVKQIESKTAFQEALDAAGDKLVVVDFSATWSGPSKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
8 -69.8003ZZX Entity 1(prereleased)  ali follow..  50  1MVYQVKDQEDFTKQLNEAGNKLVVIDFYATWCGPCKMIAPKLEELSQSMSDVVFLKVDVDECEDIAQDNQIACMPTFLFMKNGQKLDSLSGANYDKLLELVEKN. 104
9 -69.8003qfa_C mol:protein length:116 Thioredoxin  ali model follow..  99  7.VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPSKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV 110
10 -69.8001gh2_A mol:protein length:107 THIOREDOXIN-LIKE PROTEIN  ali model follow..  40  2GVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFQFFRNKVRIDQYQGADAVGLEEKIKQHL 106
11 -67.5001xwa_A mol:protein length:111 thioredoxin  ali model follow..  51  6MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFDNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKANI 111
12 -67.3002vim_A mol:protein length:104 THIOREDOXIN  ali model follow..  37  1.MRVLATAADLEKLINENKGRLIVVDFFAQWCGPCRNIAPKVEALAKEIPEVEFAKVDVDQNEEAAAKYSVTAMPTFVFIKDGKEVDRFSGANETKLRETITRH. 103
13 -65.9002xbi_A mol:protein length:108 THIOREDOXIN  ali model follow..  43  6.LIELKQDGDLESLLEQHKNKLVVVDFFATWCGPCKTIAPLFKELSEKY-DAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIAKVEDMIKKFI 108
14 -65.3002xbq_A mol:protein length:117 THIOREDOXIN  ali model follow..  43  15.LIELKQDGDLESLLEQHKNKLVVVDFFATWCGPCKTIAPLFKELSEKY-DAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIAKVEDMIKKFI 117
15 -65.0003f3q_A mol:protein length:109 Thioredoxin-1  ali model follow..  46  1MVTQFKTASEFDSAIAQ--DKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAIAAN. 102
16 -64.6001m7t_A mol:protein length:107 Chimera of Human and E. coli thioredoxin  ali model follow..  70  1MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDAQDVAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDANL 106
17 -64.3002vm1_A mol:protein length:118 THIOREDOXIN H ISOFORM 1.  ali model follow..  40  8.VIACHTKQEFDTHMANGTGKLVIIDFTASWCGPCRVIAPVFAEYAKKFPGAIFLKVDVDELKDVAEAYNVEAMPTFLFIKDGEKVDSVVGGRKDDIHTKIVALM 113
18 -64.1002diy_A mol:protein length:130 Thioredoxin-like protein 2  ali model follow..  27  20.VEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHA 123
19 -64.1001syr_A mol:protein length:112 thioredoxin  ali model follow..  39  3MVKIVTSQAEFDSIISQ--NELVIVDFFAEWCGPCKRIAPFYEECSKTYTKMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGANDSALKQLIEKYA 105
20 -63.8001xfl_A mol:protein length:124 Thioredoxin h1  ali model follow..  43  12.VIACHTVETWNEQLQKASKTLVVVDFTASWCGPCRFIAPFFADLAKKLPNVLFLKVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAKHL 117
21 -63.7001ti3_A mol:protein length:113 thioredoxin H  ali model follow..  42  6.VIACHTVDTWKEHFEKGSQKLIVVDFTASWCPPCKMIAPIFAELAKKFPNVTFLKVDVDELKAVAEEWNVEAMPTFIFLKDGKLVDKTVGADKDGLPTLVAKHA 111
22 -63.5001ep7_A mol:protein length:112 THIOREDOXIN CH1, H-TYPE  ali model follow..  46  4.VIVIDSKAAWDAQLAKGEHKPIVVDFTATWCGPCKMIAPLFETLSNDYGKVIFLKVDVDAVAAVAEAAGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHA 110
23 -62.9001wmj_A mol:protein length:130 Thioredoxin H-type  ali model follow..  39  15VVIACHNKDEFDAQMTKAAGKVVIIDFTASWCGPCRFIAPVFAEYAKKFPGAVFLKVDVDELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTIVKHV 121
24 -62.9002fa4_A mol:protein length:111 Thioredoxin II  ali model follow..  48  2MVTQLKSASEYDSALASG-DKLVVVDFFATWCGPCKMIAPMIEKFAEQYSDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAIASNV 105
25 -62.7002oe0_A mol:protein length:114 Thioredoxin-3  ali model follow..  42  8.ITKLTNLTEFRNLIKQ--NDKLVIDFYATWCGPCKMMQPHLTKLIQAYPDVRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPTALEKGIKDL. 108
26 -62.7002wz9_A mol:protein length:153 GLUTAREDOXIN-3  ali model follow..  27  14.VEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHA 117
27 -62.3002iwt_A mol:protein length:125 THIOREDOXIN H ISOFORM 2  ali model follow..  38  17.VISVHSLEQWTMQIEEAAKKLVVIDFTASWCGPSRIMAPVFADLAKKFPNAVFLKVDVDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTAKVGLHA 122
28 -61.9001faa_A mol:protein length:124 THIOREDOXIN F  ali model follow..  39  24......NKDTFWPIVKAAGDKPVVLDMFTQWCGPCKAMAPKYEKLAEEYLDVIFLKLDCNENKTLAKELGIRVVPTFKILKENSVVGEVTGAKYDKLLEAIQAAR 123
29 -61.8001r26_A mol:protein length:125 Thioredoxin  ali model follow..  31  15.VVDVYSVEQFRNIMSE--DILTVAWFTAVWCGPCKTIERPMEKIAYEFPTVKFAKVDADNNSEIVSKCRVLQLPTFIIARSGKMLGHVIGANPGMLRQKLRDII 116
30 -61.0002j23_A mol:protein length:121 THIOREDOXIN  ali model follow..  46  11.VQVISSYDQFKQVTG--GDKVVVIDFWATWCGPCKMIGPVFEKISDTPDKVGFYKVDVDEQSQIAQEVGIRAMPTFVFFKNGQKIDTVVGADPSKLQAAITQHS 114
31 -61.0003d21_A mol:protein length:139 Thioredoxin H-type  ali model follow..  41  26.VHLITTKERWDQKLSEADGKIVLANFSARWCGPCKQIAPYYIELSENYPSLMFLVIDVDELSDFSASWEIKATPTFFFLRDGQQVDKLVGANKPELHKKITAIL 131
32 -61.0003cxg_A mol:protein length:133 Putative thioredoxin  ali model follow..  23  15IYIELKNTGSLNQVFSSTQNSSIVIKFGAVWCKPCNKIKEYFKNQLNYY-YVTLVDIDVDIHPKLNDQHNIKALPTFEFYFNLNNVHTVEGANQNDIEKAFQKYC 122
33 -60.9003d22_A mol:protein length:139 Thioredoxin H-type  ali model follow..  39  26.VHLITTKERWDQKLSEADGKIVLANFSARWCGPSRQIAPYYIELSENYPSLMFLVIDVDELSDFSASWEIKATPTFFFLRDGQQVDKLVGANKPELHKKITAIL 131
34 -60.2003d6i_A mol:protein length:112 Monothiol glutaredoxin-3  ali model follow..  31  2.VIEINDQEQFTYLTTTAGDKLIVLYFHTSWAEPCKALKQVFEAISNEPSNVSFLSIDADENSEISELFEISAVPYFIIIHKGTILKELSGADPKEYVSLLEDCK 108
35 -56.8002f51_A mol:protein length:118 thioredoxin  ali model follow..  33  5IVHFNGTHEALLNRIKEA-PGLVLVDFFATWCGPCQRLGQILPSIAEANKDVTFIKVDVDKNGNAADAYGVSSIPALFFVKKEKTLDQFVGADVSRIKADIEKF. 111
36 -56.7003hhv_A mol:protein length:110 Thioredoxin (TrxA-2)  ali model follow..  34  12......NSKNFDEFITK--NKIVVVDFWAEWCAPCLILAPVIEELANDYPQVAFGKLNTEESQDIAMRYGIMSLPTIMFFKNGELVDQILGAPREEIEVRLKSLL 109
37 -56.1002e0q_A mol:protein length:104 thioredoxin  ali model follow..  36  5......DSKNFDSFLAS--HEIAVVDFWAEWCAPCLILAPIIEELAEDYPQVGFGKLNSDENPDIAARYGVMSLPTVIFFKDGEPVDEIIGAPREEIEIRIKNLL 102
38 -53.9002o7k_A mol:protein length:107 Thioredoxin  ali model follow..  35  4MAIVKVTDADFDSKVESG---VQLVDFWATWCGPCKMIAPVLEELAADYGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFPKENLAEVLDKHL 107
39 -53.8002o89_A mol:protein length:107 Thioredoxin  ali model follow..  33  4MAIVKVTDADFDSKVESG---VQLVDFWATWCGTSKMIAPVLEELAADYGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFPKENLAEVLDKHL 107
40 -53.8003tco_A mol:protein length:109 Thioredoxin (TrxA-1)  ali model follow..  34  10......TEENFDEVIRN--NKLVLVDCWAEWCAPCHLYEPIYKKVAEKYGKAVFGRLNVDENQKIADKYSVLNIPTTLIFVNGQLVDSLVGADEDTLESTVNKYL 108
41 -53.6001dby_A mol:protein length:107 CHLOROPLAST THIOREDOXIN M CH2  ali model follow..  29  1MEAGAVNDDTFKNVVLES-SVPVLVDFWAPWCGPCRIIAPVVDEIAGEYDKLKCVKLNTDESPNVASEYGIRSIPTIMVFKGGKKCETIIGAPKATIVQTVEKYL 106
42 -53.6002cvk_A mol:protein length:110 Thioredoxin  ali model follow..  35  8......TDQNFDETLGQ--HPLVLVDFWAEWCAPCRMIAPILEEIAKEYGKLLVAKLDVDENPKTAMRYRVMSIPTVILFKDGQPVEVLVGAPKRNYQAKIEKHL 106
43 -53.5002voc_A mol:protein length:112 THIOREDOXIN  ali model follow..  30  1MAIVKATDQSFSAET---SEGVVLADFWAPWCGPSKMIAPVLEELDQEMDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKDGEVVETSVGFPKEALQELVNKHL 104
44 -53.4003gnj_A mol:protein length:111 Thioredoxin domain protein  ali model follow..  22  4MSLEKLDTNTFEQLIYDE-GKACLVMFSRKNCHVCQKVTPVLEELRLNYESFGFYYVDVEEEKTLFQRFSLKGVPQILYFKDGEYKGKMAGDEDDEVEQMIADVL 109
45 -53.0003dyr_A mol:protein length:111 Thioredoxin-1  ali model follow..  28  9......TDDSFDTDVLKA-DGAILVDFWAEWCGPCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGTPTLLLFKNGEVAATKVGASKGQLKEFLDANL 108
46 -52.9002i1u_A mol:protein length:121 Thioredoxin  ali model follow..  34  18......TDASFATDVLSS-NKPVLVDFWATWCGPCKMVAPVLEEIATERTDLTVAKLDVDTNPETARNFQVVSIPTLILFKDGQPVKRIVGAGKAALLRELSDVV 117
47 -52.9001nsw_A mol:protein length:105 THIOREDOXIN  ali model follow..  34  6......TDANFQQAIQG--DGPVLVDFWAAWCGPCRMMAPVLEEFAEAHDKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGRPVKQLIGYPKEQLEAQLADVL 104
48 -52.8001srx_A mol:protein length:108 THIOREDOXIN  ali model follow..  29  8......TDDSFDTDLVKA-DGAILVDFWAEWCGPCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYIERGIPTLLLFKNGEVAATKVGASKGQLKEFLDANL 107
49 -52.8001nw2_A mol:protein length:105 THIOREDOXIN  ali model follow..  35  6......TDANFQQAIQG--DKPVLVDFWAAWCGPCRMMAPVLEEFAEAHDKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGEPVKQLIGYPKEQLEAQLADVL 104
50 -52.8002eir_A mol:protein length:108 Thioredoxin 1  ali model follow..  28  8......TDDSFDTDVLKA-DGAILVDFWAEWCGPCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKCFLDCNL 107
51 -52.7001t00_A mol:protein length:112 Thioredoxin  ali model follow..  26  11......TDDSFEQDVLKN-DKPVLVDFWAAWCGPCRQIAPSLEAIAAEYDKIEIVKLNIDENPGTAAKYGVMSIPTLNVYQGGEVAKTIVGAPKAAIVRDLEDFI 110
52 -52.7001thx_A mol:protein length:115 THIOREDOXIN  ali model follow..  22  13......TDAEFESEVLKA-EQPVLVYFWASWCGPCQLMSPLINLAANTYDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVSKDKLLSFLDTHL 112
53 -52.7002puk_C mol:protein length:106 Thioredoxin M-type, chloroplast (TRX-M)  ali model follow..  29  6......NDSSWKEFVLES-EVPVMVDFWAPWCGPSKLIAPVIDELAKEYGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAPKSTLTDSIEKYL 105
54 -52.7001keb_A mol:protein length:108 Thioredoxin 1  ali model follow..  26  8......TDDSFDTDVLKA-DGAILVDFWAEWCGPCKLIASILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDANL 107
55 -52.6001uvz_A mol:protein length:119 THIOREDOXIN  ali model follow..  36  7TTFNIQDGPDFQDRVVNS-ETPVVVDFHAQWCGPCKILGPRLEKMVAKQGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIDEDQLEAFLKKLI 112
56 -52.5003VFI Entity 1(prereleased)  ali follow..  27  5......SDSDFQLEVRQH-PDPIIIMFTGSWCQPCKKMKPTFEEMASQMGDIRFAYMDAEDAEKTMAELNIRTLPSLALFVDGMIREVFSGTNKSDLRYWINNNI 104
57 -52.5001txx_A mol:protein length:108 PROTEIN (THIOREDOXIN)  ali model follow..  26  8......TDDSFDTDVLKA-DGAILVDFWAEWCVWCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDANL 107
58 -52.5001zcp_A mol:protein length:108 Thioredoxin 1  ali model follow..  25  8......TDDSFDTDVLKA-DGAILVDFWAEWCACAKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDANL 107
59 -52.5002o8v_B mol:protein length:128 Thioredoxin 1  ali model follow..  27  22......TDDSFDTDVLKA-DGAILVDFWAEWCGPAKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDANL 121
60 -52.4002l6c_A mol:protein length:110 Thioredoxin  ali model follow..  21  8......TTEAGMAHFE--GLSDAIVFFHKNLCPHCKNMEKVLDKFGARAPQVAISSVDSEARPELMKELGFERVPTLVFIRDGKVAKVFSGINPRELQALYASI. 104
61 -52.2002i4a_A mol:protein length:107 thioredoxin  ali model follow..  32  8......SDSSFDQDVLKA-SGLVLVDFWAEWCGPCKMIGPALGEIGKEFGKVTVAKVNIDDNPETPNAYQVRSIPTLMLVRDGKVIDKKVGAPKSQLKAWVESA. 106
62 -52.2003emx_A mol:protein length:135 Thioredoxin  ali model follow..  17  23...........PEEFRQLLQGDAILAVYSKTCPHCHRDWPQLIQASKEVDGSLIGERELSAARLEMNKAGVEGTPTLVFYKEGRIVDKLVGAPWSLKVEKAREIY 125
63 -52.0003hxs_A mol:protein length:141 Thioredoxin  ali model follow..  32  35...KIADYENHSKEWKYLGDKPAIVDFYADWCGPCKMVAPILEELSKEYGKIYIYKVNVDKEPELARDFGIQSIPTIWFVPMKGEPQVNMGASKEQLKGYIDKVL 138
64 -51.8002l5l_A mol:protein length:136 Thioredoxin  ali model follow..  29  20LAKVYNFEKNPEEWKYEG-DKPAIVDFYADWCGPCKMVAPILDELAKEYGQIVIYKVDTEKEQELAGAFGIRSIPSILFIPMEGKPEMAQGAPKASFKKAIDEFL 125
65 -51.7003hz4_A mol:protein length:140 Thioredoxin  ali model follow..  25  12......EDMTWSQQVEDS-KKPVVVMFYSPACPYCKAMEPYFEEYAKEYSSAVFGRINIATNPWTAEKYGVQGTPTFKFFCHGRPVWEQVGQYPSILKNAVRDML 111
66 -51.6003ul3_B mol:protein length:128 Thioredoxin  ali model follow..  22  24VPRLQQNGSNIINGVNMK-NTVIVLYFFAKWCQACTMQSTEMDKLQKYYKRIYLLKVDLDKNESLARKFSVKSLPTIILLKNKTMLARKDHFSSNDLIALIKKH. 128
67 -50.9002dj0_A mol:protein length:137 Thioredoxin-related transmembrane protein 2  ali model follow..  27  13......NDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYTGLNFGKVDVGRYTDVSTRYKVKQLPTLILFQGGKEAMRRPQIDKKG......... 110
68 -48.9002av4_A mol:protein length:160 Thioredoxin-like protein 4A (DIM1)  ali model follow..  18  16MLQHLNSGWAVDQAIVNEDERLVCIRFGHDYDPDCMKMDELLYKVADDIKNCVIYLVDITEVPDFNTMYELYDPVSVMFFYRNKHMMIDLGTNNNKINWPMNN.. 120
69 -47.9001oaz_A mol:protein length:123 THIOREDOXIN 1  ali model follow..  28  9......TDDSFDTDVLKA-DGAILVDFWAEWCGPCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDANL 122
70 -47.5003p2a_A mol:protein length:148 Putative thioredoxin-like protein  ali model follow..  24  44......TAETLDKLLQD--DLPMVIDFWAPWCGPCRSFAPIFAETAAERGKVRFVKVNTEAEPALSTRFRIRSIPTIMLYRNGKMIDMLNGAPKAPFDNWLDEQL 142
71 -47.5001qgv_A mol:protein length:142 SPLICEOSOMAL PROTEIN U5-15KD  ali model follow..  21  4MLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTNNNKINWAMEDK. 109
72 -46.8001v98_A mol:protein length:140 thioredoxin  ali model follow..  29  39......DEKGFAQEVAGAP--LTLVDFFAPWCGPCRLVSPILEELARDHGRLKVVKVNVDEHPGLAARYGVRSVPTLVLFRRGAPVATWVGAPRRVLEERLRPYL 137
73 -45.8002ppt_A mol:protein length:155 thioredoxin-2  ali model follow..  25  52......IDPAILARAERD-DLPLLVDFWAPWCGPCRQMAPQFQAAAATLGQVRLAKIDTQAHPAVAGRHRIQGIPAFILFHKGRELARAAGAPASELVGFVRGKL 151
74 -45.7002l57_A mol:protein length:126 Uncharacterized protein  ali model follow..  19  7KQINFQSINVVENLEEAKEGIPTIIMFKTDTCPYCVEMQKELSYVSKERENIYYARLEEEKNIDLAYKYDANIVPTTVFLKEGNKFYVHQGLRKNNIETILNSLG 116
75 -45.2003aps_A mol:protein length:122 DnaJ homolog subfamily C member 10  ali model follow..  22  9......TPQTFNEKVLQG-KTHWVVDFYAPWCGPCQNFAPEFELLARMIGKVRAGKVDCQAYPQTCQKAGIKAYPSVKLYQYERAKKSIWEEDAKTIAALIYGKL 112

FFAS is supported by the NIH grant R01-GM087218-01
6 1 0 6 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ginalski K, Grishin NV, Godzik A., Rychlewski L. Practical lessons from protein structure prediction. Nucleic Acids Res. 2005 Apr 1;33(6):1874-91.