current user: public




Query: 1ahh_A mol:protein length:255 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .
# Score Template Links and tools%idFirst MFNSDNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQELNLast
1 -103.0001ahh_A mol:protein length:255 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model  100  1MFNSDNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQELN 255
2 -103.0003gaf_A mol:protein length:256 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  61  2MSYESPFHLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDLKSEGAEAVAAAIRQAGGKAIGLECNVTDEQHREAVIKAALDQFGKITVLVNNAGGGGPKPFDMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDALATVLTPEIERAMLKHTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGGGVQELD 256
3 -93.9002zat_A mol:protein length:260 Dehydrogenase/reductase SDR family member 4  ali model follow..  33  6..VERRKPLENKVALVTASTDGIGLAIARRLAQDGAHVVVSSRKQENVDRTVATLQGEGLSVTGTVCHVGKAEDRERLVAMAVNLHGGVDILVSNAAVNPFFIIDATEEVWDKILHVNVKATVLMTKAVVPEMEKRGGGSVLIVSSVGAYHPFPNLGPYNVSKTALLGLTKNLAVELAPRNIRVNCLAPGLIKTNFSQVLWDKARKEYMKESLRIRRLGNPEDCAGIVSFLCSEDASYITGETVVVGGGTASRL. 260
4 -93.8001zem_A mol:protein length:262 xylitol dehydrogenase  ali model follow..  32  2.....SKKFNGKVCLVTGAGGNIGLATALRLAEEGTAIALLDMNREALEKAEASVREKGVEARSYVCDVTSEEAVIGTVDSVVRDFGKIDFLFNNAGYQGAFVQDYPSDDFARVLTINVTGAFHVLKAVSRQMITQNYGRIVNTASMAGVKGPPNMAAYGTSKGAIIALTETAALDLAPYNIRVNAISPGYMGPGFMWERQPKVVAQQMIGSVPMRRYGDINEIPGVVAFLLGDDSSFMTGVNLPIAGG...... 262
5 -93.6003o4r_A mol:protein length:261 Dehydrogenase/reductase SDR family member 4  ali model follow..  32  7..MTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPSRL. 261
6 -93.3003lyl_A mol:protein length:247 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  30  1......MSLNEKVALVTGASRGIGFEVAHALASKGATVVGTATSQASAEKFENSMKEKGFKARGLVLNISDIESIQNFFAEIKAENLAIDILVNNAGITRDNLMRMSEDEWQSVINTNLSSIFRMSKECVRGMMKKRWGRIISIGSVVGSAGNPGQTNYCAAKAGVIGFSKSLAYEVASRNITVNVVAPGFIATDMTDK-LTDEQKSFIATKIPSGQIGEPKDIAAAVAFLASEEAKYITGQTLHVNGGMYM... 246
7 -92.9002ew8_A mol:protein length:249 (S)-1-Phenylethanol dehydrogenase  ali model follow..  35  2.....TQRLKDKLAVITGGANGIGRAIAERFAVEGADIAIADLVP--APEAEAAIRNLGRRVLTVKCDVSQPGDVEAFGKQVISTFGRCDILVNNAGIYPLIPFELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGRIINLTSTTYWLKIEAYTHYISTKAANIGFTRALASDLGKDGITVNAIAPSLVRTATTEASALSAMFDVLPNMLAIPRLQVPLDLTGAAAFLASDDASFITGQTLAVDGGMVRH.. 249
8 -92.6004dqx_A mol:protein length:277 Probable oxidoreductase protein  ali model follow..  37  16.....SMDLNQRVCIVTGGGSGIGRATAELFAKNGAYVVVADVNEDAAVRVANEI---GSKAFGVRVDVSSAKDAESMVEKTTAKWGRVDVLVNNAGFGTTGNVTIPEETWDRIMSVNVKGIFLCSKYVIPVMRRNGGGSIINTTSYTATSAIADRTAYVASKGAISSLTRAMAMDHAKEGIRVNAVAPGTIDSPYFTKIFPAKLRSDFNARAVMDRMGTAEEIAEAMLFLASDRSRFATGSILTVDGGSSI... 265
9 -92.5003qiv_A mol:protein length:253 short-chain dehydrogenase or 3-oxoacyl-[acyl-  ali model follow..  34  4.....SMRFENKVGIVTGSGGGIGQAYAEALAREGAAVVVADINAEAAEAVAKQIVADGGTAISVAVDVSDPESAKAMADRTLAEFGGIDYLVNNAAIFGGMLLTIDPEYYKKFMSVNLDGALWCTRAVYKKMTKRGGGAIVNQSSTAA---WLYSNYYGLAKVGINGLTQQLSRELGGRNIRINAIAPGPIDTEANRTTTPKEMVDDIVKGLPLSRMGTPDDLVGMCLFLLSDEASWITGQIFNVDGGQIIR.. 252
10 -92.3002cfc_A mol:protein length:250 2-(R)-HYDROXYPROPYL-COM DEHYDROGENASE  ali model follow..  28  2..........SRVAIVTGASSGNGLAIATRFLARGDRVAALDLSAETLEETARTWHAYADKVLRVRADVADEGDVNAAIAATMEQFGAIDVLVNNAGITGNSLHTTPVEQFDKVMAVNVRGIFLGCRAVLPHMLLQGAGVIVNIASVASLVAFPGRSAYTTSKGAVLQLTKSVAVDYAGSGIRCNAVCPGMIETPMTQWRLQPELRDQVLARIPQKEIGTAAQVADAVMFLAGEDATYVNGAALVMDGAYTA... 249
11 -92.3003ndr_A mol:protein length:247 3-oxoacyl-(Acyl-carrier protein) reductase  ali model follow..  33  3.......RLAGKTALVTGAAQGIGKAIAARLAADGATVIVSDINAEGAKAAAASI---GKKARAIAADISDPGSVKALFAEIQALTGGIDILVNNASIVPFVAWDVDLDHWRKIIDVNLTGTFIVTRAGTDQMRAAGAGRVISIASNTFFAGTPNMAAYVAAKGGVIGFTRALATELGKYNITANAVTPGLIESDGVKASPHNEAFGFVEMLQAMKGKGQPEHIADVVSFLASDDARWITGQTLNVDAGMVRH.. 247
12 -92.0001i01_A mol:protein length:244 BETA-KETOACYL [ACP] REDUCTASE  ali model follow..  32  1......MNFEGKIALVTGASRGIGRAIAETLAARGAKVIGTATSENGAQAISDYL---GANGKGLMLNVTDPASIESVLEKIRAEFGEVDILVNNAGITRDNLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVGTMGNGGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRA-LSDDQRAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGMYM... 243
13 -92.0003rro_A mol:protein length:251 3-ketoacyl-(acyl-carrier-protein) reductase  ali model follow..  33  4..MSQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYL---GDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKA-LNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYM... 250
14 -91.9001xq1_A mol:protein length:266 PUTATIVE TROPINONE REDUCATSE  ali model follow..  32  4AEQSQRWSLKAKTVLVTGGTKGIGHAIVEEFAGFGAVIHTCARNEYELNECLSKWQKKGFQVTGSVCDASLRPEREKLMQTVSSMFGKLDILINNLGAIRSKPLDYTAEDFSFHISTNLESAYHLSQLAHPLLKASGCGNIIFMSSIAGVVSASVGSIYSATKGALNQLARNLACEWASDGIRANAVAPAVIATPLAEAVYDDEFKKVVISRKPLGRFGEPEEVSSLVAFLCMPAASYITGQTICVDGGLTVN.. 258
15 -91.8003gvc_A mol:protein length:277 Probable short-chain type dehydrogenase/reduc  ali model follow..  31  15..SMNHPDLAGKVAIVTGAGAGIGLAVARRLADEGCHVLCADIDGDAADAAATKI---GCGAAACRVDVSDEQQIIAMVDACVAAFGGVDKLVANAGVVHLASLDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERGGGAIVNLSSLAGQVAVGGTGAYGMSKAGIIQLSRITAAELRSSGIRSNTLLPAFVDTPMQQTAMAGAGGARSMIARLQGRMAAPEEMAGIVVFLLSDDASMITGTTQIADGGTIAAL. 270
16 -91.5003oic_A mol:protein length:258 Enoyl-[acyl-carrier-protein] reductase [NADPH  ali model follow..  30  2........EQNKCALVTGSSRGVGKAAAIRLAENGYNIVINYASKKAALETAEEIEKLGVKVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAASGVLRPVELEETHWDWTMNINAKALLFCAQEAAKLMEKNGGGHIVSISSLGSIRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDALKHF-REDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSKADMIRGQTIIVDGGRSLLV. 250
17 -91.5003awd_A mol:protein length:260 Putative polyol dehydrogenase  ali model follow..  29  4.MYMEKLRLDNRVAIVTGGAQNIGLACVTALAEAGARVIIADLDEAMATKAVEDLRMEGHDVSSVVMDVTNTESVQNAVRSVHEQEGRVDILVACAGICISEAEDMTDGQWLKQVDINLNGMFRSCQAVGRIMLEQKQGVIVAIGSMSGLIVNQQQAAYNASKAGVHQYIRSLAAEWAPHGIRANAVAPTYIETTLTRFGMEPELYDAWIAGTPMGRVGQPDEVASVVQFLASDAASLMTGAIVNVDAGFTV... 259
18 -91.1001iy8_A mol:protein length:267 LEVODIONE REDUCTASE  ali model follow..  25  8.....TTRFTDRVVLITGGGSGLGRATAVRLAAEGAKLSLVDVSSEGLEASKAAVLETAAEVLTTVADVSDEAQVEAYVTATTERFGRIDGFFNNAGIEGKQTESFTAAEFDKVVSINLRGVFLGLEKVLKIMREQGSGMVVNTASVGGIRGIGNQSGYAAAKHGVVGLTRNSAVEYGRYGIRINAIAPGAIWTPMVENSMPRKAAEEFIQVNPSKRYGEAPEIAAVVAFLLSDDASYVNATVVPIDGGQSA... 265
19 -91.0003enn_A mol:protein length:249 GLUCOSE/RIBITOL DEHYDROGENASE  ali model follow..  29  5.....MFDLTGRKALVTGATGGLGEAIARALHAQGAIVGLHGTREEKLKELAAEL---GERIFVFPANLSDREAVKALGQKAEEEMGGVDILVNNAGITRDGLVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMRRRNGRIINITSIVGVTGNPGQANYCASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIESAMTGK-LNEKQKDAIMGNIPMKRMGVGADIAAAVVYLASDEAAYVTGQTLHVNGGMAM... 248
20 -91.0003ftp_A mol:protein length:270 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  32  17.....DKTLDKQVAIVTGASRGIGRAIALELARRGAMVIGTATTEAGAEGIGAAFKQAGLEGRGAVLNVNDATAVDALVESTLKEFGALNVLVNNAGITQDQLMRMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKARGGRIVNITSVVGSAGNPGQVNYAAAKAGVAGMTRALAREIGSRGITVNCVAPGFIDTDMTKG-LPQEQQTALKTQIPLGRLGSPEDIAHAVAFLASPQAGYITGTTLHVNGGMFMS.. 264
21 -90.9003VM3 Entity 1(prereleased)  ali follow..  32  4.MTQQRWRLDGQTALITGASAGIGLAIAHELAGFGADLMIVGRDIDMLETARDELLDVQMQVHALAADVSDDEDRRQILDWVEDHSDGLHILVNNAGGNVTKAAEYSEDEWRKIFETNLFSAFELSRYAHPLLARHASSSIVNVGSVSGLTHVRSGVVYGMSKAAMHQMTRNLAVEWAEDGIRVNAVAPWYIRTRRTSGPLDPDYYEEVINRTPMRRIGEPEEVAAAVGFLCLPAASYVTGECIAVDGGFLRY.. 259
22 -90.9001rwb_A mol:protein length:261 Glucose 1-dehydrogenase  ali model follow..  33  2.....YKDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLENPVSSEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTKTLALEYAPKGIRVNNIGPGAINTPINAEKFDPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMTL... 252
23 -90.9001g6k_A mol:protein length:261 GLUCOSE 1-DEHYDROGENASE  ali model follow..  34  2.....YKDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLANPVSSEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKFDPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMTQ... 252
24 -90.8003AY6 Entity 1(prereleased)  ali follow..  28  4.....YTDLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNEEEALDAKKEVEEAGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDKGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKFDPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQASYVTGITLFADGGMTK... 254
25 -90.8002d1y_A mol:protein length:256 hypothetical protein TT0321  ali model follow..  34  1.....MGLFAGKGVLVTGGARGIGRAIAQAFAREGALVALCDLRPEGKEVAE------AIGGAFFQVDLEDERERVRFVEEAAYALGRVDVLVNNAAIAAPGSATVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASVQGLFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAIPERTRRDWEDLHALRRLGKPEEVAEAVLFLASEKASFITGAILPVDGGMTASF. 249
26 -90.8003aus_A mol:protein length:269 Glucose 1-dehydrogenase 4  ali model follow..  28  4.....YTDLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNEEEALDAKKEVEEAGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDKGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKFDPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQASYVTGITLFADGGMTK... 254
27 -90.8003sju_A mol:protein length:279 Keto reductase  ali model follow..  26  8LVPRGSHMSRPQTAFVTGVSSGIGLAVARTLAARGIAVYGCARDAKNVSAAVDGLRAAGHDVDGSSCDVTSTDEVHAAVAAAVERFGPIGILVNSAGRNGGGETDLDDALWADVLDTNLTGVFRVTREVLRAMREAGWGRIVNIASTGGKQGVMYAAPYTASKHGVVGFTKSVGFELAKTGITVNAVCPGYVETPMAERVTEQEVHERFNAKIPLGRYSTPEEVAGLVGYLVTDAAASITAQALNVCGGLGN... 272
28 -90.7002hq1_A mol:protein length:247 Glucose/ribitol dehydrogenase  ali model follow..  29  1......MQLKGKTAIVTGSSRGLGKAIAWKLGNMGANIVLNGSASTSLDATAEEFKAAGINVVVAKGDVKNPEDVENMVKTAMDAFGRIDILVNNAGITRDTLLKMSEKDWDDVLNTNLKSAYLCTKAVSKIMLKQKSGKIINITSIAGIIGNAGQANYAASKAGLIGFTKSIAKEFAAKGIYCNAVAPGIIKTDMTDV-LPDKVKEMYLNNIPLKRFGTPEEVANVVGFLASDDSNYITGQVINIDGGLVM... 247
29 -90.5002uvd_A mol:protein length:246 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE  ali model follow..  36  2........LKGKVALVTGASRGIGRAIAIDLAKQGANVVVNYANEQKANEVVDEIKKLGSDAIAVRADVANAEDVTNMVKQTVDVFGQVDILVNNAGVTKDNLMRMKEEEWDTVINTNLKGVFLCTKAVSRFMMRQRHGRIVNIASVVGVTGNPGQANYVAAKAGVIGLTKTSAKELASRNITVNAIAPGFIATDMTDV-LDENIKAEMLKLIPAAQFGEAQDIANAVTFFASDQSKYITGQTLNVDGGMVM... 246
30 -90.5001k2w_A mol:protein length:256 SORBITOL DEHYDROGENASE  ali model follow..  31  1......MRLDGKTALITGSARGIGRAFAEAYVREGARVAIADINLEAARATAAEI---GPAACAIALDVTDQASIDRCVAELLDRWGSIDILVNNAALFDLAPIEITRESYDRLFAINVSGTLFMMQAVARAMIAGGGGKIINMASQAGRRGEALVGVYCATKAAVISLTQSAGLNLIRHGINVNAIAPGVVDGEHWDGV-RGEKKRQVGAAVPFGRMGRAEDLTGMAIFLATPEADYIVAQTYNVDGGNWMS.. 256
31 -90.5003sj7_A mol:protein length:252 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  31  2........SMTKSALVTGASRGIGRSIALQLAEEGYNVAVNYASKEKAEAVVEEIKAKGVDSFAIQANVADADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDA-LSDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGMYM... 246
32 -90.5003tox_A mol:protein length:280 Short chain dehydrogenase  ali model follow..  34  3.....MSRLEGKIAIVTGASSGIGRAAALLFAREGAKVVVTARNGNALAELTDEIAGGGGEAAALAGDVGDEALHEALVELAVRRFGGLDTAFNNAGALGAMISSLSVEGWRETLDTNLTSAFLAAKYQVPAIAALGGGSLTFTSSFVGHTGFAGVAPYAASKAGLIGLVQALAVELGARGIRVNALLPGGTDTPANFANLAPETRGFVEGLHALKRIARPEEIAEAALYLASDGASFVTGAALLADGGASV... 255
33 -90.4001nxq_A mol:protein length:251 R-alcohol dehydrogenase  ali model follow..  29  3.......RLDGKVAIITGGTLGIGLAIATKFVEEGAKVMITGRHSDVGEKAAKSVGT-PDQIQFFQHDSSDEDGWTKLFDATEKAFGPVSTLVNNAGIAVNKSVETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGGASIINMSSIEGFVGDPSLGAYNASKGAVRIMSKSAALDCALKDVRVNTVHPGYIKTPLVDDLPGAEEAMSQRTKTPMGHIGEPNDIAYICVYLASNESKFATGSEFVVDGGYTAQ.. 251
34 -90.4001ae1_A mol:protein length:273 TROPINONE REDUCTASE-I  ali model follow..  30  11CNNEGRWSLKGTTALVTGGSKGIGYAIVEELAGLGARVYTCSRNEKELDECLEIWREKGLNVEGSVCDLLSRTERDKLMQTVAHVFGKLNILVNNAGVVIHKEADFTEKDYNIIMGTNFEAAYHLSQIAYPLLKASQNGNVIFLSSIAGFSALPSVSLYSASKGAINQMTKSLACEWAKDNIRVNSVAPGVILTPLVETAIQKEEIDNFIVKTPMGRAGKPQEVSALIAFLCFPAASYITGQIIWADGGFTAN.. 270
35 -90.3003o38_A mol:protein length:266 Short chain dehydrogenase  ali model follow..  28  19.......LLKGKVVLVTAAATGIGSTTARRALLEGADVVISDYHERRLGETRDQLADLGGRVEAVVCDVTSTEAVDALITQTVEKAGRLDVLVNNAGLGGQTPVDMTDEEWDRVLNVTLTSVMRATRAALRYFRGVDGGVIVNNASVLGWRAQHSQSHYAAAKAGVMALTRCSAIEAVEFGVRINAVSPSIARHKFLEKTSSSELLDRLASDEAFGRAAEPWEVAATIAFLASDYSSYMTGEVVSVSSQRA.... 266
36 -90.3003gk3_A mol:protein length:269 Acetoacetyl-CoA reductase  ali model follow..  26  14.....GSMQAKRVAFVTGGMGGLGAAISRRLHDAGMAVAVSHSRNDHVSTWLMHERDAGRDFKAYAVDVADFESCERCAEKVLADFGKVDVLINNAGITRDATFKMTKGDWDAVMRTDLDAMFNVTKQFIAGMVERRFGRIVNIGSVNGSRGAFGQANYASAKAGIHGFTKTLALETAKRGITVNTVSPGYLATAMVEAVPQDVLEAKILPQIPVGRLGRPDEVAALIAFLCSDDAGFVTGADLAINGGMHMS.. 263
37 -90.3002p68_A mol:protein length:248 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  30  2.....EIKLQGKVSLVTGSTRGIGRAIAEKLASAGSTVIITGTSGERKAVAEEIANKYGVKAHGVEMNLLSEESINKAFEEIYNLVDGIDILVNNAGITRDKLLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQRWGRIVNISSVVGFTGNVGQVNYSTTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDMTAV-LSEEIKQKYKEQIPLGRFGSPEEVANVVLFLCSELASYITGEVIHVNGGMF.... 248
38 -90.2002ae1_A mol:protein length:260 TROPINONE REDUCTASE-II  ali model follow..  33  1..MAGRWNLEGCTALVTGGSRGIGYGIVEELASLGASVYTCSRNQKELNDCLTQWRSKGFKVEASVCDLSSRSERQELMNTVANHFGKLNILVNNAGIVIYKEADYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGNVVFISSVSGALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSLVEMTIQDENLNKLIDRCALRRMGEPKELAAMVAFLCFPAASYVTGQIIYVDGGLMAN.. 257
39 -90.2003v8b_A mol:protein length:283 Putative dehydrogenase, possibly 3-oxoacyl-[a  ali model follow..  29  12LYFQSMMNQPSPVALITGAGSGIGRATALALAADGVTVGALGRTRTEVEEVADEIVGAGGQAIALEADVSDELQMRNAVRDLVLKFGHLDIVVANAGINGVWIDDLKPFEWDETIAVNLRGTFLTLHLTVPYLKQRGGGAIVVVSSINGTFTTPGATAYTATKAAQVAIVQQLALELGKHHIRVNAVCPGAIETNISDNTKLRHEEEKGQVPITDGQPGRSEDVAELIRFLVSERARHVTGSPVWIDGGQGL... 275
40 -90.1001w4z_A mol:protein length:281 KETOACYL REDUCTASE  ali model follow..  29  13...SHMATQDSEVALVTGATSGIGLEIARRLGKEGLRVFVCARGEEGLRTTLKELREAGVEADGRTCDVRSVPEIEALVAAVVERYGPVDVLVNNAGRPGGGATELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVSTEEAFDRITARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGGLGN... 274
41 -90.1004DBZ Entity 1(prereleased)  ali follow..  29  13...SHMATQDSEVALVTGATSGIGLEIARRLGKEGLRVFVCARGEEGLRTTLKELREAGVEADGRTCDVRSVPEIEALVAAVVERYGPVDVLVNNAGRPGGGATELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGGKQGLVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVSTEEAFDRITARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGGLGN... 274
42 -90.0002q2q_A mol:protein length:255 Beta-D-hydroxybutyrate dehydrogenase  ali model follow..  29  1.......TLKGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDP--APALAEIARHGVKAVHHPADLSDVAQIEALFALAEREFGGVDILVNNAGIQHVAPVQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGWLAQ.. 255
43 -90.0001uls_A mol:protein length:245 putative 3-oxoacyl-acyl carrier protein reduc  ali model follow..  30  1......MRLKDKAVLITGAAHGIGRATLELFAKEGARLVACDIEEGPLREAAEAV-----GAHPVVMDVADPASVERGFAEALAHLGRLDGVVHYAGITRDNFHKMPLEDWELVLRVNLTGSFLVAKAASEAMREKNPGSIVLTASRVYL-GNLGQANYAASMAGVVGLTRTLALELGRWGIRVNTLAPGFIETRMTAK-VPEKVREKAIAATPLGRAGKPLEVAYAALFLLSDESSFITGQVLFVDGGRTI... 240
44 -90.0003lf1_A mol:protein length:265 Short Chain Oxidoreductase Q9HYA2  ali model follow..  28  1...MKPYDLSEAVAVVTGGSSGIGLATVELLLEAGAAVAFCARDGERLRAAESALRQRGARLFASVCDVLDALQVRAFAEACERTLGCASILVNNAGQGRVSTFETTDEAWSEELQLKFFSVIHPVRAFLPQLESRADAAIVCVNSLLASQPEPHMVATSAARAGVKNLVRSMAFEFAPKGVRVNGILIGLVESGQWRRRFEAREERARNKQIPLGRLGKPIEAARAILFLASPLSAYTTGSHIDVSGGLSRH.. 264
45 -90.0003uxy_A mol:protein length:266 Short-chain dehydrogenase/reductase SDR  ali model follow..  26  12LYFQSMQGFEGKVALVTGAAGGIGGAVVTALRAAGARVAVADRAVAG-----------IAADLHLPGDLREAAYADGLPGAVAAGLGRLDIVVNNAGVISRGRIETTDADWSLSLGVNVEAPFRICRAAIPLMAAAGGGAIVNVASCWGLRPGPGHALYCLTKAALASLTQCMGMDHAPQGIRINAVCPNEVNTPMLRTGFPDRAVAELGRTVPLGRIAEPEDIADVVLFLASDAARYLCGSLVEVNGGKAVA.. 260
46 -89.9003ak4_A mol:protein length:263 NADH-dependent quinuclidinone reductase  ali model follow..  29  4..MAGIFDLSGRKAIVTGGSKGIGAAIARALDKAGATVAIADLDVMAAQAVVAGL---ENGGFAVEVDVTKRASVDAAMQKAIDALGGFDLLCANAGVSTMRPADITDEEWDFNFDVNARGVFLANQIACRHFLASNKGVIVNTASLAAKVGAPLLAHYSASKFAVFGWTQALAREMAPKNIRVNCVCPGFVKTAMQERMTPEAVRAEYVSLTPLGRIEEPEDVADVVVFLASDAARFMTGQGINVTGGVRMD.. 263
47 -89.9001geg_A mol:protein length:256 ACETOIN REDUCTASE  ali model follow..  32  2..........KKVALVTGAGQGIGKAIALRLVKDGFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQVFAAVEQARKTLGGFDVIVNNAGVAPSTPISITPEIVDKVYNINVKGVIWGIQAAVEAFKKEGGGKIINACSQAGHVGNPELAVYSSSKFAVRGLTQTAARDLAPLGITVNGYCPGIVKTPMWAEIDRQYGTAEFAKRITLGRLSEPEDVAACVSYLASPDSDYMTGQSLLIDGGMVFN.. 256
48 -89.8003pk0_A mol:protein length:262 Short-chain dehydrogenase/reductase SDR  ali model follow..  29  4....SMFDLQGRSVVVTGGTKGIGRGIATVFARAGANVAVAGRSTADIDACVADLQLGSGKVIGVQTDVSDRAQCDALAGRAVEEFGGIDVVCANAGVFPDAPLTMTPEQLNGIFAVNVNGTFYAVQACLDALIASGSGRVVLTSSITGITGYPGWSHYGATKAAQLGFMRTAAIELAPHKITVNAIMPGNIMTEGLLE-NGEEYIASMARSIPAGALGTPEDIGHLAAFLATKEAGYITGQAIAVDGGQVL... 253
49 -89.8003cxr_A mol:protein length:291 Dehydrogenase with different specificities  ali model follow..  36  19.FSLDQFSLKGKIALVTGASYGIGFAIASAYAKAGATIVFNDINQELVDRGMAAYKAAGINAHGYVCDVTDEDGIQAMVAQIESEVGIIDILVNNAGIIRRVPMEMTAAQFRQVIDIDLNAPFIVSKAVIPSMIKKGHGKIINICSMMSELGRETVSAYAAAKGGLKMLTKNIASEYGEANIQCNGIGPGYIATPQTAPLRELPFDQFIIAKTPAARWGEAEDLMGPAVFLASDASNFVNGHILYVDGGILAYI. 279
50 -89.6003grp_A mol:protein length:266 3-oxoacyl-(Acyl carrierprotein) reductase  ali model follow..  27  16.....MFKLTGRKALVTGATGGIGEAIARCFHAQGAIVGLHGTREDKLKEIAADL---GKDVFVFSANLSDRKSIKQLAEVAEREMEGIDILVNNAGITRDGLVRMQDQDWDDVLAVNLTAASTLTRELIHSMMRRRYGRIINITSIVGVVGNPGQTNYCAAKAGLIGFSKALAQEIASRNITVNCIAPGFIKSAMTDK-LNEKQKEAIMAMIPMKRMGIGEEIAFATVYLASDEAAYLTGQTLHINGGMAM... 259
51 -89.6003n74_A mol:protein length:261 3-ketoacyl-(acyl-carrier-protein) reductase  ali model follow..  37  4.....SMSLEGKVALITGAGSGFGEGMAKRFAKGGAKVVIVDRDKAGAERVAGEI---GDAALAVAADISKEADVDAAVEAALSKFGKVDILVNNAGIGHKPQNLVEPEEFDRIVGVNVRGVYLMTSKLIPHFKENGACVILNVASTGAGRPRPNLAWYNATKGWVVSVTKALAIELAPAKIRVVALNPVAGETPLLTTFMSEEIRKKFRDSIPMGRLLKPDDLAEAAAFLCSPQASMITGVALDVDGGRSI... 256
52 -89.5001hdc_A mol:protein length:254 3-ALPHA, 20 BETA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  32  2.......DLSGKTVIITGGARGLGAEAARQAVAAGARVVLADVLDEEGAATAREL---GDAARYQHLDVTIEEDWQRVVAYAREEFGSVDGLVNNAGISTGMFLTESVERFRKVVEINLTGVFIGMKTVIPAMKDAGGGSIVNISSAAGLMGLALTSSYGASKWGVRGLSKLAAVELGTDRIRVNSVHPGMTYTPMTAE-TGIRQGEGNYPNTPMGRVGEPGEIAGAVVKLLSDTSSYVTGAELAVDGGWTT... 244
53 -89.3003ucx_A mol:protein length:264 Short chain dehydrogenase  ali model follow..  28  8.......LLTDKVVVISGVGPALGTTLARRCAEQGADLVLAARTVERLEDVAKQVTDTGRRALSVGTDITDDAQVAHLVDETMKAYGRVDVVINNAFRSMKPFANTTFEHMRDAIELTVFGALRLIQGFTPAL-EESKGAVVNVNSMVVRHSQAKYGAYKMAKSALLAMSQTLATELGEKGIRVNSVLPGYIWGGTLKSYFEEDIYNAAAAGSDLKRLPTEDEVASAILFMASDLASGITGQALDVNCGEYKA.. 264
54 -89.0003r1i_A mol:protein length:276 Short-chain type dehydrogenase/reductase  ali model follow..  36  16MSVLDLFDLSGKRALITGASTGIGKKVALAYAEAGAQVAVAARHSDALQVVADEIAGVGGKALPIRCDVTQPDQVRGMLDQMTGELGGIDIAVCNAGIVSVQALDMPLEEFQRIQDTNVTGVFLTAQAAARAMVDQGGGTIITTASMSGHIINIPQSHYCTSKAAVVHLTKAMAVELAPHQIRVNSVSPGYIRTELVEPL--ADYHALWEPKIPLGRMGRPEELTGLYLYLASAASSYMTGSDIVIDGGYTC... 269
55 -88.9001nff_A mol:protein length:260 Putative oxidoreductase Rv2002  ali model follow..  28  2.....SGRLTGKVALVSGGARGMGASHVRAMVAEGAKVVFGDILDEEGKAMAAEL---ADAARYVHLDVTQPAQWKAAVDTAVTAFGGLHVLVNNAGILNIGTIDYALTEWQRILDVNLTGVFLGIRAVVKPMKEAGRGSIINISSIEGLAGTVACHGYTATKFAVRGLTKSTALELGPSGIRVNSIHPGLVKTPMTDWVPED------IFQTALGRAAEPVEVSNLVVYLASDESSYSTGAEFVVDGGTVA... 240
56 -88.9003ai1_A mol:protein length:263 NADPH-sorbose reductase  ali model follow..  30  3......MGISGKVAVITGSSSGIGLAIAEGFAKEGAHIVLVARQVDRLHEAARSLKEKGVRVLEVAVDVATPEGVDAVVESVRSSFGGADILVNNAGTGSNETIEAADEKWQFYWELHVMAAVRLARGLVPGMRARGGGAIIHNASICAVQPLWYEPIYNVTKAALMMFSKTLATEVIKDNIRVNCINPGLILTPDWIKTAKGYLQSVADEHAPIKRFASPEELANFFVFLCSERATYSVGSAYFVDGGMLKTL. 263
57 -88.9003ezl_A mol:protein length:256 Acetoacetyl-CoA reductase  ali model follow..  26  2.....AMVMSQRIAYVTGGMGGIGTSICQRLHKDGFRVVAGCGNSPRRVKWLEDQKALGFDFYASEGNVGDWDSTKQAFDKVKAEVGEIDVLVNNAGITRDVVFKMTREDWQAVIDTNLTSLFNVTKQVIDGMVERGWGRIINISSVNGQKGQFGQTNYSTAKAGIHGFTMSLAQEVATKGVTVNTVSPGYIGTDMVKA-IRPDVLEKIVATIPVRRLGSPDEIGSIVAWLASEESGFSTGADFSLNGGLHM... 249
58 -88.8003tzq_B mol:protein length:271 Short-chain type dehydrogenase/reductase  ali model follow..  31  6.....TAELENKVAIITGACGGIGLETSRVLARAGARVVLADLPETDLAGAAASV---GRGAVHHVVDLTNEVSVRALIDFTIDTFGRLDIVDNNAAHSDPAVTQMTVDVWDDTFTVNARGTMLMCKYAIPRLISAGGGAIVNISSATAHAAYDMSTAYACTKAAIETLTRYVATQYGRHGVRCNAIAPGLVRTPRLEVGLPQPIVDIFATHHLAGRIGEPHEIAELVCFLASDRAAFITGQVIAADSGLLAHL. 254
59 -88.7004dml_A mol:protein length:269 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  34  17.....ALPLTDRIALVTGASRGIGRAIALELAAAGAKVAVNYASAGAADEVVAAIAAAGGEAFAVKADVSQESEVEALFAAVIERWGRLDVLVNNAGITRDTLLRMKRDDWQSVLDLNLGGVFLCSRAAAKIMLKQRSGRIINIASVVGEMGNPGQANYSAAKAGVIGLTKTVAKELASRGITVNAVAPGFIATDMTSELAAEK----LLEVIPLGRYGEAAEVAGVVRFLAADPAAYITGQVINIDGGLVMA.. 263
60 -88.4002fwm_X mol:protein length:250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogena  ali model follow..  27  1....GHMDFSGKNVWVTGAGKGIGYATALAFVEAGAKVTGFDQA----------FTQEQYPFATEVMDVADAAQVAQVCQRLLAETERLDALVNAAGILRMGATQLSKEDWQQTFAVNVGGAFNLFQQTMNQFRRQRGGAIVTVASDAAHTPRIGMSAYGASKAALKSLALSVGLELAGSGVRCNVVSPGSTDTDMQRTLWVSDFGEQFKLGIPLGKIARPQEIANTILFLASDLASHITLQDIVVDGGSTL... 248
61 -88.3001edo_A mol:protein length:244 BETA-KETO ACYL CARRIER PROTEIN REDUCTASE  ali model follow..  33  1..........SPVVVVTGASRGIGKAIALSLGKAGCKVLVNYASAKAAEEVSKQIEAYGGQAITFGGDVSKEADVEAMMKTAIDAWGTIDVVVNNAGITRDTLIRMKKSQWDEVIDLNLTGVFLCTQAATKIMMKKRKGRIINIASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDMTAK-LGEDMEKKILGTIPLGRTGQPENVAGLVEFLASPAASYITGQAFTIDGGIAI... 244
62 -88.3002c07_A mol:protein length:285 3-OXOACYL-(ACYL-CARRIER PROTEIN) REDUCTASE  ali model follow..  30  29.....YYCGENKVALVTGAGRGIGREIAKMLAKSVSHVICISRTQKSCDSVVDEIKSFGYESSGYAGDVSKKEEISEVINKILTEHKNVDILVNNAGITRDNLLRMKNDEWEDVLRTNLNSLFYITQPISKRMINNRYGRIINISSIVGLTGNVGQANYSSSKAGVIGFTKSLAKELASRNITVNAIAPGFISSDMTDK-ISEQIKKNIISNIPAGRMGTPEEVANLACFLSSDKSGYINGRVFVIDGGLS.... 274
63 -88.2003i4f_A mol:protein length:264 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  26  2.....SLGRFVRHALITAGTKGLGKQVTEKLLAKGYSVTVTYHDTTAMETMKETYKDVEERLQFVQADVTKKEDLHKIVEEAMSHFGKIDFLINNAGVFERKKLDYEEDEWNEMIQGNLTAVFHLLKLVVPVMRKQNFGRIINYGGADSAPGWIYRSAFAAAKVGLVSLTKTVAYEEAEYGITANMVCPGDIIGEMKEA-TIQEARQLKEHNTPIGRSGTGEDIARTISFLCEDDSDMITGTIIEVTGAVDV... 253
64 -88.2003a28_C mol:protein length:258 L-2.3-butanediol dehydrogenase  ali model follow..  29  2..........SKVAMVTGGAQGIGRGISEKLAADGFDIAVADLQEEQAAETIKLIEAADQKAVFVGLDVTDKANFDSAIDEAAEKLGGFDVLVNNAGIAQIKPLEVTEEDLKQIYSVNVFSVFFGIQAASRKFDELGKGKIINAASIAAIQGFPILSAYSTTKFAVRGLTQAAAQELAPKGHTVNAYAPGIVGTGMWEQIDAEENFKEYSSSIALGRPSVPEDVAGLVSFLASENSNYVTGQVMLVDGGMLYN.. 258
65 -87.7003svt_A mol:protein length:281 Short-chain type dehydrogenase/reductase  ali model follow..  34  6.....QLSFQDRTYLVTGGGSGIGKGVAAGLVAAGASVMIVGRNPDKLAGAVQELEALGANIRYEPTDITNEDETARAVDAVTAWHGRLHGVVHCAGGSENIITQVDSEAWRRTVDLNVNGTMYVLKHAAREMVRGGGGSFVGISSIAASNTHRWFGAYGVTKSAVDHLMQLAADELGASWVRVNSIRPGLIRTDLVAAITEAELSSDYAMCTPLPRQGEVEDVANMAMFLLSDAASFVTGQVINVDGGQMLR.. 259
66 -87.6001wmb_A mol:protein length:260 D(-)-3-hydroxybutyrate dehydrogenase  ali model follow..  27  2........LKGKVAVVTGSTSGIGLGIATALAAQGADIVLNGFGDAAEKVRAGLAAQHGVKVLYDGADLSKGEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRTPLVEKQIETAARELLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGWTAR.. 260
67 -87.5002cf2_E mol:protein length:226 FATTY ACID SYNTHASE, KR DOMAIN  ali model follow..  33  1......MNFEGKIALVTGASRGIGRAIAETLAARGAKVIGTATSENGAQAISDYL---GANGKGLMLNVTDPASIESVLEKIRAEFGEVDILVNNAGITRDNLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIG---------GQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETSDD-------QRAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGM..... 226
68 -87.5003uf0_A mol:protein length:273 Short-chain dehydrogenase/reductase SDR  ali model follow..  32  15QSMTGPFSLAGRTAVVTGAGSGIGRAIAHGYARAGAHVLAWGRT-DGVKEVADEIADGGGSAEAVVADLADLEGAANVAEEL-AATRRVDVLVNNAGIIARAPAEVSLGRWREVLTVNLDAAWVLSRSFGTAMLAHGSGRIVTIASMLSFQGGRNVAAYAASKHAVVGLTRALASEWAGRGVGVNALAPGYVVTANTAALRDDERAAEITARIPAGRWATPEDMVGPAVFLASDAASYVHGQVLAVDGGWLAS.. 267
69 -87.4002yz7_A mol:protein length:260 D-3-hydroxybutyrate dehydrogenase  ali model follow..  29  2........LKGKKAVVTGSTSGIGLAMATELAKAGADVVINGFGEDIERERSTLESKFGVKAYYLNADLSDAQATRDFIAKAAEALGGLDILVNNAGIQHTAPIEFPVDKWNAIIALNLSAVFHGTAAALPIMQKQGWGRIINIASAHGLVASVNKSAYVAAKHGVVGLTKVTALENAGKGITCNAICPGWVRTPLVEKQIEAAARELLAEKQPSLQFVTPEQLGGAAVFLSSAAADQMTGTTLSLDGGWTAR.. 260
70 -87.3003v2h_A mol:protein length:281 D-beta-hydroxybutyrate dehydrogenase  ali model follow..  29  14.....FQSMMTKTAVITGSTSGIGLAIARTLAKAGANIVLNGFGPDEIRTVTDEVAGLSGTVLHHPADMTKPSEIADMMAMVADRFGGADILVNNAGVQFVEKIDFPVEQWDRIIAVNLSSSFHTIRGAIPPMKKKGWGRIINIASAHGLVASPFKSAYVAAKHGIMGLTKTVALEVAESGVTVNSICPGYVLTPLVEKQIPDQINEVMLKGQPTKKFITVEQVASLALYLAGDDAAQITGTHVSMDGGWTAQ.. 275
71 -87.0002zk7_A mol:protein length:257 Glucose 1-dehydrogenase related protein  ali model follow..  28  4.....FSDLRDKVVIVTGASMGIGRAIAERFVDEGSKVIDLSIHDPG-----------EAKYDHIECDVTNPDQVKASIDHIFKEYGSISVLVNNAGIESYGKISMSMGEWRRIIDVNLFGYYYASKFAIPYMIRSRDPSIVNISSVQASIITKNASAYVTSKHAVIGLTKSIALDYA-PLLRCNAVCPATIDTPLVRKAAEEKKISEWGHEHPMQRIGKPQEVASAVAFLASREASFITGTCLYVDGGLSIR.. 250
72 -87.0002a4k_A mol:protein length:263 3-oxoacyl-[acyl carrier protein] reductase  ali model follow..  27  1.....MGRLSGKTILVTGAASGIGRAALDLFAREGASLVAVDREERLLAEAVAAL---EAEAIAVVADVSDPKAVEAVFAEALEEFGRLHGVAHFAGVAHSALSNLPLEAWEKVLRVNLTGSFLVARKAGEVL--EEGGSLVLTGSVAGL-GAFGLAHYAAGKLGVVGLARTLALELARKGVRVNVLLPGLIQTPMTAG-LPPWAWEQEVGASPLGRAGRPEEVAQAALFLLSEESAYITGQALYVDGGRSI... 241
73 -86.9002ph3_A mol:protein length:245 3-oxoacyl-[acyl carrier protein] reductase  ali model follow..  30  2...........RKALITGASRGIGRAIALRLAEDGFALAIHYGNREKAEEVAEEARRRGSPLVVLGANLLEAEAATALVHQAAEVLGGLDTLVNNAGITRDTLVRMKDEDWEAVLEANLSAVFRTTREAVKLMMKARFGRIVNITSVVGILGNPGQANYVASKAGLIGFTRAVAKEYAQRGITVNAVAPGFIETEMTER-LPQEVKEAYLKQIPAGRFGRPEEVAEAVAFLVSEKAGYITGQTLCVDGGLTPH.. 245
74 -86.7001pwx_A mol:protein length:254 halohydrin dehalogenase  ali model follow..  25  2...........STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDELE------AFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSATPFGPWKELSTYTSARAGACTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFYNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPM... 245
75 -86.4001uzl_A mol:protein length:247 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE  ali model follow..  29  10.....KPPFVSRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPK-----------GLFGVECDVTDSDAVDRAFTAVEEHQGPVEVLVSNAGLSADAFMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIGSVSGSWGIGNQANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDTDMTRA-LDERIQQGALQFIPAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGGMGM... 245

FFAS is supported by the NIH grant R01-GM087218-01
5 7 1 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. FATCAT: a web server for flexible structure comparison and structure similarity searching. Nucleic Acids Res. 2004 Jul 1;32(Web Server issue):W582-5.