current user: public




1cm8A
Query: 1cm8_A mol:protein length:367 PHOSPHORYLATED MAP KINASE P38-GAMMA, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .
# Score Template Links and tools%idFirst MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPLLast
1 -133.0001cm8_A mol:protein length:367 PHOSPHORYLATED MAP KINASE P38-GAMMA  ali model  100  1MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL 367
2 -131.0003gc8_A mol:protein length:370 Mitogen-activated protein kinase 11  ali model follow..  61  4MLEMSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDSELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIE. 369
3 -131.0003gcp_A mol:protein length:360 Mitogen-activated protein kinase 14  ali model follow..  60  2....SQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKSQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDSELKILDFGLCRHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSLESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES.... 360
4 -131.0003U8W Entity 1(prereleased)  ali follow..  61  4MLEMSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES.... 366
5 -131.0002fsl_X mol:protein length:367 Mitogen-activated protein kinase 14  ali model follow..  60  2...ASQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTADEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSSESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES.... 361
6 -131.0001oz1_A mol:protein length:372 Mitogen-activated protein kinase 14  ali model follow..  61  5.GSMSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES.... 366
7 -130.0003p4k_A mol:protein length:370 Mitogen-activated protein kinase 14  ali model follow..  61  3.AMMSQERPTFYRQELNKTIWEVPERYQNLAPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES.... 364
8 -130.0003e92_A mol:protein length:371 Mitogen-activated protein kinase 14  ali model follow..  61  10.HGMSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES.... 371
9 -128.0003dt1_A mol:protein length:383 Mitogen-activated protein kinase 14  ali model follow..  61  15MLEMSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES.... 377
10 -128.0003coi_A mol:protein length:353 Mitogen-activated protein kinase 13  ali model follow..  66  1.SLSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMG-LKFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQPFDDSLEHEKLTVDEWKQHIYKEIVNFSP.............. 352
11 -126.0003oht_A mol:protein length:389 p38a  ali model follow..  61  22.TMSHKERPTFYRQELNKTIWEVPERYQTLSPVGSGAYGSVCSSYDVKSGLKIAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPATSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTGTPPASVISRMPSHEARNYINSLPQMPKRNFADVFIGANPLAVDLLEKMLVLDTDKRITASEALAHPYFSQYHDPDDEPESEPYDQSFESRQLEIEEWKRLTYEEVCSFETPPFDGDEMES.... 383
12 -125.0002z7l_A mol:protein length:366 Mitogen-activated protein kinase 1  ali model follow..  40  2...AMAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKI-SPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAP-TIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEPFKFDMELDDLPKEKLKELIFEETARFQPGYRS.......... 360
13 -125.0003QYI Entity 1(prereleased)  ali follow..  40  2.....AAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKI-SPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAP-TIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEPFKFDMELDDLPKEKLKELIFEETARFQPGYRS.......... 358
14 -125.0001wzy_A mol:protein length:368 Mitogen-activated protein kinase 1  ali model follow..  40  8.LMAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKI-SPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAP-TIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEPFKFDMELDDLPKEKLKELIFEETARFQPGYRS.......... 368
15 -125.0001tvo_A mol:protein length:368 Mitogen-activated protein kinase 1  ali model follow..  40  2...AAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKI-SPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAP-TIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEPFKFDMELDDLPKEKLKELIFEETARFQPGYRSGDLGSDE... 367
16 -124.0001pme_A mol:protein length:380 ERK2  ali model follow..  41  14.HMAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKI-SPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAP-TIEQMKDVYLVTHLMGADLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEPFKFDMELDDLPKEKLKELIFEETARFQPGYRS.......... 374
17 -124.0002ojg_A mol:protein length:380 Mitogen-activated protein kinase 1  ali model follow..  40  14.HMAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKI-SPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAP-TIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEPFKFDMELDDLPKEKLKELIFEETARFQPGYRS.......... 374
18 -123.0002zoq_A mol:protein length:382 Mitogen-activated protein kinase 3  ali model follow..  40  20.TEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKI-SPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAS-TLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPELTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEPFTFAMELDDLPKERLKELIFQETARFQPGVLEA......... 381
19 -122.0002xrw_A mol:protein length:371 MITOGEN-ACTIVATED PROTEIN KINASE 8  ali model follow..  46  1MGSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ-MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSMTPYVVTRYYRAPEVILGM-GYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQLGTPCPEFMKKL-QPTVRTYVENRPKYAGYSFEKLFPDVASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPIPDKQLDEREHTIEEWKELIYKEVMDLE............... 365
20 -121.0003npc_A mol:protein length:364 Mitogen-activated protein kinase 9  ali model follow..  46  2..SKSKVDNQFYSVEVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH-MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNMTPYVVTRYYRAPEVILG-MGYAANVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQLGTPSAEFMAAL-QPTVRNYVENRPKYPGIKFEELFPDKTSQARDLLSKMLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPIYDAQLEEREHAIEEWKELIYKEVMDWE............... 364
21 -121.0002g01_A mol:protein length:370 Mitogen-activated protein kinase 8  ali model follow..  44  2..SRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ-MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSMEPEVVTRYYRAPEVILGM-GYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKL-QPTVRTYVENRPKYAGYSFEKLFPDVASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPIPDKQLDEREHTIEEWKELIYKEVMDLE............... 364
22 -121.0002b9f_A mol:protein length:353 Mitogen-activated protein kinase FUS3  ali model follow..  39  4.................RIVYNISSDFQLKSLLGEGAYGVVCSATHKPTGEIVAIKKI-EPFDKPLFALRTLREIKILKHFKHENIITIFNIQRPD-SFENFNEVYIIQELMQTDLHRVISTQMLSDDHIQYFIYQTLRAVKVLHGSNVIHRDLKPSNLLINSNCDLKVCDFGLARIIDESMTEYVATRWYRAPEVMLTSAKYSRAMDVWSCGCILAELFLRRPIFPGRDYRHQLLLIFGIIGTPHSDDLRCIESPRAREYIKSLPMYPAAPLEKMFPRVNPKGIDLLQRMLVFDPAKRITAKEALEHPYLQTYHDPNDEPEGEPFEFDHYKEALTTKDLKKLIWNEIFS................. 353
23 -121.0003e7o_A mol:protein length:360 Mitogen-activated protein kinase 9  ali model follow..  46  2....SHMDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH-MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTASTNMTPYVVTRYYRAPEVILGM-GYKENVDIWSVGCIMGELVKGSVIFQGTDHIDQWNKVIEQLGTPSAEFMAAL-QPTVRNYVENRPAYPGIAFEELFPDKTSQARDLLSKMLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPIYDAQLEEREHAIEEWKELIYKEVMD................. 360
24 -121.0003elj_A mol:protein length:369 Mitogen-activated protein kinase 8  ali model follow..  45  7..SRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ-MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSMTPYVVTRYYRAPEVILGM-GYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKL-QPTVRTYVENRPKYAGYSFEKLFPDVASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPIPDKQLDEREHTIEEWKELIYKEVMDLE............... 369
25 -121.0002xs0_A mol:protein length:386 MITOGEN-ACTIVATED PROTEIN KINASE 8  ali model follow..  44  4..SRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ-MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSMVPFVVTRYYRAPEVILGM-GYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQLGTPCPEFMKKL-QPTVRTYVENRPKYAGYSFEKLFPDVASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPIPDKQLDEREHTIEEWKELIYKEVMDLEERTKNGVIRGQPSPL 381
26 -119.0003fv8_A mol:protein length:355 Mitogen-activated protein kinase 10  ali model follow..  45  2..SKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQ-MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSMTPYVVTRYYRAPEVILGM-GYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKL-QPTVRNYVENRPKYAGLTFPKLFPDSASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAXXX-------XXDEREHTIEEWKELIYKEVMNSE............... 355
27 -118.0003oz6_A mol:protein length:388 Mitogen-activated protein kinase 1, serine/th  ali model follow..  34  2.................RVDRHVLRKYELVKKLGKGAYGIVWKSIDRRTGEVVAVKKIFDAFQNSTDAQRTFREIMILTELSHENIVNLLNVLRAD----NDRDVYLVFDYMETDLHAVIRANILEPVHKQYVVYQLIKVIKYLHSGGLLHRDMKPSNILLNAECHVKVADFGLSRSFVNILTDYVATRWYRAPEILLGSTKYTKGIDMWSLGCILGEILCGKPIFPGSSTMNQLERIIGVIDFPSNEDVESIQSPFAKTMIESLKEKVEIRQSNKRADCNEEALDLLDKLLQFNPNKRISANDALKHPFVSIFHNPNEEPNCDHITIPINNVKHSIDDYRNLVYSEISRRKRELISNKHQNVQN.. 388
28 -118.0003nie_A mol:protein length:429 MAP2 kinase  ali model follow..  36  2....SSGRENLYFQGAIIKNVKVPDNYEIKHLIGRGSYGYVYLAYDKNANKNVAIKKVNRMFEDLIDCKRILREITILNRLKSDYIIRLHDLIIPE-DLLKFDELYIVLEIADSDLKKLFKTIFLTEQHVKTILYNLLLGEKFIHESGIIHRDLKPANCLLNQDCSVKICDFGLARTINSDLTSHVVTRWYRAPELILLQENYTNSIDIWSTGCIFAELLNMFPLFPGKSNRDQLNIIFNVIGTPPEEDLKCITKQEVIKYIKLFPTRDGIDLSKKYSSISKEGIDLLESMLRFNAQKRITIDKALSHPYLKDVRKENLENFSTKIILPFDDMVLSETQLRYIFLKEIQSFHADLIIPAKLNIHQK. 421
29 -117.0003rp9_A mol:protein length:458 Mitogen-activated protein kinase  ali model follow..  36  30.RKQHHSSKPTASMPRPHSDWQIPDRYEIRHLIGTGSYGHVCEAYDKLEKRVVAIKKILRVFEDLIDCKRILREIAILNRLNHDHVVKVLDIVIPK-DVEKFDELYVVLEIADSDFKKLFRTVYLTELHIKTLLYNLLVGVKYVHSAGILHRDLKPANCLVNQDCSVKVCDFGLARTVDYPLTGHVVTRWYRAPELILLQENYTEAIDVWSIGCIFAELLNRGPLFPGSSCRDQLNVIFNILGTPSEEDIEALEKEDAKRYIRIFPKREGTDLAERFPASSADAIHLLKRMLVFNPNKRITINECLAHPFFKEVRIAEVETNATKVRLPFNDMNMDEPQLRYAFVKEIQRYHPEIQLPRRSPNRAS. 457
30 -116.0002i6l_A mol:protein length:320 Mitogen-activated protein kinase 6  ali model follow..  37  1..............SMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAIKKI--VLTDPQSVKHALREIKIIRRLDHDNIVKVFEILGPSGSLTELNSVYIVQEYMETDLANVLEQGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTDLVLKIGDFGLARIMDPHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQMQLILESIPVVHEEDRQELLSV-IPVYIRNDMTEPHKPLTQLLPGISREAVDFLEQILTFSPMDRLTAEEALSHPYMSIYSFPMDEPI............................................. 320
31 -116.0003n9x_A mol:protein length:432 Phosphotransferase  ali model follow..  35  2......SSGRENLYFQGIKNVHVPDNYIIKHLIGRGSYGYVYLAYDKNTEKNVAIKKVNRMFEDLIDCKRILREITILNRLKSDYIIRLYDLIIPD-DLLKFDELYIVLEIADSDLKKLFKTIFLTEEHIKTILYNLLLGENFIHESGIIHRDLKPANCLLNQDCSVKVCDFGLARTINSELTSHVVTRWYRAPELILLQENYTKSIDIWSTGCIFAELLNMFPLFPGKSNRDQLNIIFNIIGTPTEDDLKNINKPEVIKYIKLFPHRKPINLKQKYPSISDDGINLLESMLKFNPNKRITIDQALDHPYLKDVRKKKLENFSTKIILPFDDMVLSETQLRYIFLKEVQSFHPELVIPSVFTIHEN. 416
32 -116.0003UIB Entity 1(prereleased)  ali follow..  35  3.....QAKGEAAMRDLIAELHAMQSPYTVQRFISSGSYGAVCAGVDS-EGIPVAIKRVFNILSDSFLCKRVLREIRLLNHFHHPNILGLRDIFVHF-EEPAMHKLYLVTELMRTDLAQVIHDQRISPQHIQYFMYHILLGLHVLHEAGVVHRDLHPGNILLADNNDITICDFNLAREDTADKTHYVTHRWYRAPELVMQFKGFTKLVDMWSAGCVMAEMFNRKALFRGSTFYNQLNKIVEVVGTPKIEDVVMFSSPSARDYLRSLSNVPARAWTAVVPTADPVALDLIAKMLEFNPQRRISTEQALRHPYFESLFDPLDLTEGLSERFHFDESVTDVYDMHKIFTAEVERFND.............. 362
33 -116.0003pg1_A mol:protein length:362 Mitogen-activated protein kinase, putative (M  ali model follow..  35  3.....QAKGEAAMRDLIAELHAMQSPYTVQRFISSGSYGAVCAGVDS-EGIPVAIKRVFNILSDSFLCKRVLREIRLLNHFHHPNILGLRDIFVHF-EEPAMHKLYLVTELMRTDLAQVIHDQRISPQHIQYFMYHILLGLHVLHEAGVVHRDLHPGNILLADNNDITICDFNLAREDTADKTHYVTHRWYRAPELVMQFKGFTKLVDMWSAGCVMAEMFNRKALFRGSTFYNQLNKIVEVVGTPKIEDVVMFSSPSARDYLRSLSNVPARAWTAVVPTADPVALDLIAKMLEFNPQRRISTEQALRHPYFESLFDPLDLTEGLSERFHFDESVTDVYDMHKIFTAEVERFND.............. 362
34 -115.0003tti_A mol:protein length:464 Mitogen-activated protein kinase 10  ali model follow..  44  39.MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQ-MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSMTPYVVTRYYRAPEVILGM-GYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKL-QPTVRNYVENRPKYAGLTFPKLFPDSASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSP. 416
35 -104.0003e3p_A mol:protein length:360 Protein kinase, putative Glycogen synthase ki  ali model follow..  28  1..GPGSMMSLNAAAAADERSRKEMDRFQVERMAGQGTFGTVQLGKEKSTGMSVAIKKV---IQDPRFRNRELQIMQDLAVLHHPNIVQLQSYFYTLGE-RDRRDIYLVMEYVPDTLHRCCRNVAPPPILIKVFLFQLIRSIGCLHSVNVCHRDIKPHNVLVNADGTLKLCDFGSAKKLSEPNVAYICSRYYRAPELIFGNQHYTTAVDIWSVGCIFAEMMLGEPIFRGDNSAGQLHEIVRVLGCPSREVLRKLNPSHTDVDLYNSKGIPSNVFSDHSLKDAKEAYDLLSALLQYLPEERMKPYEALCHPYFDELHDPATKLPNNKFRFLPNEIEVMSEAQKAKLVRK.................... 360
36 -103.0004dit_A mol:protein length:382 Glycogen synthase kinase-3 beta  ali model follow..  25  9.DKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKV------LQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTALKLCDFGSAKQLGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTE---FKFPQIKAHPWTKVFPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRFNFTTQELSSN-PPLATILIPPHARIQAAASTPTNAAALE.. 376
37 -103.0001o9u_A mol:protein length:350 GLYCOGEN SYNTHASE KINASE-3 BETA  ali model follow..  27  5.........TVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQ------GKAFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPATVYRVARKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTALKLCDFGSAKQLGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTE---FAFPQIKAHPWTKVFPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRFNFTTQELSSNPPLATILIPPHA................... 348
38 -103.0001r0e_A mol:protein length:391 Glycogen synthase kinase-3 beta  ali model follow..  25  2.AMSLSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKV------LQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTALKLCDFGSAKQLGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTE---FKFPQIKAHPWTKVFPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRFNFTTQELSSN-PPLATILIPPHARIQAAASTPTNATAASD. 370
39 -103.0001gng_A mol:protein length:378 GLYCOGEN SYNTHASE KINASE-3 BETA  ali model follow..  25  6.DKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKV------LQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTALKLCDFGSAKQLGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTE---FKFPQIKAHPWTKVFPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRFNFTTQELSSN-PPLATILIPPHARIQAAASTPT........ 367
40 -102.0004agu_A mol:protein length:311 CYCLIN-DEPENDENT KINASE-LIKE 1  ali model follow..  29  1......................MMEKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALREIRMLKQLKHPNLVNLLEVFRRK------RRLHLVFEYCDHTVLHELDRRGVPEHLVKSITWQTLQAVNFCHKHNCIHRDVKPENILITKHSVIKLCDFGFARLLTGPYDDEVATRWYRSPELLVGDTQYGPPVDVWAIGCVFAELLSGVPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSTNQYFSGVKIPDPEDMEPLELKFPNISYPALGLLKGCLHMDPTERLTCEQLLHHPYFENIREIEDLAKEHDK......................................... 303
41 -101.0003eb0_A mol:protein length:383 Putative uncharacterized protein  ali model follow..  30  2...................LETSSKKYSLGKTLGTGSFGIVCEVFDIESGKRFALKKVLQ------DPRYKNRELDIMKVLDHVNIIKLVDYFYTTGNPSQNKYLNVIMEYVPDTLHKVLKSRSIPMNLISIYIYQLFRAVGFIHSLGICHRDIKPQNLLVNSDNTLKLCDFGSAKKLSEPSVAYICSRFYRAPELMLGATEYTPSIDLWSIGCVFGELILGKPLFSGETSIDQLVRIIQIMGTPTKEQMIRMNPHYTEVR---FPTLKAKDWRKILPEGTPLAIDLLEQILRYEPDLRINPYEAMAHPFFDHLRNSYESEVKNNFNFSYELSIIPGNVLNRILPKNFSPNYKH............. 383
42 -98.9001q3d_A mol:protein length:424 GLYCOGEN SYNTHASE KINASE-3 BETA  ali model follow..  25  35.DKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKV------LQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTALKLCDFGSAKQLGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTE---FKFPQIKAHPWTKVFPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRFNFTTQELSSN-PPLATILIPPHARIQAAASTPTNATAASD. 403
43 -98.7003SAY Entity 1(prereleased)  ali follow..  25  31.DKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKV------LQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTALKLCDFGSAKQLGEPNVSXICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTE---FKFPQIKAHPWTKVFPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRFNFTTQELSSN-PPLATILIPPHARIQAAASTPTNATAAS.. 398
44 -95.1003rp0_A mol:protein length:349 Casein kinase II subunit alpha, Casein kinase  ali model follow..  28  18.....HRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKIL-----KPVKKKKIKREIKILENLRGPNIITLADIVKDP---VSRTPALVFEHVNNTDFKQLY--QTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDEHRKLRLIDWGLAEFYGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKPFFHGHDNYDQLVRIAKVLGTEDLYDIDKYNIELDPRFNDILGRHSRKRWERFVHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYPVVKEQSQPCADAVLSSGLTAA................................. 348
45 -94.2003ofm_A mol:protein length:350 Casein kinase II subunit alpha`  ali model follow..  28  20......RSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKIL-----KPVKKKKIKREVKILENLRGTNIIKLIDTVKDP---VSKTPALVFEYINNTDFKQLY--QILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDQQKKLRLIDWGLAEFYHPEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRRPFFHGQDNYDQLVRIAKVLGTEELYGLKKYHIDLDPHFNDILGQHSRKRWENFIHSVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPSADAVLSSGLTAA................................. 349
46 -93.6002zjw_A mol:protein length:340 Casein kinase II subunit alpha  ali model follow..  29  23.....HRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKIL-----KPVKKKKIKREIKILENLRGPNIITLADIVKDP---VSRTPALVFEHVNNTDFKQLY--QTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDEHRKLRLIDWGLAEFYGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKPFFHGHDNYDQLVRIAKVLGTEDLYDIDKYNIELDPRFNDILGRHSRKRWERFVHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMG............................................. 340
47 -93.0004aaa_A mol:protein length:331 CYCLIN-DEPENDENT KINASE-LIKE 2  ali model follow..  29  2.......GSSGVDLGTENLYFQSMEKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMREIKLLKQLRHENLVNLLEVCKKK------KRWYLVFEFVDHTILDDLELNGLDYQVVQKYLFQIINGIGFCHSHNIIHRDIKPENILVSQSGVVKLCDFGFARTLAAPYDDEVATRWYRAPELLVGDVKYGKAVDVWAIGCLVTEMFMGEPLFPGDSDIDQLYHIMMCLGNLIPRHQELFNKNPVFAGVRLPEIKEREPLERRYPKLSEVVIDLAKKCLHIDPDKRPFCAELLHHDFFQMDGFAERFSQELQLKVQKD.................................... 324
48 -92.9002pvh_A mol:protein length:352 Casein kinase II subunit alpha  ali model follow..  27  28......RPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKIL-----KPVKKKKIKREIKILQNLCGPNIVKLLDIVRDQ----HSKTPSLIFEYVNNTDFKVLY-PTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELKLRLIDWGLAEFYGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKPFFYGHDNHDQLVKIAKVLGTDGLNAYLNKYRIELDPQLEALGRHSRKPWLKFMHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENSRTRA........................................... 346
49 -92.9003e3b_X mol:protein length:339 Casein kinase II subunit alpha`  ali model follow..  29  23....SLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKIL-----KPVKKKKIKREVKILENLRGTNIIKLIDTVKDP---VSKTPALVFEYINNTDFKQLY--QILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDQQKKLRLIDWGLAEFYHPEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRRPFFHGQDNYDQLVRIAKVLGTEELYGLKKYHIDLDPHFNDILGQHSRKRWENFIHSVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQ............................................... 339
50 -86.7001gii_A mol:protein length:298 CELL DIVISION PROTEIN KINASE 2  ali model follow..  35  2........................ENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENK------LYLVFEHVHQDLKTFMDASAIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTS--MPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHL.............................................. 296
51 -86.6003pxf_A mol:protein length:306 Cell division protein kinase 2  ali model follow..  36  10........................ENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENK------LYLVFEFLHQDLKKFMDASAIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTS--MPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHL.............................................. 304
52 -86.6003QL8 Entity 1(prereleased)  ali follow..  36  10........................ENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENK------LYLVFEFLHQDLKKFMDASAIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTS--MPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHL.............................................. 304
53 -85.8001vyw_A mol:protein length:309 CELL DIVISION PROTEIN KINASE 2  ali model follow..  35  7........................ENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENK------LYLVFEFLHQDLKKFMDASAIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTS--MPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRLE........................................... 304
54 -85.6001ob3_A mol:protein length:288 CELL DIVISION CONTROL PROTEIN 2 HOMOLOG  ali model follow..  37  2........................EKYHGLEKIGEGTYGVVYKAQNN-YGETFALKKIRLEKEDEGIPSTTIREISILKELKHSNIVKLYDVIHTKKR------LVLVFEHLDQDLKKLLDVCELESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLARAFGIPYTHEIVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRILGTPNSKNWPNVTE--LPKYDPNFTVYEPLPWESFLKGLDESGIDLLSKMLKLDPNQRITAKQALEHAYFKE...................................................... 286
55 -84.7001h4l_A mol:protein length:292 CELL DIVISION PROTEIN KINASE 5  ali model follow..  34  2........................QKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKK------LTLVFEFCDQDLKKYFDSCNLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANARPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTK--LPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP.................................................. 292
56 -84.5002qkr_A mol:protein length:313 Cdc2-like CDK2/CDC28 like protein kinase  ali model follow..  39  15........................EKYQKLEKVGEGTYGVVYKAKDS-QGRIVALKRIRLDAEDEGIPSTAIREISLLKELHHPNIVSLIDVIHSERC------LTLVFEFMEKDLKKVLDENKLQDSQIKIYLYQLLRGVAHCHQHRILHRDLKPQNLLINSDGALKLADFGLARAFGIPYTHEVVTLWYRAPDVLMGSKKYSTSVDIWSIGCIFAEMITGKPLFPGVTDDDQLPKIFSILGTPNPREWPQVQELPLWKQR-TFQVFEKKPWSSIIPGFCQEGIDLLSNMLCFDPNKRISARDAMNHPYFKDLDPQ.................................................. 304
57 -83.4002pk9_A mol:protein length:317 Cyclin-dependent protein kinase PHO85  ali model follow..  32  1....................MSSSSQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPST-AIREISLMKELKHENIVRLYDVIHTENK------LTLVFEFMDNDLKKYMDSRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTPNESLWPSVTK--LPKYNPNIQQRPPRDLRQVLQPHDGNLMDFLHGLLQLNPDMRLSAKQALHHPWFAEYYHHASMGGSRS.......................................... 311
58 -83.3003mtl_A mol:protein length:324 Cell division protein kinase 16  ali model follow..  30  2........................ETYIKLDKLGEGTYATVYKGKSKLTDNLVALKEIRLEHEEGA-PCTAIREVSLLKDLKHANIVTLHDIIHTEKS------LTLVFEYLDKDLKQYLDDCGINMHNVKLFLFQLLRGLAYCHRQKVLHRDLKPQNLLINERGELKLADFGLARAKSIPYDNEVVTLWYRPPDILLGSTDYSTQIDMWGVGCIFYEMATGRPLFPGSTVEEQLHFIFRILGTPTEETWPGILSNEEFKTY-NYPKYRAEALLSHAPRLDSDGADLLTKLLQFEGRNRISAEDAMKHPFFLSLGERIHKLPDTTSIFALKEIQLQKEASLR......................... 316
59 -83.0002w96_B mol:protein length:306 CELL DIVISION PROTEIN KINASE 4  ali model follow..  35  4........................SRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGEEGLPISTVREVALLRRLEHPNVVRLMDVCATSRTDRE-IKVTLVFEHVDQDLRTYLDKAPLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQLDPVVVTLWYRAPEVLLQ-STYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAF----PPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHK...................................................... 294
60 -82.9001ua2_A mol:protein length:346 Cell division protein kinase 7  ali model follow..  32  10........................KRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSN------ISLVFDFMETDLEVIIKDNVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCS----PDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNP............................ 323
61 -82.1003nup_A mol:protein length:307 Cell division protein kinase 6  ali model follow..  36  11........................QQYECVAEIGEGAYGKVFKARDKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLEHPNVVRLFDVCTVSRTDRE-TKLTLVFEHVDQDLTTYLDKVPVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQLTSVVVTLWYRAPEVLLQ-SSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAF----HSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQ....................................................... 301
62 -82.0003gbz_A mol:protein length:329 Kinase, CMGC CDK  ali model follow..  33  28........................DRYRRITKLGEGTYGEVYKAIDTVTNETVAIKRIRLEHEEEGVPGTAIREVSLLKELQHRNIIELKSVIHHNHR------LHLIFEYAENDLKKYMDKNDVSMRVIKSFLYQLINGVNFCHSRRCLHRDLKPQNLLLSVS-VLKIGDFGLARAFGIPFTHEIITLWYRPPEILLGSRHYSTSVDIWSIACIWAEMLMKTPLFPGDSEIDQLFKIFEVLGLPDDTTWPGVTA--LPDWKQSFPKFRGKTLRVLGALLDDEGLDLLTAMLEMDPVKRISAKNALEHPYFSHNDFD.................................................. 322
63 -81.6003mi9_A mol:protein length:351 Cell division protein kinase 9  ali model follow..  32  17........................SKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKAS-RCKGSIYLVFDFCEHDLAGLLSNVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLE-LVKGQKRKVKDRLKARDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRK.......................... 345
64 -81.6003g33_A mol:protein length:308 Cell division protein kinase 4  ali model follow..  35  9........................SRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGG-LPISTVREVALLRRLEHPNVVRLMDVCATSRTDRE-IKVTLVFEHVDQDLRTYLDKAPLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQLTPVVVTLWYRAPEVLLQ-STYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAF----PPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHK...................................................... 302
65 -80.9001bi7_A mol:protein length:326 CYCLIN-DEPENDENT KINASE 6  ali model follow..  35  11........................QQYECVAEIGEGAYGKVFKARDKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLEHPNVVRLFDVCTVSRTDRE-TKLTLVFEHVDQDLTTYLDKVPVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQLTSVVVTLWYRAPEVLLQ-SSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAF----HSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSH........................................... 313
66 -71.1003rgf_A mol:protein length:405 Cyclin-dependent kinase 8  ali model follow..  31  20........................DLFEYECKVGRGTYGHVYKAKDGKDDKDYALKQI----EGTGISMSACREIALLRELKHPNVISLQKVFLSHAD----RKVWLLFDYAEHDLWHIIKFHQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGE-RVKIADMGFARLFNADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQHHDQLDRIFNVMGFPADKDWEDIKKMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSD............................................... 346
67 -59.6003anq_A mol:protein length:368 Dual specificity tyrosine-phosphorylation-reg  ali model follow..  27  33......................WMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKN---KKAFLNQAQIEVRLLELMNKHDTEMKYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNVSLNLTRKFAQQMCTALLFLATLSIIHCDLKPENILLPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLG-MPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQ--APKARKFFEKLPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNTS............................................. 368
68 -58.1002vx3_A mol:protein length:382 DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION- RE  ali model follow..  28  46......................WMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKN---KKAFLNQAQIEVRLLELMNKHDTEMKYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNVSLNLTRKFAQQMCTALLFLATLSIIHCDLKPENILLPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLG-MPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQ--APKARKFFEKLPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADE.................................................. 376
69 -57.7003k2l_A mol:protein length:429 Dual specificity tyrosine-phosphorylation-reg  ali model follow..  28  89......................VAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRN---EKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILG-ARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDALNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRR...................................................... 408
70 -57.7001z57_A mol:protein length:339 Dual specificity protein kinase CLK1  ali model follow..  27  12......................LSARYEIVDTLGEGAFGKVVECIDHKAGRHVAVKIVKN---VDRYCEAARSEIQVLEHLNTTDPNSTFRCVQMLEWFEHHGHICIVFELLGLSTYDFIKENGFRLDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVQNPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILA-LGWSQPCDVWSIGCILIEYYLGFTVFPTHDSKEHLAMMERILGPLPKHMIQKTRKRKSAGRYVSRACKPLKEFMLSQDVEHERLFDLIQKMLEYDPAKRITLREALKHPFFDLLKKS.................................................. 338
71 -56.3003cek_A mol:protein length:313 Dual specificity protein kinase TTK  ali model follow..  24  22........................RIYSILKQIGSGGSSKVFQVLNE-KKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQDKIIRLYDYEITD------QYIYMVMECGNIDLNSWLKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDG-MLKLIDFGIANQMQPDTTSQVGTVNYMPPEAIKDMSKISPKSDVWSLGCILYYMTYGKT--PFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQ--------------------------DVLKCCLKRDPKQRISIPELLAHPYVQIQTHPVNQMAKGTTE........................................ 306
72 -56.2002wu6_A mol:protein length:381 DUAL SPECIFICITY PROTEIN KINASE CLK3  ali model follow..  24  43......................LQERYEIVGNLGEGTFGKVVECLDHARGKSVALKIIRN---VGKYREAARLEINVLKKIKEKDKENKFLCVLMSDWFNFHGHMCIAFELLGKNTFEFLKENNYPLPHVRHMAYQLCHALRFLHENQLTHTDLKPENILFVNSTSIRVADFGSATFDHEHHTTIVATRHYRPPEVILE-LGWAQPCDVWSIGCILFEYYRGFTLFQTHENREHLVMMEKILGPIPSHMIHRTRKQKSDGRYVKENCKPLKSYMLQDSLEHVQLFDLMRRMLEFDPAQRITLAEALLHPFFAGLTPEERSFHT............................................ 375
73 -56.0001zxe_A mol:protein length:303 Serine/threonine-protein kinase  ali model follow..  24  6........................SDFEEIAVLGQGAFGQVVKARNALDSRYYAIKKIRH---TEEKLSTILSEVMLLASLNHQYVVRYYAAWLERRNVKKKSTLFIQMEYCENTLYDLIHSENQQRDEYWRLFRQILEALSYIHSQGIIHRNLKPMNIFIDESRNVKIGDFGLAKNVHRSLTSAIGTAMYVATEVLDGTGHYNEKIDMYSLGIIFFEMIY--PFSTGMERVNILKKLRSVSIEFPPD---------------------------FDDNKMKVEKKIIRLLIDHDPNKRPGARTLLNSGWLPV...................................................... 289
74 -55.9002eu9_A mol:protein length:355 Dual specificity protein kinase CLK3  ali model follow..  24  17......................LQERYEIVGNLGEGTFGKVVECLDHARGKSVALKIIRN---VGKYREAARLEINVLKKIKEKDKENKFLCVLMSDWFNFHGHMCIAFELLGKNTFEFLKENNYPLPHVRHMAYQLCHALRFLHENQLTHTDLKPENILFVNSTSIRVADFGSATFDHEHHTTIVATRHYRPPEVILE-LGWAQPCDVWSIGCILFEYYRGFTLFQTHENREHLVMMEKILGPIPSHMIHRTRKQKSDGRYVKENCKPLKSYMLQDSLEHVQLFDLMRRMLEFDPAQRITLAEALLHPFFAGLTPEERSFHTSR.......................................... 351
75 -55.6003llt_A mol:protein length:360 Serine/threonine kinase-1, PfLammer  ali model follow..  22  27......................LNNAFLVIRKMGDGTFGRVLLCQHIDNKKYYAVKVVRN---IKKYTRSAKIEADILKKIQNDD----NNIVKYHGKFMYYDHMCLIFEPLGPSLYEIITRNNFHIEDIKLYCIEILKALNYLRKMSLTHTDLKPENILLDDSTGIKLIDFGCATFKSDYHGSIINTRQYRAPEVILN-LGWDVSSDMWSFGCVLAELYTGSLLFRTHEHMEHLAMMESIIQPIPKNMLYEATKTNGNASSINSIKHVKKCLPLYKIIKHELFCDFLYSILQIDPTLRPSPAELLKHKFLE....................................................... 354

FFAS is supported by the NIH grant R01-GM087218-01
6 2 0 4 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. FATCAT: a web server for flexible structure comparison and structure similarity searching. Nucleic Acids Res. 2004 Jul 1;32(Web Server issue):W582-5.