current user: public




Query: 1e69_A mol:protein length:322 CHROMOSOME SEGREGATION SMC PROTEIN, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .
# Score Template Links and tools%idFirst MRLKKLYLKGFKSFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEQSKKELRASEKFDMIFAGSENLPPAGSAYVELVFEENGEEITVARELKRTGENTYYLNGSPVRLKDIRDRFAGTGLGVDFYSIVGQGQIDRIVNASPEELRLESSKHPTSLVPRGSYQRVNESFNRFISLLFFGGEGRLNIVSEAKSILDAGFEISIRKPGRRDQKLSLLSGGEKALVGLALLFALMEIKPSPFYVLDEVDSPLDDYNAERFKRLLKENSKHTQFIVITHNKIVMEAADLLHGVTMVNGVSAIVPVEVEKILEVGSLast
1 -148.0001e69_A mol:protein length:322 CHROMOSOME SEGREGATION SMC PROTEIN  ali model  100  1MRLKKLYLKGFKSFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEQSKKELRASEKFDMIFAGSENLPPAGSAYVELVFEENGEEITVARELKRTGENTYYLNGSPVRLKDIRDRFAGTGLGVDFYSIVGQGQIDRIVNASPEELRLESSKHPTSLVPRGSYQRVNESFNRFISLLFFGGEGRLNIVSEAKSILDAGFEISIRKPGRRDQKLSLLSGGEKALVGLALLFALMEIKPSPFYVLDEVDSPLDDYNAERFKRLLKENSKHTQFIVITHNKIVMEAADLLHGVTMVNGVSAIVPVEVEKILEVGS 316
2 -122.0003zgx_A mol:protein length:426 CHROMOSOME PARTITION PROTEIN SMC  ali model follow..  42  1MFLKRLDVIGFKSFAERISVDFVKGVTAVVGPNGSGKSNITDAIRWVLGEQSARSLRGGKMEDIIFAGSDSRKRLNLAEVTLTLDNDDHEVSVTRRVYRSGESEFLINNQPCRLKDIIDLFMDSGLGKEAFSIISQGKVEEILSSKAEDRRSIFEEAAGVLKYKTRKKKAENKLFETQDNLLFGGGRAELRLTDPNDLLHSGVEIIAQPPGKKLQNLNLLSGGERALTAIALLFSILKVRPVPFCVLDEVEAALDEANVFRFAQYLKKYSSDTQFIVITHRKGTMEEADVLYGVTMQEGVSKVISVKLEETKEFVQ 426
3 -102.0004i99_A mol:protein length:354 Chromosome partition protein Smc  ali model follow..  38  2PYIEKLELKGFKSYGNKVVIPFSKGFTAIVGANGSGKSNIGDAILFVLGGLSAKAMRASRISDLIFAGSKNEPPAKYAEVAIYFNNEDDEVVIRRRVYPDGRSSYWLNGRRATRSEILDILTAAMISPDGYNIVLQGDITKFIKMSPLERRLLIDDISGIAEYDSKKEKALEEEKEKKNVFMRPGGSARLILENPEDPFSGGLEIEAKPAGKDVKRIEAMSGGEKALTALAFVFAIQKFKPAPFYLFDEIDAHLDDANVKRVADLIKESSKESQFIVITLRDVMMANADKIIGVSMRDGVSKVVSLSLEKAMKILE 342
4 -83.6004ux3_A mol:protein length:543 STRUCTURAL MAINTENANCE OF CHROMOSOMES PROTEIN  ali model follow..  27  2AYIKRVIIKGFKTYRNETIIDFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDY-SNLKREERQGLIHQGSGGS--VMSASVEIVFHDPDHSMILIRRTVGLKKDDYQLNDRNVTKGDIVRMLETAGFSMNNYNIVPQGKIVALTNAKDKERLQLLEDVVGAKSFEVKLKASLKKMEETEQKK-IQINKEMGELNSKLSEMETGVSISVSFNSKQNEQLHVLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQFICTTFRTDMLQVADKFFRVKYENKISTVIEVNREEAIGFIR 527
5 -79.4001w1w_A mol:protein length:430 STRUCTURAL MAINTENANCE OF CHROMOSOME 1  ali model follow..  32  3.RLVGLELSNFKSYRGVTKVGGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNH-LRSNILKDLIYRGVLNDENSDSAYVKAFYQKGNKLVELMRIISRNGDTSYKIDGKTVSYKDYSIFLENENI-KAKNFLVFQGDVEQIAAQSPVELSRMFEEVSGSIQFEKTFDYVSDHLDAIYRELLAGGNASLT-IEDEDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRPDLQFIVISLKNTMFEKSDALVGVYRQENSSKIITLDLSNYAE... 430
6 -42.2003qkt_A mol:protein length:339 DNA double-strand break repair rad50 ATPase  ali model follow..  20  1MKLERVTVKNFRSHSD-TVVEFKEGINLIIGQNGSGKSSLLDAILVGLY--WPLRIKDIKKDEFTKVGARD------TYIDLIFEKDGTKYRITRRFLKGYSSGEIHAMKRLVGNEWKHVTEPSSKAISAFMYIRQGQIDAILESDEAREKVAYKKLSELKGGSGGTEELIEKVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKLTFLSGGERIALGLAFRLAMSLYGEISLLILDEPTPYLDEERRRKLITIMERYLKKIQVILVSHDEELKDAADHVIRISLENGSSKVEVVS......... 339
7 -41.7003qku_A mol:protein length:359 DNA double-strand break repair rad50 ATPase  ali model follow..  20  1MKLERVTVKNFRSHSD-TVVEFKEGINLIIGQNGSGKSSLLDAILVGL---WPLRIKDIKKDEFTKVGARD------TYIDLIFEKDGTKYRITRRFLKGYSSKHVTEPSSKAISAFMEKLIPYNIFLNA-IYIRQGQIDAILESD-EAREKVVREVLNLDKFETAYKKLSELKKTINNRIKEYGGSGGIKDLEKAKDFTEELIEKVKKYKALARELTFLSGGERIALGLAFRLAMSLYGEISLLILDEPTPYLDEERRRKLITIMERYLKKIQVILVSHDEELKDAADHVIRISLENGSSKVEVVS......... 359
8 -37.3003qkr_B mol:protein length:179 DNA double-strand break repair rad50 ATPase  ali model follow..  20  3...............................................................................................................................KENRERVKKEIKDLEKAKDFTEELIEKVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAE-----ENKVRLFVVWEGKE-RPLTFLSGGERIALGLAFRLAMSLYGEISLLILDEPTPYLDEERRRKLITIMERYLKKPQVILVSHDEELKDAADHVIRISLENGSSKVEVVS......... 179
9 -37.0005f3w_B mol:protein length:372 DNA double-strand break repair Rad50 ATPase,D  ali model follow..  23  3MILKEIRMNNFKSHVN-SRIKFEKGIVAIIGENGSGKSSIFEAVFFALGAGS-----NFNYDTIITKGKKS------VYVELDFEVNGNNYKIIREYDSGRGGAKLYKNGKPTISAVNKAVNELGVDRNMFLYIKQGEIAKFLSLKPSEKLETVAKLLGIDEFEKCYQKMGEIVKEYEKRLFGRNGFQAYLREKYVPLIQKYLNEAFSEFDLPYSFVELLSGGEQIAVALSLRLAIANANRVECIILDEPTVYLDENRRAKLAEIFRKVKSIPQMIIITHHRELEDVADVIINVKKDGNVSKV............. 368
10 -29.0003tho_A mol:protein length:382 Probable DNA double-strand break repair Rad50  ali model follow..  22  12MRPERLTVRNFLGLKN-VDIEFQSGITVVEGPNGAGKSSLFEAISFALGNGI----RYPNSYDYVNRNAVD----GTARLVFQFERGGKRYEIIREINENGKKAAIAAKPTSVKQEVEKILGIEHRTFIRTVFLPQGEIDKLLISPPSEITEIISDVFQSKETLEKLEKLLKETGRVLEAVLKRTKAYLDILTNGRFDIDFDDEKGGFIIKDWERPARGLSGGERALISISLAMSLAEVASGRLFFIDEGFSSLCTENKEKIASVLKELERLNKVIFITCDREFSEAFDRKLRITGGVVVNE.............. 376
11 -27.2003qkr_A mol:protein length:203 DNA double-strand break repair rad50 ATPase  ali model follow..  20  1MKLERVTVKNFRSHSD-TVVEFKEGINLIIGQNGSGKSSLLDAILVGLWPLRIKDIKKDEF---------TKVGARDTYIDLIFEKDGTKYRITRRFLKGYSSGEIHAMKRLSSKAISAFMEKL-IPYNIFLYIRQGQIDAILES-DEAREKVVREVLNLDKFETAYKKLSELKKTINNRI....................................................................................................................................... 184
12 -21.2001qhl_A mol:protein length:227 PROTEIN (CELL DIVISION PROTEIN MUKB)  ali model follow..  20  5GKFRSLTLINWNGFFART-FDLDELVTTLSGGNGAGKSTTMAAFVTALPDLTRNTTEAGATSGSRDKGLHGKLKAGVCYSMLDTINSRHQRVVV.............................................................................................................................................................................................................................. 102
13 -18.6004ad8_A mol:protein length:517 DNA REPAIR PROTEIN RECN  ali model follow..  16  40..LSRLEIRNL-ATITQLELELGGGFCAFTGETGAGKSIIVDALGLLLGGRANH--------DLIRSGEKELL----VTGFWGDGDESEADSASRRLSSAGRGAARLSGEVVELQEWAQGRLTIHWQHSAVSLLSPANQRGLLDRRVTKEAQAYAAAKLKNKYGPTLEDVVEFGAQAAEELLEEDERDAGSLQADVDALHAELLKVGQALDAAREREAVASGGE--LSRVMLAVSTVLGADTPSVVFDEVDAGIGGAAAIAVAEQLSRLADTRQVLVVTHLAQIAARAHHHYKVEKQEEIARMLSGNTSEAA.... 507
14 -17.9002o5v_A mol:protein length:359 DNA replication and repair protein recF  ali model follow..  20  4VRLSALSTLNYRNL-APGTLNFPEGVTGIYGENGAGKTNLLEAAYLAL----TGQTDAPRIEQLIQAGETE------AYVRADLQQGGSLSIQEVGLGRGRRQL-KVDGVRARTGDLSELVFGPPSGRRAYLDSLLSRLSARYGEQLSRYERTVSQRNAALR-EWAMHVWDDVLLKLGTEIMLFRRRALTRLDELAREANAQLADLRGRRAEELARGSTVTGGEGRTVALALRRAELELGEDPVLLLDDFTAELDP---HRRQYLLDLAASVPQAIVTG..................................... 327
15 -17.0005da9_A mol:protein length:449 Putative uncharacterized protein,Putative unc  ali model follow..  20  4..IEKLSILGVRSFGHPETIAFNTPLTLIVGYNGSGKTTVIECLKYATGELPPNSTRNGAFHDPDLVGEKEVR----AQVKLSFRSIGESYVVTRNIQLLVQRNNKRTQKTLRVAELDKLVSELGVPPAILDFCHQDDSLWPMSEPAALKKR-FDEIFEAQKYTKVIENIRLLKKKKGDEL....................................................................................................................................... 203
16 -16.4003euj_A mol:protein length:483 Chromosome partition protein mukB, Linker  ali model follow..  16  8.KFRSLTLINWNGFFART-FDFDELVTTLSGGNGAGKSTTMAGFVTALPDLTLLNFRNTTEAG---KGLYGKLKAGVCYAVLETVNSRAQRIITGGSGGSISAESVANILRKTIQREQNRILQLNQGLQNIAFGQVKGVRLVVNIRDTHSILLNALSDQHEQHKDLFESQKLSFSEALAMLYRMPQTIGEELLDYRNYLDLEVETLRGAYGWMRAESSALSTGEAIGTGMSILLMVVDILPCRLLFLDQAAR-LDAMSINTLFELCERL--DMQLLIAAPENISPERGKLVRKILANQEYVHVVGLK......... 480
17 -14.9004aby_A mol:protein length:415 DNA REPAIR PROTEIN RECN  ali model follow..  15  39.RLSRLEIRNL-ATITQLELELGGGFCAFTGETGAGKSIIVDALGLLLGGRANHDLIRSGEKELL------------VTGFWGDGDESEADSASRRLSSAGRGAARLSGEVVSVRELQEW-VSLLSPANQRGLLDERLQASESSKHPTSLVPRGSVDALHAELLKVGQALDAAREREAEPLVDSLLAVIRELGMPHARMEFALSALAEPAAYGLSDVLLRSGGE--LSRVMLAVSTVLGADTPSVVFDEVDAGIGGAAAIAVAEQLSRLADTRQVLVVTHLAQIAARAHHHYKVEKQEEIARMLSGNTSEAA.... 405
18 -14.5002ff7_A mol:protein length:247 Alpha-hemolysin translocation ATP-binding pro  ali model follow..  21  31.........................VIGIVGRSGSGKSTLTKLI--------------------------------------------------QRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVG-----------------------------------EQGAGLSGGQRQRIAIARAL----VNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRI--IVMEKG................. 213
19 -13.8005eum_A mol:protein length:258 Lipid A export ATP-binding/permease protein M  ali model follow..  20  48..........................VALVGRSGSGKSTIANLV---------------------------------------------------RFYDIEQGEILLDGVNIQDYRLSNLRENCAVVSQQVHLFNDTIANNIAYAAQDKYSREEIIAAAKAAYALEF----EKLPQGFDTVIG-------------------------------ENGASLSGGQRQRLAIARAL----LRNSPVLILDEATSALDTESERAIQSALEELKKDRTVVVIAHRLSTIENADEI--LVIDHG................. 230
20 -13.8005dgx_A mol:protein length:256 Lipid A export ATP-binding/permease protein M  ali model follow..  22  31...........HKVLSGVSVDIKAGQTAFVGKSGSGKTTLTSII---------------------------------------------------RFYTQHEGEILLDGVDTRELTLENLRSHLSIVSQNVHLFDDTVYNNIAFGLSREVSEEEVIDA----------------------------LKRANAYEFVQELSDGINTNIGNNGSK------LSGGQRQRISIARAL----LKNAPVLIFDEATSALDNESERVVQQALESLTKSCTTIVIAHRLSTVENADKI--VVMDGG................. 229
21 -13.5005idv_A mol:protein length:279 Lipid A export ATP-binding/permease protein M  ali model follow..  21  62..........................VALVGRSGAGKTSLVNML---------------------------------------------------RFQEVSSGQIYLDDLPIRDIELSSLRTQIAMVNQQVVLFNRTVRENIAYGQLHNASDEDVIAAAKA----------------------------AYAHDFIMNLPNGYDTVLGAQGLN------LSGGQRQRIAIARAI----LKNAPILILDEATSALDNESEHFIQQAFDEAMQDRTTIVIAHRLSTIENADRI--VVMDRG................. 244
22 -13.1001mv5_A mol:protein length:243 Multidrug resistance ABC transporter ATP-bind  ali model follow..  17  30.........................IIAFAGPSGGGKSTIFSLL--------------------------------------------------ERFYQPTAGEITIDGQPIDNISLENWRSQIGFVSQDSAIMAGTIRENLTYGLEGDYTDEDLWQVLD----------------------------LAFARSFVENMPDQLNTEVGERGVK------ISGGQRQRLAIARAF----LRNPKILMLDEATASLDSESESMVQKALDSLMKGRTTLVIAHRLSTIVDADKIYFIE..................... 211
23 -12.8002ghi_A mol:protein length:260 transport protein  ali model follow..  20  33...........HRTLKSINFFIPSGTTALVGHTGSGKSTIAKLL---------------RFYDA-------------------------------------EGDIKIGGKNVNKYNRNSIRSIIGIVPQDTILFNETIKYNILYGKLDATDEEVIKATKSAQ-----------------------------LYDFIEALPKKWDTIVGNKGMK------LSGGERQRIAIARCL----LKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRKNRTLIIIAHRLSTISSAESI--ILLNKG................. 229
24 -11.7001jj7_A mol:protein length:260 PEPTIDE TRANSPORTER TAP1  ali model follow..  25  45.........................VTALVGPNGSGKSTV--------------------------------------------------AALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSF----------------------------ISGLPQGYDTEVDEAGSQ------LSGGQRQAVALARAL----IRKPCVLILDDATSALDANSQLQVEQLLYESPERYSVLLITQHLSLVEQADHILGAIREGG................. 236
25 -11.6002pjz_A mol:protein length:263 Hypothetical protein ST1066  ali model follow..  19  18...........RFSLENINLEVNGEKVIILGPNGSGKTTLLRAISGLLPYSGNIFINGMEVRKIRNYIRYSTNLPEAYEIGVTVNDIVYLYEELKGLDR---------------DLFLEMLKALKLGEE----------------------------------------------------------------------------------ILRRKLYKLSAGQSVLVRTSLALA----SQPEIVGLDEPFENVDAARRHVISRYIKEYGKEG--ILVTHELDMLNLYKEYKAYFLVGN................. 202
26 -11.5002ixe_A mol:protein length:271 ANTIGEN PEPTIDE TRANSPORTER 1  ali model follow..  25  47.........................VTALVGPNGSGKSTV--------------------------------------------------AALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAHDF----------------------------ISGFPQGYDTEVGETGNQ------LSGGQRQAVALARAL----IRKPRLLILDNATSALDAGNQLRVQRLLYESPEWATVLLITQQLSLAERAHHILGSVCEQG................. 238
27 -11.5003zdq_A mol:protein length:595 ATP-BINDING CASSETTE SUB-FAMILY B MEMBER 10,  ali model follow..  22  369......................SGSVTALVGPSGSGKSTVLSLLL--------------------------------------------------RLYDPASGTISLDGHDIRQLNPVWLRSKIGTVSQEPILFSCSIAENIAYGADDPSSVTAEEIQRVAEVANAVAFIR-NFPQGFNTVVG-------------------------------EKGVLLSGGQKQRIAIARAL----LKNPKILLLDEATSALDAENEYLVQEALDRLMDGRTVLVIAHRLSTIKNANMV--AVLDQG................. 557
28 -11.5004ayw_A mol:protein length:619 ATP-BINDING CASSETTE SUB-FAMILY B MEMBER 10  ali model follow..  20  392...............QDFSLSIPSGVTALVGPSGSGKSTVLSLLL--------------------------------------------------RLYDPASGTISLDGHDIRQLNPVWLRSKIGTVSQEPILFSCSIAENIAYGADDPSSVTAEEIQRVAEVANAVAFIR-NFPQGFNTVVG-------------------------------EKGVLLSGGQKQRIAIARAL----LKNPKILLLDEATSALDAENEYLVQEALDRLMDGRTVLVIAHHLSTIKNANMV--AVLDQG................. 588
29 -11.4001l7v_C mol:protein length:249 Vitamin B12 transport ATP-binding protein btu  ali model follow..  15  4..VMQLQDVAESTRLGPLSGEVRAGILHLVGPNGAGKSTLLARMAGMTSGKGSIQFAGQPLEAWSATKLALHRAYLSQQQTPPFATPVWHYL-----------------------------------------------------------------------------------------------TLHQHDKTRTELLNDVAGALALDDKLGRSTNQLSGGEWQRVRLAAVVLQITPQANPLLLLDEPMNSLDVAQQSALDKILSALCQQLAIVMSSHDNHTLRHAHRAWGKMLASGRREEV............ 220
30 -11.4003b5w_A mol:protein length:582 Lipid A export ATP-binding/permease protein m  ali model follow..  23  371.........................TVALVGRSGSGKSTIASLI---------------------------------------------------RFYDIDEGEILMDGHDLREYTLASLRNQVALVSQNVHLFNDTVANNIAYARTEQYSREQIEEAARMAYAMDF----NKMDNGLDTVIG-------------------------------ENGVLLSGGQRQRIAIARAL----LRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLSTIEKADEI--VVVEDG................. 554
31 -11.4003vx4_A mol:protein length:273 Putative ABC transporter, ATP-binding protein  ali model follow..  19  64..........................VSLVGASGSGKTTLAKLIV--------------------------------------------------NFYEPNKGIVRINGNDLKVIDKTALRRHISYLPQQAYVFSGSIMDNLVLGAKEGTSQEDIIRACEIAEIRSD----EQMPQGYQTELSDGAG--------------------------------ISGGQKQRIALARAL----LTQAPVLILDAATSSLDILTEKKIISNLLQMTEKTIIF-VAHRLSISQRTDEVIGKIVEQG................. 250
32 -11.4003b5y_A mol:protein length:582 Lipid A export ATP-binding/permease protein m  ali model follow..  23  371.........................TVALVGRSGSGKSTIASLI---------------------------------------------------RFYDIDEGHILMDGHDLREYTLASLRNQVALVSQNVHLFNDTVANNIAYARTEEYSREQIEEAARMAYAMDF----NKMDNGLDTIIG-------------------------------ENGVLLSGGQRQRIAIARAL----LRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLSTIEQADEI--VVVEDG................. 554
33 -11.3003b5x_A mol:protein length:582 Lipid A export ATP-binding/permease protein m  ali model follow..  22  371.........................TVALVGRSGSGKSTIANLF---------------------------------------------------RFYDVDSGSICLDGHDVRDYKLTNLRRHFALVSQNVHLFNDTIANNIAYAAEGEYTREQIEQAARQAHAMEF----ENMPQGLDTVIG-------------------------------ENGTSLSGGQRQRVAIARAL----LRDAPVLILDEATSALDTESERAIQAALDELQKNKTVLVIAHRLSTIEQADEI--LVVDEG................. 554
34 -11.3003nh6_A mol:protein length:306 ATP-binding cassette sub-family B member 6, m  ali model follow..  20  61...........RETLQDVSFTVMPGQTALVGPSGAGKSTILRLL---------------------------------------------------RFYDISSGCIRIDGQDISQVTQASLRSHIGVVPQDTVLFNDTIADNIRYGRVTAGNDEVEAAAQAAG-----------------------------IHDAIMAFPEGYRTQVGERGLK------LSGGEKQRVAIARTI----LKAPGIILLDEATSALDTSNERAIQASLAKVCANRTTIVVAHRLSTVVNADQI--LVIKDG................. 258
35 -11.2005c73_C mol:protein length:564 Protein glycosylation K  ali model follow..  17  349LKICNLSFGGKKYLFKNLNLNIKKGKIAFIGESGCGKSTLVDLI---------------------------------------------------GLLKPKEGQILIDKQELNASNAKNYRQKIGYIPQNIYLFNDSIAKNITFGDAVDEEKLNKVIK------------------------------QANLEHFIKNLPQGVQTKVGDGGSN------LSGGQKQRIAIARAL----YLEPEILVLDQATSALDTQSEAKIMDEIYKISKDKTMIIIAHRLSTITQCDKVY--RLEHG................. 558
36 -11.1004fi3_C mol:protein length:249 Vitamin B12 import ATP-binding protein BtuD  ali model follow..  15  4..VMQLQDVAESTRLGPLSGEVRAGILHLVGPNGAGKSTLLARMAGMTSGKGSIQFAGQPLEAWSATKLALHRAYLSQQQTPPFATPVWHYL-----------------------------------------------------------------------------------------------TLHQHDKTRTELLNDVAGALALDDKLGRSTNQLSGGEWQRVRLAAVVLQITPQANPLLLLDQPMCSLDVAQQSALDKILSALSQQLAIVMSSHDNHTLRHAHRAWGKMLASGRREEV............ 220
37 -11.0004pl0_A mol:protein length:580 Microcin-J25 export ATP-binding/permease prot  ali model follow..  19  358...........KKILNSVSLDLFTGMYSLTGPSGSGKSTLVKII---------------------------------------------------GYYKNYFGDIYLNDISLRNISDEDLNDAIYYLTQDDYIFMDTLRFNLRLANYDASENEIFKVLKLANL------------------------------SVVNNEPVSLDTHLINRGNN------YSGGQKQRISLARLF----LRKPAIIIIDEATSALDYINESEILSSIRTHFPDALIINISHRINLLECSDCVYGNIVASG................. 560
38 -11.0005EG1 Entity 1(prereleased)  ali follow..  19  358...........KKILNSVSLDLFTGMYSLTGPSGSGKSTLVKII---------------------------------------------------GYYKNYFGDIYLNDISLRNISDEDLNDAIYYLTQDDYIFMDTLRFNLRLANYDASENEIFKVLKLANL------------------------------SVVNNEPVSLDTHLINRGNN------YSGGQKQRISLARLF----LRKPAIIIIDEATSALDYINESEILSSIRTHFPDALIINISHRINLLECSDCVYGNIVASG................. 560
39 -10.9002hyd_A mol:protein length:578 ABC transporter homolog  ali model follow..  18  354...........APILKDINLSIEKGETAFVGMSGGGKSTLINLI---------------------------------------------------RFYDVTSGQILIDGHNIKDFLTGSLRNQIGLVQQDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEV------------------------------------ERGVKLSGGQKQRLSIARIF----LNNPPILILDEATSALDLESESIIQEALDVLSKDRTTLIVAHRLSTITHADKIVVIEVETG................. 557
40 -10.8002nq2_C mol:protein length:253 Hypothetical ABC transporter ATP-binding prot  ali model follow..  15  11....GFYYQAENFLFQQLNFDLNKGILAVLGQNGCGKSTL---LDLLLGIHRPIQGKIEVYQSIGFVPQFFSSPFAYSVLDIVL------------MGRSTHINTFAKPKSHDYQVAMQALDYLNLTH-----------------------------------------------------------------------------------LAKREFTSLSGGQRQLILIARAIA----SECKLILLDEPTSALDLANQDIVLSLLIDLAQSMTVVFTTHKTLLLNKQNFKFGILTSENLTALFHLPMF....... 230
41 -10.7004hlu_D mol:protein length:268 Energy-coupling factor transporter ATP-bindin  ali model follow..  20  28...............KDVNAEFETGIYVVVGKNGSGKTTLLKILAGLLAAAG----------EIFLDGSPADPFLLRKNVGYVFQNPSSQIIGA------------------------TVEEDVAFSLEIMGL--------------------------------DESEMRKRIKKVLELV--------------------------GLSGLAAADPLNLSGGQKQRLAIA---SMLARDTR-FLALDEPVSMLDPPSQREIFQVLESLKNEKGIILVTHELEYLDDMDFI--LHISNG................. 215
42 -10.6004ry2_A mol:protein length:730 ABC-type bacteriocin transporter  ali model follow..  16  502...........KPVLKNINLTIPKGTVAIVGESGSGKTTLAKLLM--------------------------------------------------NFYSPEKGDILINGHSIKNISLELIRKKIAFVSQDVFIFSGTVKENLCLGNENVDMDEIIKAAKMANAHDFIEKLPLKYDTFLN-----------------------------------ESGANLSEGQKQRLAIARAL----LKKPDILILDEATSNLDSITENHIKDAIYGLEDDVTVIIIAHRLSTIVNCDKIYGEIVESG................. 705
43 -10.6004g1u_C mol:protein length:266 Hemin import ATP-binding protein HmuV  ali model follow..  19  12LEASHLHYHQQQALINDVSLHIASGMVAIIGPNGAGKSTLLRLLTGYLSPSHGEHLLGQNLNSWQPKALARTRAVMRQYSELAFPFSVSEVIQMGRAPYGGSQDRQALQQVMAQTDCLAL--------------------------------------------------------------------------------------------AQRDYRVLSGGEQQRVQLARVLA----PTPRWLFLDEPTSALDLYHQQHTLRLLRQLTRQLAVCCVLHDNLAALYADRI--MLLAQG................. 224
44 -10.4003ozx_A mol:protein length:538 RNase L inhibitor  ali model follow..  18  12........NGFKLF--GLPTPKNNTILGVLGKNGVGKTTV---LKILAGEIIPNFGDPNSKVGKDEVLKRFRGKEIYNYFKELYSNELKIVHKIQYVEYASKFLKGTVNEILTKIDERGKKDEV---------KELLNMTNLWN----------------------------------------------------------------------KDANILSGGGLQRLLVAASLL----READVYIFDQPSSYLDVRERMNMAKAIRELLKNKYVIVVDHDLIVLDLTDLIHIIYGESSVYGRVS........... 221
45 -10.2003g5u_A mol:protein length:1284 Multidrug resistance protein 1a  ali model follow..  19  407...............KGLNLKVKSGQTALVGNSGCGKSTT--------------------------------------------------VQLMQRLYDPLDGMVSIDGQDIRTINVRYLREIIGVVSQEPVLFATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFDTL-------------------------------------ERGAQLSGGQKQRIAIARAL----VRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGVIVEQG................. 606
46 -9.9401b0u_A mol:protein length:262 HISTIDINE PERMEASE  ali model follow..  18  14...........KRYGGHEVLK-AGDVISIIGSSGSGKSTFLRCI---------NFLEKPSEGAIIVNGQN---------INLVRDKDGQLKVADK-------------------NQLRLLRTRLTMVFQHFNLWSHMTVENVMEAPIQVLGLSKHDARERALKYLAKVGIDERAQGKYPV---------------------------------------LSGGQQQRVSIARALAM----EPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKMVVVTHEMGARHVSSHVIGKIEEEGDPEQV............ 240
47 -9.8804yms_J mol:protein length:240 ABC-type polar amino acid transport system, A  ali model follow..  20  9...........KNFGSLEVLK-KGEVVVIIGPSGSGKSTLLRCI---------NLLEEPTKGEVFIDGVKINNGK---------------------------------------VNINKVRQKVGMVFQHFNLFPHLTAIENITLAPVKVK------------KMNKKEAEELAVDLLAKV----------------------------LDKKDQYPIKLSGGQKQRLAIARALAM----QPEVMLFDEPTSALDPEMVKEVLNVMKQLANEMTMVVVTHEMGAREVGDRVIGVIVEEGTPEEI............ 223
48 -9.8602olj_A mol:protein length:263 Amino acid ABC transporter  ali model follow..  17  26...........KSFGSLEVLK-EGEVVVVIGPSGSGKSTFLRCL---------NLLEDFDEGEIIIDGINLKAKD---------------------------------------TNLNKVREEVGMVFQRFNLFPHMTVLNNITLAPMKVR------------KWPREKAEAKAMELLDKV----------------------------KDKAHAYPDSLSGGQAQRVAIARALAM----EPKIMLFDEPTSALDPEMVGEVLSVMKQLANEMTMVVVTHEMGAREVGDRVLGYIIEEGKPEDL............ 240
49 -9.7501xmi_A mol:protein length:291 Cystic fibrosis transmembrane conductance reg  ali model follow..  19  67..........................LAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRIFSWIMPGTIKE--------NIIAGVSYDEYRYRSVI------------KACQLEEDISKF--------------AEKDNIVLGEGGIT----------------------------------------------------------------------LSGGQRARISLARAV----YKDADLYLLDSPFGYLDLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKI--LILHEG................. 235
50 -9.7204mrn_A mol:protein length:614 ABC transporter related protein  ali model follow..  21  374...........REILHGLSFEVAAGSRAIVGPSGAGKSTIA----------------------LLF-----------------------------RFYDPWEGRILIDGQDIAHVTQTSLRAALGIVPQDSVLFNDTIGYNIAYGRDGASRAEVDAAAKGAA-----------------------------IADFIARLPQGYDTEVGERGLK------LSGGEKQRVAIARTL----VKNPPILLFDEATSALDTRTEQDILSTMRAVASHRTTISIAHRLSTIADSDTI--LVLDQG................. 571
51 -9.7205d7t_A mol:protein length:300 Energy-coupling factor transporter ATP-bindin  ali model follow..  21  32...............SDLSFAIERGWTALIGHNGSGKSTVSKLINGLLAPDDLDK-----------------------------------------------SSITVDGVKLGADTVWEVREKVGI-------VFQNPDNQFVGATVSDDVAFGLENRAVPR-----PEMLKIVAQAVADV--------------------------GMADYADSEPSNLSGGQKQRVAIA---GILAVKPQ-VIILDESTSMLDPEGKEQILDLVRKIKEDLTVISITHDLEEAAGADQVLGQLLDQGKPEEIFPKVEMLKRIG. 249
52 -9.6702bbo_A mol:protein length:291 Cystic fibrosis transmembrane conductance reg  ali model follow..  19  67..........................LAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRIFSWIMPGTIKE--------NIIFGVSYDEYRYRSVI------------KACQLEEDISKF--------------AEKDNIVLGEGGIT----------------------------------------------------------------------LSEGQQAKISLARAV----YKDADLYLLDSPFGYLDLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKI--LILHEG................. 235
53 -9.6301g6h_A mol:protein length:257 HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID TRANS  ali model follow..  18  14....VKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGR---------VYFENKDITNKEPAELYHYGIVRTFQTPQPLKEMT----------------------------------------LENLLIGEICPGESPLNSLFYKKWIPKEEEMVEKAFKILE---------------------------FLKLSHLYDRKAGELSGGQMKLVEIGRALMT----NPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKITFLIIEHRDIVLNYIDHLYGQIIAEGRGEEEIKNVLSDPKVVE 252
54 -9.6004f4c_A mol:protein length:1321 Multidrug resistance protein pgp-1  ali model follow..  17  424............TYPSRPDVPILRGMVALVGSSGCGKSTI--------------------------------------------------ISLLLRYYDVLKGKITIDGVDVRDINLEFLRKNVAVVSQEPALFNCTIEENISLGKEGITREEMVAACKMANAEKFIKTLPNGYNTL-------------------------------------DRGTQLSGGQKQRIAIARAL----VRNPKILLLDEATSALDAESEGIVQQALDKAAKGRTTIIIAHRLSTIRNADLIIGQVVEVGDRALMAQQ......... 643
55 -9.5903gd7_A mol:protein length:390 Fusion complex of Cystic fibrosis transmembra  ali model follow..  15  38...............ENISFSISPGRVGLLGRTGSGKSTLLSAFLRLLNTEGEIQIDGVSWDSI----------------------------------------------------------TLEQWRKAFGVIPQ---KVFIFSGTFRKNLDPNAAHSDQEIWKVADEVG--------------------LRSVIEQFPGKLDFVLVDGGCV------LSHGHKQLMCLARSV----LSKAKILLLDEPSAHLDPVTYQIIRRTLKQAFADCTVILCEARIEAMLECDQF--LVIEEN................. 229
56 -9.5404huq_B mol:protein length:279 Energy-coupling factor transporter ATP-bindin  ali model follow..  20  24...............TDVSFTVHAGWLAIVGHNGSGKSTLAKSLDGLLPFT--------------------------------------------------QGSVTVGGITLTPETVWQVREQIGM-------IFQNPDNQFVGATVEDDVAFGLENRQISR-----DEMVPRVQAALAQV--------------------------GMTSFAQREPSSLSGGQKQRVALA---GIVAIAPK-ILILDEATSMLDPQGRIEMLAIVRQLRQQLTVISITHDIDEAASADRVLGRLVDEAVPSQIFERGTQLVEMG. 238
57 -9.4202pzg_A mol:protein length:241 Cystic fibrosis transmembrane conductance reg  ali model follow..  21  49..........................LAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRIFSWIMPGTIKE--------NIIFGVSYDEYRYRSVIKA------------------------------------------------------------------------------------------CQLEEDISKFAEKDNIVLGEGGIT------LSGGQRARISLARAV----YKDADLYLLDSPFGYLDLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKI--LILHEG................. 217
58 -9.4204wbs_A mol:protein length:282 ABC transporter related  ali model follow..  19  41...........KRYGSRTVVK-SGEVVGLLGPNGAGKTTSFYMIVGLVPLDAGE---------IDLDGKSISLLPIHKRASLGLSYLPQEASVFRKLS-------------------------------------EENIRAVLELQVGDDGKRLSKDAIASRTEALLDELQIS-------------------------------------HLRENPALSLSGGERRRVEIARALAT----NPSFILLDEPFAGVDPIAVLEIQKIVKFLKQRNIGVLITHNRETLGICDHAYGSVLAAGAPGDIIEN......... 262
59 -9.4001q3h_A mol:protein length:286 Cystic fibrosis transmembrane conductance reg  ali model follow..  20  67..........................LAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVFSWIMPGTIKE--------NIIFGVSYDEYRYKSVV------------KACQLQQDITKF--------------AEQDNTVLGEGGVT----------------------------------------------------------------------LSGGQRARISLARAV----YKDADLYLLDSPFGYLDFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKI--LILHQG................. 235
60 -9.3901yqt_A mol:protein length:538 RNase l inhibitor  ali model follow..  17  6..SGLVPRSHMEQLEEDCVHRYGVNVVGIVGPNGTGKSTA---VKILAGQLIPNLCGDNDSWDGVIRAFRGNE------------QNYFEKLKNGEIRPVVKPQYVDLIPKAVKGKVIELLKKADETGKLEEVVKALELENVLE----------------------------------------------------------------------REIQHLSGGELQRVAIAAALL----RNATFYFFDEPSSYLDIRQRLNAARAIRRLSEEGKSVLVVEHDLAVYLSDIIHVVYGEPGVYGIFS........... 236
61 -9.2902bbs_A mol:protein length:290 Cystic fibrosis transmembrane conductance reg  ali model follow..  19  67..........................LAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRINSWIMPGTIK----------------------------------------------ENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGIT-----------------------------------------------------------LSGGQRARISLARAV----YKDADLYLLDSPFGYLDLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKI--LILHEG................. 234
62 -9.2704q7l_A mol:protein length:256 Uncharacterized ABC transporter ATP-binding p  ali model follow..  17  34..........................VALVGPTGSGKTTIVNLLM--------------------------------------------------RFYDVDRGQILVDGIDIRKIKRSSLRSSIGIVLQDTILFSTTVKENLKYGNPGATDEEIKEAAKLTHSDHFIKHLPEGYETVLT-----------------------------------DNGEDLSQGQRQLLAITRAF----LANPKILILDEATSNVDTKTEKSIQAAMWKLMEGKTSIIIAHRLNTIKNADLI--IVLRDG................. 215
63 -9.2302iw3_A mol:protein length:986 ELONGATION FACTOR 3A  ali model follow..  19  440.........GAKILLNKTQLRLKRA-YGICGPNGCGKSTL---MRAIANGQV--------------DGFPTQEECRTVYVEHDIDGTHSDTSVL---------DFVFESGVGTKEAIKDKLIEFGFTDE----------------------------------------------------------------------------------MIAMPISALSGGWKMKLALARAV----LRNADILLLDEPTNHLDTVNVAWLVNYLNTCGITS--ITISHDSVFLDVCEYII--NYEGLKLRKYKGNFTEFVKK.. 630
64 -9.2001sgw_A mol:protein length:214 putative ABC transporter  ali model follow..  15  5LEIRDLSVGYDKPVLERITMTIEKGVVNFHGPNGIGKTTLLKTISTYLKPLKG---------EIIYNG----------------------------------------------VPITKVKGKIFFLPEEIIVPRKISVEDYLK------------VASLYGVKVNKNEIMDALESV--------------------------------VLDLKKKLGELSQGTIRRVQLASTL----LVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEKGIVIISSRE-ELSYCDVNENLHKYSTKI............... 204
65 -9.1303gfo_A mol:protein length:275 Cobalt import ATP-binding protein cbiO 1  ali model follow..  22  25...............KGINMNIKRGVTAILGGNGVGKSTLFQNFNGILKPSSGR---------ILFDNKP------------------------------------IDYSRKGIMKL----------RESIGIVFQDPDNQLFSASVYQ-----DVSFGAVNMKLPEDEIRKRVDNALKRT--------------------------GIEHLKDKPTHCLSFGQKKRVAIA---GVLVMEPK-VLILDEPTAGLDPMGVSEIMKLLVEMQKEITIIIATHDDIVPLYCDNVFGRVILQGNPKEVFAEKEVIRKV.. 241

FFAS is supported by the NIH grant R01-GM087218-01
8 2 8 8 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Jaroszewski L, Ye Y, Godzik A. The interplay of fold recognition and experimental structure determination in structural genomics. Curr Opin Struct Biol. 2004 Jun;14(3):307-12.