current user: public




Query: 1cm8_A mol:protein length:367 PHOSPHORYLATED MAP KINASE P38-GAMMA, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .
# Score Template Links and tools%idFirst MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPLLast
1 -130.0001cm8_A mol:protein length:367 PHOSPHORYLATED MAP KINASE P38-GAMMA  ali model  100  1MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL 367
2 -128.0003gcp_A mol:protein length:360 Mitogen-activated protein kinase 14  ali model follow..  60  1...GSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKSQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDSELKILDFGLCRHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSLESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES.... 360
3 -128.0004geo_A mol:protein length:367 Mitogen-activated protein kinase 14  ali model follow..  60  2...ASQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIAANWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDAADQLKLILRLVGTPGAELLKKISSESARNAIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES.... 361
4 -128.0002fsl_X mol:protein length:367 Mitogen-activated protein kinase 14  ali model follow..  60  2...ASQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTADEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSSESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES.... 361
5 -128.0003p4k_A mol:protein length:370 Mitogen-activated protein kinase 14  ali model follow..  61  3.AMMSQERPTFYRQELNKTIWEVPERYQNLAPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES.... 364
6 -128.0003gc8_A mol:protein length:370 Mitogen-activated protein kinase 11  ali model follow..  61  4MLEMSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDSELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLE... 367
7 -128.0001oz1_A mol:protein length:372 Mitogen-activated protein kinase 14  ali model follow..  61  5.GSMSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES.... 366
8 -127.0003e92_A mol:protein length:371 Mitogen-activated protein kinase 14  ali model follow..  60  9HHGMSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES.... 371
9 -126.0003dt1_A mol:protein length:383 Mitogen-activated protein kinase 14  ali model follow..  61  15MLEMSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES.... 377
10 -126.0003coi_A mol:protein length:353 Mitogen-activated protein kinase 13  ali model follow..  66  1.SLSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMG-LKFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQPFDDSLEHEKLTVDEWKQHIYKEIVNFSP.............. 352
11 -125.0004ewq_A mol:protein length:383 Mitogen-activated protein kinase 14  ali model follow..  61  15QSNASQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES.... 377
12 -125.0003oht_A mol:protein length:389 p38a  ali model follow..  61  21FTMSHKERPTFYRQELNKTIWEVPERYQTLSPVGSGAYGSVCSSYDVKSGLKIAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPATSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTGTPPASVISRMPSHEARNYINSLPQMPKRNFADVFIGANPLAVDLLEKMLVLDTDKRITASEALAHPYFSQYHDPDDEPESEPYDQSFESRQLEIEEWKRLTYEEVCSFETPPFDGDEMES.... 383
13 -125.0004myg_A mol:protein length:372 Mitogen-activated protein kinase 13  ali model follow..  65  13SHMSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMG-MEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQPFDDSLEHEKLTVDEWKQHIYKEIVNFSP.............. 365
14 -122.0004o6e_A mol:protein length:368 Mitogen-activated protein kinase 1  ali model follow..  40  1MGSSSSGLVPRGSHMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKI-SPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAP-TIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEPFKFDMELDDLPKEKLKELIFEETARFQPGYRS.......... 362
15 -122.0004i5h_A mol:protein length:359 Mitogen-activated protein kinase 1  ali model follow..  40  1...SNAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKI-SPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAP-TIEQMKDVYIVADLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKILDFGLARVADPFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEPFKFDMELDDLPKEKLKELIFEETARFQPGYRS.......... 359
16 -121.0003zu7_A mol:protein length:365 MITOGEN-ACTIVATED PROTEIN KINASE 1  ali model follow..  40  1...AAMAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKI-SPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAP-TIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEPFKFDMELDDLPKEKLKELIFEETARFQPGYRS.......... 359
17 -121.0004iz5_A mol:protein length:356 Mitogen-activated protein kinase 1  ali model follow..  40  2.......PGGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKI-SPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAP-TIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPFLEEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEPFKFDMELDDLPKEKLKELIFEETARFQPGYRS.......... 356
18 -121.0004h3q_A mol:protein length:362 Mitogen-activated protein kinase 1  ali model follow..  40  2.SMAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKI-SPFEHQTYCQRTLREIKILLAFRHENIIGINDIIRAP-TIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTSDLKICDFGLARVADPFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCGINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLAQYYDPSDEPIAEPFKFDMELDDLPKEKLKELIFEETARFQPGYRS.......... 362
19 -121.0004qp1_A mol:protein length:369 Mitogen-activated protein kinase 1  ali model follow..  41  3.SMAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKI-SPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAP-TIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEPFKFDMELDDLPKEKLKELIFEETARFQPGYRS.......... 363
20 -121.0001wzy_A mol:protein length:368 Mitogen-activated protein kinase 1  ali model follow..  40  8.LMAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKI-SPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAP-TIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEPFKFDMELDDLPKEKLKELIFEETARFQPGYRS.......... 368
21 -120.0001tvo_A mol:protein length:368 Mitogen-activated protein kinase 1  ali model follow..  40  2...AAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKI-SPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAP-TIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEPFKFDMELDDLPKEKLKELIFEETARFQPGYRSGDLGSDE... 367
22 -120.0001pme_A mol:protein length:380 ERK2  ali model follow..  41  14.HMAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKI-SPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAP-TIEQMKDVYLVTHLMGADLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEPFKFDMELDDLPKEKLKELIFEETARFQPGYRS.......... 374
23 -120.0002ojg_A mol:protein length:380 Mitogen-activated protein kinase 1  ali model follow..  40  13SHMAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKI-SPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAP-TIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEPFKFDMELDDLPKEKLKELIFEETARFQPGYRS.......... 374
24 -120.0002zoq_A mol:protein length:382 Mitogen-activated protein kinase 3  ali model follow..  40  20.TEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKI-SPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAS-TLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEPFTFAMELDDLPKERLKELIFQETARFQPGVLEA......... 381
25 -119.0002xrw_A mol:protein length:371 MITOGEN-ACTIVATED PROTEIN KINASE 8  ali model follow..  46  1MGSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ-MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTMMTPYVVTRYYRAPEVILGM-GYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQLGTPCPEFMKKL-QPTVRTYVENRPKYAGYSFEKLFPDVASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPPDKQLDEREHTIEEWKELIYKEVMDLE............... 365
26 -118.0003tti_A mol:protein length:464 Mitogen-activated protein kinase 10  ali model follow..  45  40..SKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQ-MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTMMTPYVVTRYYRAPEVILGM-GYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKL-QPTVRNYVENRPKYAGLTFPKLFPDSASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSP. 416
27 -118.0004l7f_A mol:protein length:367 Mitogen-activated protein kinase 8  ali model follow..  44  1.....SLDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ-MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTMMTPYVVTRYYRAPEVILGM-GYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKL-QPTVRTYVENRPKYAGYSFEKLFPDVASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPPDKQLDEREHTIEEWKELIYKEVMDWRKGIIT.......... 365
28 -118.0002g01_A mol:protein length:370 Mitogen-activated protein kinase 8  ali model follow..  44  2..SRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ-MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTMMEPEVVTRYYRAPEVILGM-GYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKL-QPTVRTYVENRPKYAGYSFEKLFPDVASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPPDKQLDEREHTIEEWKELIYKEVMDLE............... 364
29 -118.0004qny_A mol:protein length:354 Mitogen activated protein kinase, putative  ali model follow..  36  3.......PATKSLAELQAEVCRLDDRYLLERIIGAGSYGVVIRARDTKSDNRVAMKRVNKEFEEVILAKRILREIKLLAHFNDDNIIGLRNILTPE-DPENFDHFYIVMDIMETDLKQVLRSQELTEAHIQFFIYQALRALHIIHSAGVIHRDITPANILVNTNCDLKICDFGLAKEENDYMTDYVTMRWYRAPELVMEDKDYSAQIDVWGIGCILGELLGSRPLFQGKDRVNQLDKIVDVIGTPSEEDINSVGSSAAQKYLKKKSHRPQADWRQRYPTASPEALDLLRHMLVFNPKRRITVLQAMRHPFLEQLHDDADDNLSYALFRFDENEQKTIVDVKRAIYEESVKFHNE............. 354
30 -118.0003npc_A mol:protein length:364 Mitogen-activated protein kinase 9  ali model follow..  46  2..SKSKVDNQFYSVEVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH-MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTMMTPYVVTRYYRAPEVILGM-GYAANVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQLGTPSAEFMAAL-QPTVRNYVENRPKYPGIKFEELFPDKTSQARDLLSKMLVIDPDKRISVDEALRHPYITVWYDPAEAEAPQIYDAQLEEREHAIEEWKELIYKEVMDWE............... 364
31 -118.0003elj_A mol:protein length:369 Mitogen-activated protein kinase 8  ali model follow..  45  7..SRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ-MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTMMTPYVVTRYYRAPEVILGM-GYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKL-QPTVRTYVENRPKYAGYSFEKLFPDVASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPPDKQLDEREHTIEEWKELIYKEVMDLE............... 369
32 -118.0004ic7_A mol:protein length:442 Mitogen-activated protein kinase 7  ali model follow..  37  32.ASVAAKNLALLKARSFDVTFDVGDEYEIIETIGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDILRPTVPYGEFKSVYVVLDLMESDLHQIIHSQPLTLEHVRYFLYQLLRGLKYMHSAQVIHRDLKPSNLLVNENCELKIGDFGMARGLCTFMTEYVATRWYRAPELMLSLHEYTQAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQSLPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCPPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQP. 405
33 -118.0003vuh_A mol:protein length:370 Mitogen-activated protein kinase 8  ali model follow..  46  2..SRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLSQVIQ-MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDATLKILDFGLARTAGTMMTPYVVTRYYRAPEVILGM-GYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQLGTPSPEFMKKL-QPTVRTYVENRPKYAGYSFEKLFPDVASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPPDKQLDEREHTIEEWKELIYKEVMDLE............... 364
34 -118.0003vum_A mol:protein length:370 Mitogen-activated protein kinase 8  ali model follow..  45  2..SRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVVAAYDAILERNVAIKKLSRPFQNQTHAKRAYRELVLMKVVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLSQVIQ-MELDHERMSYLLYQMLVGIKHLHSAGIIHRDLKPSNIVVKSDATLKILDFGLARTAGTMMTPYVVTRYYRAPEVILGM-GYKENVDIWSVGVIMGEMIKGGVLFPGTDHIDQWNKVIEQLGTPSPEFMKKL-QPTVRTYVENRPKYAGYSFEKLFPDVASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPPDKQLDEREHTIEEWKELIYKEVMDLE............... 364
35 -118.0003e7o_A mol:protein length:360 Mitogen-activated protein kinase 9  ali model follow..  46  1...GSHMDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH-MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTASTMMTPYVVTRYYRAPEVILGM-GYKENVDIWSVGCIMGELVKGSVIFQGTDHIDQWNKVIEQLGTPSAEFMAAL-QPTVRNYVENRPAYPGIAFEELFPDKTSQARDLLSKMLVIDPDKRISVDEALRHPYITVWYDPAEAEAPQIYDAQLEEREHAIEEWKELIYKEVMD................. 360
36 -118.0002b9f_A mol:protein length:353 Mitogen-activated protein kinase FUS3  ali model follow..  38  3................KRIVYNISSDFQLKSLLGEGAYGVVCSATHKPTGEIVAIKKI-EPFDKPLFALRTLREIKILKHFKHENIITIFNIQRPD-SFENFNEVYIIQELMQTDLHRVISTQMLSDDHIQYFIYQTLRAVKVLHGSNVIHRDLKPSNLLINSNCDLKVCDFGLARIIDEGMTEYVATRWYRAPEVMLTSAKYSRAMDVWSCGCILAELFLRRPIFPGRDYRHQLLLIFGIIGTPHDNDLRCIESPRAREYIKSLPMYPAAPLEKMFPRVNPKGIDLLQRMLVFDPAKRITAKEALEHPYLQTYHDPNDEPEGEPFEFDHYKEALTTKDLKKLIWNEIFS................. 353
37 -117.0003pg1_A mol:protein length:362 Mitogen-activated protein kinase, putative (M  ali model follow..  35  3.....QAKGEAAMRDLIAELHAMQSPYTVQRFISSGSYGAVCAGVDS-EGIPVAIKRVFNILSDSFLCKRVLREIRLLNHFHHPNILGLRDIFVHF-EEPAMHKLYLVTELMRTDLAQVIHDQVISPQHIQYFMYHILLGLHVLHEAGVVHRDLHPGNILLADNNDITICDFNLAREDDANKTHYVTHRWYRAPELVMQFKGFTKLVDMWSAGCVMAEMFNRKALFRGSTFYNQLNKIVEVVGTPKIEDVVMFSSPSARDYLRSLSNVPARAWTAVVPTADPVALDLIAKMLEFNPQRRISTEQALRHPYFESLFDPLDLTEGLSERFHFDESVTDVYDMHKIFTAEVERFND.............. 362
38 -117.0003v3v_A mol:protein length:379 Mitogen-activated protein kinase 8  ali model follow..  45  2..SRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ-MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTMMTPEVVTRYYRAPEVILGM-GYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQLGTPCPEFMKKL-QPTVRTYVENRPKYAGYSFEKLFPDVASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPPDKQLDEREHTIEEWKELIYKEVMDLPKRPTT.......... 369
39 -117.0005awm_A mol:protein length:394 Stress-activated protein kinase JNK  ali model follow..  46  15.RTMTTAQHQHYTVEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQNVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQ-MDLDHDRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTMMTPYVVTRYYRAPEVILGM-GYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRL-QPTVRNYVENRPRYTGYSFDRLFPDKASDARNLLSKMLVIDPEQRISVDEALKHEYINVWYDAEEVDAPEPYDHSVDEREHTVEQWKELIYEEVMDYEAHNTNNRTR...... 388
40 -117.0004o2z_A mol:protein length:377 Mitogen-activated protein kinase 3, putative  ali model follow..  38  15ELSVPKIVGDFKVYNVSGSPFEVPSKYTLLKILGMGAYGIACSCLDGDTGEKVSIKKCRDVFRDVEDGKRVLREIDMMRFFHHENLLNVVNILPPLREYHSFEDVYVVTPLMDVDMNVVLRSQVLEESHMQYFVYQILRGLKYLHSANVAHRDLKPANLVTNISCELKIIDFGLSRSVDSELTDYVITRWYRPPELLLENTNYSTAVDIWSVGCIFAEMYNRKPVFPGRNTMDQLRMIAQHIGKPPASI---VEHREALEKLNELP-DGSLNIPKLVPGGNTEGIDFLSKMWTLDPSKRPTAADMLAHPYLAHLHDEEDEPTCPPFLWAHESTPMGVSELRRAFWADIVDYNP.............. 371
41 -117.0002xs0_A mol:protein length:386 MITOGEN-ACTIVATED PROTEIN KINASE 8  ali model follow..  44  4..SRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ-MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTMMVPFVVTRYYRAPEVILGM-GYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQLGTPCPEFMKKL-QPTVRTYVENRPKYAGYSFEKLFPDVASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPPDKQLDEREHTIEEWKELIYKEVMDLEERTKNGVIRGQPSPL 381
42 -117.0003fv8_A mol:protein length:355 Mitogen-activated protein kinase 10  ali model follow..  45  2..SKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQ-MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTMMTPYVVTRYYRAPEVILGM-GYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKL-QPTVRNYVENRPKYAGLTFPKLFPDSASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAXXXXX-------DEREHTIEEWKELIYKEVMNSE............... 355
43 -115.0003rp9_A mol:protein length:458 Mitogen-activated protein kinase  ali model follow..  36  29QRKQHHSSKPTASMPRPHSDWQIPDRYEIRHLIGTGSYGHVCEAYDKLEKRVVAIKKILRVFEDLIDCKRILREIAILNRLNHDHVVKVLDIVIPK-DVEKFDELYVVLEIADSDFKKLFRTVYLTELHIKTLLYNLLVGVKYVHSAGILHRDLKPANCLVNQDCSVKVCDFGLARTVDYQLTGHVVTRWYRAPELILLQENYTEAIDVWSIGCIFAELLNRGPLFPGSSCFDQLNVIFNILGTPSEEDIEALEKEDAKRYIRIFPKREGTDLAERFPASSADAIHLLKRMLVFNPNKRITINECLAHPFFKEVRIAEVETNATKVRLPFNDMNMDEPQLRYAFVKEIQRYHPEIQLPRRSPNRAS. 457
44 -115.0002i6l_A mol:protein length:320 Mitogen-activated protein kinase 6  ali model follow..  37  1..............SMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAIKKI--VLTDPQSVKHALREIKIIRRLDHDNIVKVFEILGPSGSLTELNSVYIVQEYMETDLANVLEQGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINEDLVLKIGDFGLARIMDPHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQMQLILESIPVVHEEDRQELLS-VIPVYIRNDMTEPHKPLTQLLPGISREAVDFLEQILTFSPMDRLTAEEALSHPYMSIYSFPMDEPI............................................. 320
45 -112.0003n9x_A mol:protein length:432 Phosphotransferase  ali model follow..  35  2......SSGRENLYFQGIKNVHVPDNYIIKHLIGRGSYGYVYLAYDKNTEKNVAIKKVNRMFEDLIDCKRILREITILNRLKSDYIIRLYDLIIPD-DLLKFDELYIVLEIADSDLKKLFKTIFLTEEHIKTILYNLLLGENFIHESGIIHRDLKPANCLLNQDCSVKVCDFGLARTINSQLTSHVVTRWYRAPELILLQENYTKSIDIWSTGCIFAELLNMFPLFPGKSNRDQLNIIFNIIGTPTEDDLKNINKPEVIKYIKLFPHRKPINLKQKYPSISDDGINLLESMLKFNPNKRITIDQALDHPYLKDVRKKKLENFSTKIILPFDDMVLSETQLRYIFLKEVQSFHPELVIPSVFTIHEN. 416
46 -111.0003nie_A mol:protein length:429 MAP2 kinase  ali model follow..  36  2....SSGRENLYFQGAIIKNVKVPDNYEIKHLIGRGSYGYVYLAYDKNANKNVAIKKVNRMFEDLIDCKRILREITILNRLKSDYIIRLHDLIIPE-DLLKFDELYIVLEIADSDLKKLFKTIFLTEQHVKTILYNLLLGEKFIHESGIIHRDLKPANCLLNQDCSVKICDFGLARTINSQLTSHVVTRWYRAPELILLQENYTNSIDIWSTGCIFAELLNMFPLFPGKSNRDQLNIIFNVIGTPPEEDLKCITKQEVIKYIKLFPTRDGIDLSKKYSSISKEGIDLLESMLRFNAQKRITIDKALSHPYLKDVRKENLENFSEKIILPFDDMVLSETQLRYIFLKEIQSFHADLIIPAKLNIHQK. 421
47 -107.0003oz6_A mol:protein length:388 Mitogen-activated protein kinase 1, serine/th  ali model follow..  34  2.................RVDRHVLRKYELVKKLGKGAYGIVWKSIDRRTGEVVAVKKIFDAFQNSTDAQRTFREIMILTELSHENIVNLLNVLRA----DNDRDVYLVFDYMETDLHAVIRANILEPVHKQYVVYQLIKVIKYLHSGGLLHRDMKPSNILLNAECHVKVADFGLSRSFVNILTDYVATRWYRAPEILLGSTKYTKGIDMWSLGCILGEILCGKPIFPGSSTMNQLERIIGVIDFPSNEDVESIQSPFAKTMIESLKEKVEIRQSNKRADCNEEALDLLDKLLQFNPNKRISANDALKHPFVSIFHNPNEEPNCDIITIPINDVKHSIDDYRNLVYSEISRRKRELISNKHQNVQN.. 388
48 -92.2003e3p_A mol:protein length:360 Protein kinase, putative Glycogen synthase ki  ali model follow..  28  1..GPGSMMSLNAAAAADERSRKEMDRFQVERMAGQGTFGTVQLGKEKSTGMSVAIKKV---IQDPRFRNRELQIMQDLAVLHHPNIVQLQSYFYTLGE-RDRRDIYVVMEYVPDTLHRCCRNVAPPPILIKVFLFQLIRSIGCLHSVNVCHRDIKPHNVLVNADGTLKLCDFGSAKKLSEPNVAYICSRYYRAPELIFGNQHYTTAVDIWSVGCIFAEMMLGEPIFRGDNSAGQLHEIVRVLGCPSREVLRKLNPSHTDVDLYNSKGIPSNVFSDHSLKDAKEAYDLLSALLQYLPEERMKPYEALCHPYFDELHDPATKLPNNKFRFLPNEIEVMSEAQKAKLVRK.................... 360
49 -90.6003eb0_A mol:protein length:383 Putative uncharacterized protein  ali model follow..  30  1..................GLETSSKKYSLGKTLGTGSFGIVCEVFDIESGKRFALKKVLQ------DPRYKNRELDIMKVLDHVNIIKLVDYFSVIVNPSQNKYLNVIMEYVPDTLHKVLKSRSIPMNLISIYIYQLFRAVGFIHSLGICHRDIKPQNLLVNSDNTLKLCDFGSAKKLSEPSVAYICSRFYRAPELMLGATEYTPSIDLWSIGCVFGELILGKPLFSGETSIDQLVRIIQIMGTPTKEQMIRMNPHYTE---VRFPTLKAKDWRKILPEGTPLAIDLLEQILRYEPDLRINPYEAMAHPFFDHLRNSYESEVKNNFNFSPYELSIPGNVLNRILPKNFSPNYKH............. 383
50 -89.5001o9u_A mol:protein length:350 GLYCOGEN SYNTHASE KINASE-3 BETA  ali model follow..  27  8............ATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKV------LQGKAFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPATVYRVARHQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTALKLCDFGSAKQLGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ---IREMNPNYTEFAFPQIKAHPWTKVFPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRFNFTTQELSSNPPLATILIPPHA................... 348
51 -88.1001gng_A mol:protein length:378 GLYCOGEN SYNTHASE KINASE-3 BETA  ali model follow..  26  5RDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKV------LQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTALKLCDFGSAKQLGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREM---NPNYTEFKFPQIKAHPWTKVFPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRFNFTTQELSSNPPLATILIPPHA................... 357
52 -87.8004dit_A mol:protein length:382 Glycogen synthase kinase-3 beta  ali model follow..  27  18..........VVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKV------LQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTALKLCDFGSAKQLGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREM---NPNYTEFKFPQIKAHPWTKVFPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRFNFTTQELSSNPPLATILI....................... 356
53 -87.0003u87_A mol:protein length:349 Casein kinase II subunit alpha  ali model follow..  28  21........REYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKIL-----KPVKKKKIKREIKILENLRGPNIITLADIVKDP---VSRTPALVFEHVNNTDFKQLY--QTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDEHRKLRLIDWGLAEFYHPEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKPFFHGHDNYDQLVRIAKVLGTEDYDYIDKYNIELDPRFNDILGRHSRKRWERFVHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYPVVKEQSQPCADAVLSSGLTAA................................. 348
54 -87.0003ofm_A mol:protein length:350 Casein kinase II subunit alpha`  ali model follow..  28  22........REYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKIL-----KPVKKKKIKREVKILENLRGTNIIKLIDTVKDP---VSKTPALVFEYINNTDFKQLY--QILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDQQKKLRLIDWGLAEFYHPEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRRPFFHGQDNYDQLVRIAKVLGTEEYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPSADAVLSSGLTAA................................. 349
55 -86.7004md8_E mol:protein length:391 Casein kinase II subunit alpha  ali model follow..  26  21........REYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKIL-----KPVKKKKIKREIKILENLRGPNIITLADIVKDP---VSRTPALVFEHVNNTDEKQLY--QTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDEHRKLRLIDWGLAEHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKPFFHGHDNYDQLVRIAKVLGTEDYDYIDKYNIELDPRFNDILGRHSRKRWERFVHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMP----GGSTPVSSANMMSGISSVPTPSPLGP.......... 366
56 -86.6004nm0_A mol:protein length:389 Glycogen synthase kinase-3 beta  ali model follow..  26  31.DKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQ------DKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTALKLCDFGSAKQLGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREM---NPNYTEFKFPQIKAHPWTKVFPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRFNFTTQELSSNPPLATILIPPHA................... 382
57 -86.4001r0e_A mol:protein length:391 Glycogen synthase kinase-3 beta  ali model follow..  25  2.AMSLSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKV------LQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTALKLCDFGSAKQLGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREM---NPNYTEFKFPQIKAHPWTKVFPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDA. 371
58 -86.2002zjw_A mol:protein length:340 Casein kinase II subunit alpha  ali model follow..  29  26........REYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKIL-----KPVKKKKIKREIKILENLRGPNIITLADIVKDP---VSRTPALVFEHVNNTDFKQLY--QTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDEHRKLRLIDWGLAEHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKPFFHGHDNYDQLVRIAKVLGTEDYDYIDKYNIELDPRFNDILGRHSRKRWERFVHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARM.............................................. 339
59 -85.8004md7_E mol:protein length:391 Casein kinase II subunit alpha  ali model follow..  26  21........REYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKIL-----KPVKKKKIKREIKILENLRGPNIITLADIVKDP---VSRTPALVFEHVNNTDFKQLY--QTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDEHRKLRLIDWGLAEFYHPEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKPFFHGHDNYDQLVRIAKVLGTEDYDYIDKYNIELDPRFNDILGRHSRKRWERFVHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSNMMSGISSVP-EPEPLGPLAGEPVIAAANPLGMPVPAAAGAQ. 390
60 -84.6003say_A mol:protein length:430 Glycogen synthase kinase-3 beta  ali model follow..  25  31.DKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKV------LQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTALKLCDFGSAKQLGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREM---NPNYTEFKFPQIKAHPWTKVFPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDA. 400
61 -84.3004ptc_A mol:protein length:441 Glycogen synthase kinase-3 beta  ali model follow..  25  46.DKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKV------LQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTALKLCDFGSAKQLGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREM---NPNYTEFKFPQIKAHPWTKVFPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDA. 415
62 -84.0003e3b_X mol:protein length:339 Casein kinase II subunit alpha`  ali model follow..  29  27........REYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKIL-----KPVKKKKIKREVKILENLRGTNIIKLIDTVKDP---VSKTPALVFEYINNTDFKQLY--QILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDQQKKLRLIDWGLAEHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRRPFFHGQDNYDQLVRIAKVLGTEEYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQ............................................... 339
63 -84.0002pvh_A mol:protein length:352 Casein kinase II subunit alpha  ali model follow..  27  30........KEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKIL-----KPVKKKKIKREIKILQNLCGPNIVKLLDIVRDQ----HSKTPSLIFEYVNNTDFKVLY-PTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELKLRLIDWGLAEHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKPFFYGHDNHDQLVKIAKVLGTDGNAYLNKYRIELDPQLEALVGRHSRKPWLKFMHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENSRTRA........................................... 346
64 -83.4004e7w_A mol:protein length:394 Glycogen Synthase Kinase 3  ali model follow..  29  37.....................QREIAYTNCKVIGNGSFGVVFQAKLVESDE-VAIKKV------LQDKRFKNRELQIMRIVKHPNVVDLKAFFYSNGDKKDEVFLNLVLEYVPETVYRASRHQTMPMLLIKLYMYQLLRSLAYIHSIGICHRDIKPQNLLLDPPSGLKLIDFGSAKILGEPNVSYICSRYYRAPELIFGATNYTTNIDIWSTGCVMAELMQGQPLFPGESGIDQLVEIIKVLGTPSREQIKTM---NPNYMEHKFPQIRPHPFSKVFPRTPPDAIDLISRLLEYTPSARLTAIEALCHPFFDELRTGEARELPPLFNWTKEELSVRPDLISRLVPQHAEAELLSRGIDVHNFQPIPL 386
65 -82.9005air_A mol:protein length:430 LOW-DENSITY LIPOPROTEIN RECEPTOR-RELATED PROT  ali model follow..  26  41.DKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKV------LQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTALKLCDFGSAKQLGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREM---NPNYTEFKFPQIKAHPWTKVFPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRFNFTTQELSSNPPLATILIPPHA................... 392
66 -81.4004acc_A mol:protein length:465 GLYCOGEN SYNTHASE KINASE-3 BETA  ali model follow..  26  64.DKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKV------LQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTALKLCDFGSAKQLGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREM---NPNYTEFKFPQIKAHPWTKVFPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRFNFTTQELSSNPPLATILIPPHA................... 415
67 -77.9004agu_A mol:protein length:311 CYCLIN-DEPENDENT KINASE-LIKE 1  ali model follow..  30  1......................MMEKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALREIRMLKQLKHPNLVNLLEVFRRK------RRLHLVFEYCDHTVLHELDRRGVPEHLVKSITWQTLQAVNFCHKHNCIHRDVKPENILITKHSVIKLCDFGFARLLTDYYDDEVATRWYRSPELLVGDTQYGPPVDVWAIGCVFAELLSGVPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSTNQYFSGVKIPDPEDMEPLELKFPNISYPALGLLKGCLHMDPTERLTCEQLLHHPYFENIREIED................................................ 296
68 -76.6004aaa_A mol:protein length:331 CYCLIN-DEPENDENT KINASE-LIKE 2  ali model follow..  31  19........................EKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMREIKLLKQLRHENLVNLLEVCKKK------KRWYLVFEFVDHTILDDLELNGLDYQVVQKYLFQIINGIGFCHSHNIIHRDIKPENILVSQSGVVKLCDFGFARTLAEVYDDEVATRWYRAPELLVGDVKYGKAVDVWAIGCLVTEMFMGEPLFPGDSDIDQLYHIMMCLGNLIPRHQELFNKNPVFAGVRLPEIKEREPLERRYPKLSEVVIDLAKKCLHIDPDKRPFCAELLHHDFFQM...................................................... 306
69 -75.2004bgq_A mol:protein length:304 CYCLIN-DEPENDENT KINASE-LIKE 5  ali model follow..  30  12........................NKFEILGVVGEGAYGVVLKCRHKETHEIVAIKKFKDSEENEEVKETTLRELKMLRTLKQENIVELKEAFRRR------GKLYLVFEYVEKNMLELLEENGVPPEKVKSYIYQLIKAIHWCHKNDIVHRDIKPENLLISHNDVLKLCDFGFARNNNANYDEEVATRWYRSPELLLG-APYGKSVDMWSVGCILGELSDGQPLFPGESEIDQLFTIQKVLGPLPSEQMKLFYSPRFHGLRFPAVNHPQSLERRYLGILNSVLLDLMKNLLKLDPADRYLTEQCLNHPTFQTQ..................................................... 301
70 -74.9003zdu_A mol:protein length:325 CYCLIN-DEPENDENT KINASE-LIKE 3  ali model follow..  30  3........................EMYETLGKVGEGSYGTVMKCKHKNTGQIVAIKIFYERPEQSV-NKIAMREIKFLKQFHHENLVNLIEVFRQK------KKIHLVFEFIDHTVLDELQHHGLESKRLRKYLFQILRAIDYLHSNNIIHRDIKPENILVSQSGITKLCDFGFARTLADIYDDEVATRWYRAPELVLKDTSYGKPVDIWALGCMIIEMATGNPYLPSSSDLDLLHKIVLKVGNLSPHLQNIFSKSPIFAGVVLPQVQHPKNARKKYPKLNGLLADIVHACLQIDPADRISSSDLLHHEYFTR...................................................... 289
71 -74.6001gii_A mol:protein length:298 CELL DIVISION PROTEIN KINASE 2  ali model follow..  36  2........................ENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTE------NKLYLVFEHVHQDLKTFMDATGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTS--MPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDV..................................................... 289
72 -74.3004eoi_A mol:protein length:299 Cyclin-dependent kinase 2  ali model follow..  36  3........................ENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTE------NKLYLVFEFLHQDLKDFMDATGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPENLLINTEGAIKLADFGLARAFGVPVRTYVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTS--MPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDV..................................................... 290
73 -74.3004y72_A mol:protein length:302 Cyclin-dependent kinase 1  ali model follow..  36  7........................EDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVSLQDVLMQD------SRLYLIFEFLSMDLKKYLDSQYMDSSLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVES--LQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKK............................................... 301
74 -74.0001vyw_A mol:protein length:309 CELL DIVISION PROTEIN KINASE 2  ali model follow..  36  7........................ENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTE------NKLYLVFEFLHQDLKKFMDATGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTS--MPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPH............................................... 300
75 -73.9004au8_A mol:protein length:296 CYCLIN-DEPENDENT KINASE 5  ali model follow..  35  6........................QKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSD------KKLTLVFEFCDQDLKKYFDSGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMT--KLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP.................................................. 296

FFAS is supported by the NIH grant R01-GM087218-01
8 2 9 8 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Grynberg M, Erlandsen H, Godzik A. HEPN: a common domain in bacterial drug resistance and human neurodegenerative proteins. Trends Biochem Sci. 2003 May;28(5):224-6. Review.