current user: public




Query: 2fwm_X mol:protein length:250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogena, from PDB0312

Results of FFAS03 search in COG0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst GHMDFSGKNVWVTGAGKGIGYATALAFVEAGAKVTGFDQAFTQEQYPFATEVMDVADAAQVAQVCQRLLAETERLDALVNAAGILRMGATDQLSKEDWQQTFAVNVGGAFNLFQQTMNQFRRQRGGAIVTVASDAAHTPRIGMSAYGASKAALKSLALSVGLELAGSGVRCNVVSPGSTDTDMQRTLWVSDDAEEQRIRGFGEQFKLGIPLGKIARPQEIANTILFLASDLASHITLQDIVVDGGSTLGALast
1 -92.100[IQR] COG1028 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)  ali follow..  31  1.MGKLTGKTALITGASQGIGEGIARVFARHGANLILLDISLGGRGHRCTAVKADVRDFASVQAAVARAKETEGRIDILVNNAGVCRLGNFLDMSEEDRDFHIDINIKGVWNVTKAVLPEMIKRKDGRIVMMSSVTGMVADPGETAYALSKAAIVGLTKSLAVEYAQSGIRVNAICPGYVRTPMAESIARQSNPDDP--ESVLTEMAKAIPLRRLADPLEVGELAAFLASDESSYLTGTQNVIDGGSTL.. 255
2 -90.700[R] KOG0725 Reductases with broad range of substrate specificities  ali follow..  27  2.......SCALVIGATSTLGKAVVRRLAFTGYKVAAAADCPNKVGGDVTAFSLDVANAEHRKELITKVAEKLGGLDTLIIVPPQNELGEIIETSGEDFDKLFANNLTTPFRLSQAAMSTLAKSQNGSIIYLTSCFGFTPSIDMGLYSVASSSVLSLTKSVAQSAAKQGVRVNSVVSGMIEGDGTGAVWDHASGEEA--RQIKQHLESMIPLGRLGRPSDVASYVEFLASTKARYITGENCIVGGGVSY.. 251
3 -78.000[R] COG4221 Short-chain alcohol dehydrogenase of unknown specificity  ali follow..  21  4...SLQGKIAVITGAASGIGLATTEALLEQGATVVMVDWNAAKLGERAIPQVTNLLDADSCNAMIPEILGKVDHIDILYCNAGTYIGGDLTETTPEAIDKMLNLNVNAVMKNVQAVVPHMSERKTGDIIVTCSIAGHFPTYWEPVYSGSKWAITSFVQGMRRQMIPHGVRVAQVSPGPVVSALLADWPE-------------ENLRKAKESGSLIDASEVADAVVYMLTRKRTVTIRDMLVLPTNFDR.. 242
4 -72.800[I] KOG1200 Mitochondrial/plastidial beta-ketoacyl-ACP reductase  ali follow..  29  71.VQKVESPVVVITGASRGIGKAIALALGKAGCKVLVNYARIEEYGGQAITFGGDVSKATDVDAMMKTALDKWGTIDVVVNNAGITRDTLLIRMKQSQWDEVIALNLTGVFLCTQ-----------GRIINISSVVGLIGNIGQANYAAAKGGVISFSKTAAREGASRNINVNVVCPGFIASDMTAELGED----------MEKKILGTIPLGRYGKAEEVAGLVEFLASPAASYITGQAFTIDGGIAI.. 308
5 -70.800[Q] KOG1204 Predicted dehydrogenase  ali follow..  24  2......GKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAADKFVYRVLDITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNKQWERLFDVNFFSIVSLVALCLPLLKSSPVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKVRAVCIAPGVVDTQMQKDI-RETLGPQGMTPKALERFTQLYKTSSLLDPKVPAAVLAQLVKGIPDSLNGQYLRYNDERLGP. 260
6 -65.200[I] COG0623 Enoyl-[acyl-carrier-protein] reductase (NADH)  ali follow..  20  1.MGFLSGKRILVTGVALSIAYGIAQAMHREGAELAFTYQNFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFADGDYVNAVTREGFKIAHDISSYSFVAMAKACRSML--NPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKD--------FRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSI.. 253
7 -62.000[M] COG3967 Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein)  ali follow..  22  1..MKMTNNTVLITGGSAGIGLELAKRLLELGNEVIICGRSEARLAENIHTKQCDVADRSQREALYEWALKEYPNLNVLVNNAGIQKEIDFKKGTEELFGDEIELNFQAPVHLSALFTPHLMKQPEAAIVQVTSGLAFNPLAVYPVYCATKAALHSFSLTLRHHVRDTSVEVIEMAPPMVDTGLNQKSRDKQG-----------------LTYRGISSEEYVQYFLDGLKEGKQEITNERVEG........ 231
8 -57.400[Q] KOG1201 Hydroxysteroid 17-beta dehydrogenase 11  ali follow..  19  47.PKSIAGEVAVVTGAGHGLGRAISLELAKKGCHIAVVDINVSGAKVRAKAYKANVTNYDDLVELNSKVVEEMGPVTVLVNNAGVMMHRNMFNPDPADVQLMINVNLTSHFWTKLVFLPKMKELRKGFIVTISSLAGVFPLPYSATYTTTKSGALAHMRTLRMELNQKDIHVTTVLPSFLRTNSDVTQ--------------LTHTIGFGDVYPLFTGEEVAQRIVAGMVRGEAEIT.............. 281
9 -57.100[Q] KOG1205 Predicted dehydrogenase  ali follow..  22  42.SEKVNGKVVIITGSSSGIGEHLAYEYARRGAYLTLVARREDRLSPDVAVVRGDVSVIKDCKRFVQETISRFGRLDHLVNNAGIAEAKFFEDYSESDVLPIVNTNFWGPVYATHFAIPHL-KKTKGKIIAVASPAGWSGVPRMSIYAASKAAMINFYETLRIELHP-EVGVTIVFPGLIENGNTN---------PDLLAESLLQKQDWSQVVTIESAAECAKAVVNGICRGKTFVA.............. 277
10 -56.400[R] COG0300 Short-chain dehydrogenases of various substrate specificities  ali follow..  20  1....MRKKTIFITGASSGLGRQLAIDFSWEETVLCLFARSQEENGGEAHIYPVDLADPQSIDRSFAEAISAVGVVDVLINNAGYGVFEPFCDSQMDENERMFRVNVFGLMRATAAVLPTMREQGSGHIINIASQAGKIATAKSAIYSATKHAVLGFTNSLRMELKGTGIHVSAVNPGPIQTPFFDQADKEGAYTSKVQRIMLD-------------PEDVSEKIVQLTKKPKRELN.............. 229
11 -55.800[Q] KOG1210 Predicted 3-ketosphinganine reductase  ali follow..  23  26KPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKDKQVVLCISVDVSDYNQVENVIKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSTFERLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSASKFAIRGLAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTK----------PLETRLISETTSVCKPEQVAKQIVKDAIQGNFNSS---LGSDGYMLS.. 275
12 -54.300[I] KOG1206 Peroxisomal multifunctional beta-oxidation protein and related enzymes  ali follow..  25  317.IKSLCNKVVVVTGAGGGLGKSHAIWFARYGAKVVVNDEEINKLYGEGTAIPDSHDVVTEAPLIIQTAISKFQRVDILVNNAGILRDKSFLKMKDEEWFAVLKVHLFSTFSLSKAVWPIFTKQKSGFIINTTSTSGIYGNFGQANYAAAKAAILGFSKTIALEGAKRGIIVNVIAP-HAETAMTKTIFSE------------------KELSNHFDASQVSPLVVLLASEEGRRVIGQLFEVGGGWCG.. 557
13 -50.400[IR] KOG4169 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases  ali follow..  15  221.......ARNLVSAIETSKNGTVLMLEMGETTEGLAIEWKKQHPDTEIFYQKMDITQKSDIDAAYKATAEKLGHFDVVVNGSGL--------LDDRRIELTIQINLVGVINSTLTALEYMDKSRGGLIVNISSVAGLQPTPLMAIYSTSKTGVTTFTRAMASPIAHSGVGFITICPGYTNTGILKDI------DKKTTFPFYETRMRTVFSKVKGQTAEVCARNIVNAIETAK--NGAVLMLELGEIH.. 461
14 -43.200[Q] KOG1209 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases  ali follow..  22  6.....ESPVVLITGCSQGIGHALAREFTEKGCRVVATSRSRSTQDSRLFVKELDVQSDQNVSKVLSEVIDKFGKIDVLVNNAGVQCVGPLAETPISAMENTFNTNVFGSMRMTQAVVPHMVSKKKGKIVNVGSITVMAPGPWAGVYTATKAAIHALTDTLRLELRPFGIDVINVVPGGIRTNIANSAVATELKLYKPYEEAIRERAFISQRMNPTPAETFARDTVAAVLKKN.................. 263
15 -40.900[QR] KOG1610 Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases  ali follow..  19  24.VSHLQDKYVFITGCDSGFGNLLARQLDARGLRVLAACLTEKGASDRLETVTLDVTKMESIAAATQWVKEHVGDLWGLVNNAGITPITLCEWLNTEDSMNMLKVNLIGVIQVTLSMLPLV-RRARGRIVNVSSILGRVAFFV-GGYCVSKYGVEAFSDILRREIQHFGVKISIVEPGYFRTGMTNMTQSLERMKQQQYFDALYNIMKEGLLNCSTNLNLVTDCMEHALTPRTRYSAG............. 284
16 -40.400[I] COG4982 3-oxoacyl-[acyl-carrier protein] reductase  ali follow..  15  355...LYSSEIAVVTGASKGIAASVAARLLDGGATVIATTSKLDEEGAALWVVAANMASYSDIDALVEWIIKDAQTPTLLFPFAAPRVIGDLSEAGAEIEMKVLLWAVQRLIVGLSKIGTERVASRLHVVLPGSPNRGMFG--GDGAYGEAKSALDAVVSRWHAESAARVSLAHALIGWTRGTGLMGHNDVIVSAVEE-------------AGVTTYSTDEMAAMLLDLCNAESKVAAAGTVDLTGGLGE.. 622
17 -40.300[R] KOG1611 Predicted short chain-type dehydrogenase  ali follow..  15  1....MSPKSVVVTGSNRGLGFGLVQQFLKDPQHVIATARDVDKCDPRLHILQLSLGSDESIANFAEKVSEIVGELTLLINNAAVMPYVTKQKPDRKVVLDLFESNTIGPMMLTQSLVPLIIKARGAIINIASEFLGSISENTSGAYRMTKCAVNQFTKTLSIDLKDDHILTAGICPGMVQTDMSKGKGQ--------------------------TIEESSSQILAAFNKLGATHNGGYFRRDL...... 246
18 -38.900[I] KOG1014 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3  ali follow..  21  48......GQWAVITGAGDGIGKAYSFELAKRGLNVVLISRTLEKLGRSVKIIQADFTKDDIYEHIKEKLAG---EIGILVNNVGMLPNLLHFLNAPDEIQSLIHCNITSVVKMTQLILKHMESRQKGLILNISSGIALFPWPLYSMYSASKAFVCAFSKALQEEYKAKEVIIQVLTPYAVSTAMTK................................................................. 237
19 -37.900[S] COG3007 Uncharacterized paraquat-inducible protein B  ali follow..  13  35GPIANGPKRVLVIGASTGYGLAARITAAGCGADTLGVFFEAAQKGLYAKSINGDAFSDEIKQLTIDAIKQDLGQVDQVIYSLASVFNSALKPIGNAVNLRGLDTDKEVIKESVDALLDAGVLAEGAQTTAFTYLGEKIDIYWNGSIGAAKKDLDQKVLAIRESLAAHGARVSVLKAVVTQASSAIPMMPLYLS------------LLFKVMKEKGTHEGCIEQVYSLYKD---SLCGDSPHMDQEGRL.. 330
20 -36.800[Q] KOG1208 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)  ali follow..  22  43...SAKGLVAVVTGSNCGIGFETVRELNLRKADVYMLCRSEEKAATRLHFIECDLTDFESVRRAAKETLESTDTIDILINNAGIMFQSK-HEQTKDGHEKTWQSNHLGPFLLTELFLPAVKKSSYARIINVSSRIHLKSEKMMKSYRQSKLANVMHARALTKELRKDGVTVNSLHPGVVNTELARNTILNTPGIKQITAVFRWFLMK--------TSRDGAQTSIFLAGKKIGGISGK............ 298
21 -35.400[I] KOG1478 3-keto sterol reductase  ali follow..  22  3.......KVVLITGASSGIGLALCKRLLAEDDELVCAALLASHPTAEVTIVQVDVSNLQSVFRASKELKQRFQRLDCIYLNAGIMPNPQLDKITADGLQEVFETNVFGHFILIRELEPLLCHSDNSQLIWTSSRSARKSNFGKEPYSSSKYATDLLSVALNRNFNQQGLYSNVACPGTALTNLTYGI............................................................... 234
22 -16.500[IE] KOG1430 C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases  ali follow..  10  1.MGNKSGEVLLVTGGSGFLGQHLIKQLLERKEELGIKEIRSLDETSLLRTYVADIGGDL------KALSPIFNGVDGVFHCAASVK------EYPPNYEELERVNVNGTLAVVDLCIQNNVKR----LVYTSCTSVCFVPFKIPGYASSKLRAENIVLNSPLHNQKEYLATSAMRAPLTYGECDSHFITEIFDFLSTRGWVFPRIAGVGGKQQLVYAGNVAWGHICAYKVSDKAVNGLPVFVTDDTGI.. 283
23 -15.600[MG] COG0702 Predicted nucleoside-diphosphate-sugar epimerases  ali follow..  13  29MTLANLPPLVTVFGGSGFVGRHVVRMLAKRGYRIRVAVRRPDLAGGQISFAQANLRYRDSIIKAVEDA-------DHVVNCVGILAESGRNTFD--------AVQEFGAKAIAEAA-----RDTGATLTHISAIGA--DANSQTGYGRTKGRAEAAIHSVLPGAV---LRPSII--GPEDDFFNKFAKMARNLPFLPLIGGGKTKFQPVYV------EDVAEAVARSVDGKLK--PGAIYELGGPDVM.. 251
24 -15.500[C] KOG2865 NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit  ali follow..  13  62GRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSPGQVVPMKFDPRDEDSIKAVMAKA-------NVVINLIGREYETRNFSFE--------DANHHIAEKLALVCEHGGIMR----YIQVSCLGA--SVSSPSRMLRAKA-------AAEEAVLNALPEATIMRPATM----------GTEDRILNPWSMFVKKYGFLPLIGGGT-VDVAAAIVAALKDDGS-SMGKTYELGGPDVF.. 286
25 -13.900[R] KOG4288 Predicted oxidoreductase  ali follow..  14  3.........IVVLGGSGFLGHNICKLAIAKGYEVVSVSRRGAGGLHNKEPWMDDVE-TLDAQKDPNSLLPVLRDASAVVNSVGILMEN-----NYKKILQNPRGPVSHLINSLSSTAKIAAKANVPVYCYVSAHAAAPGLD--PRYIKTKREAEREISKIS------NLRSIFLRPGFMYNFNDRPFTGALASLFTVSSSINRATSGALNF-EPLPSEEVALAALEAISDPSV................. 255
26 -12.500[V] KOG1502 Flavonol reductase/cinnamoyl-CoA reductase  ali follow..  16  6.....EGKVVCVTGASGYIASWLVKFLLSRGYTVKASVRDPSDAKERLHLFKADLLEQGSFDSAID-------GCHGVFHTA-----SPFFNDAKDPQAELIDPAVKGTLNVLNSCAKASSVKR---VVVTSSMAAVG-EASKMWYVLSKT----LAEDAAWKLAKEGLDIVTINPAMVIGPLQPTLNTSAAAILNLINGAKTFPNLSFGWVNV---KDVANAHIQAFEVPSA--NGRYCLVERVVHH.. 260
27 -12.300[M] COG1089 GDP-D-mannose dehydratase  ali follow..  15  3.......KVALITGVTGQDGSYLAEFLLDKGYEVHGIKRRASGSNPNFHLHYGDLTDSSNLTRILKEV-----QPDEVYNLAAMSH----VAVSFESPEYTADVDAIGTLRLLEAIRFLGLENK----ASTSELYGLVQEIPQSPYAVAKLYAYWITVNYRESYACNGILFNHESPRRGETFVTRKITRG-------LANIAQGLESCLYLGNMGHAKDYVRMQWLMLQQE----QPEDFVIATGVQ... 256
28 -11.400[Q] COG3321 Polyketide synthase modules and related proteins  ali follow..  16 1761.....RDGSYIITGGLGGLGLFFASKLAEAGCGRIVL-ERLCAAGADIVVECGNIAEPYTADRLVNAATATGLPLRGVLHSAAVVEDATLTNITDELIDRDWSPKVYGSWNLHCATIGQPLD----WFCLFSSGAALLGSPGQGAYAAANS----WVDLFAHWRRAQGLPVSAIAWG......................................................................... 1937
29 -11.000[MG] COG0451 Nucleoside-diphosphate-sugar epimerases  ali follow..  20  3.........YLVTGTAGFIGFYVAKRLLDAGHFVTGFDGAILARSNGFRAEIGMLEDTDALKRAAEA--AEPEIIIHLAAQAGV-------RYSLENPRAYIDSNLIGSFNMLELAVKHLMLASTSSIYGANEKIPFAESDKMTLYAATKKSLMAHSYAHLHKLPTTAFRFFTVYGPWGRPDMAPIKFVDAVSNGQPI----DIYGQGNMSRDFTYIDDLVEGIVRLSA..................... 233
30 -10.700[R] COG1090 Predicted nucleoside-diphosphate sugar epimerase  ali follow..  14  35.........IILTGATGFVGCSLVPLLHQQGHELTLLVRSVSKAQRLFAPGSFPQLKAIAYEATKSGDQKVVDGQDAVINLAG---EPISERWTEAYKAEIFDSRKLGTEKLVEAIAK---ADRKPQVMISGSAIGYYGTSETATFTESSKPGDDFLENAAHQVEQLGVRLVVFRIGIV-------LGADGGALAKMLPPFKLFAGGPLGSGEQWFSRDLIALIDKALTDST.................. 256
31 -10.600[M] COG1091 dTDP-4-dehydrorhamnose reductase  ali follow..  14  3.........LAVTGRNGQVVSALQALAGADLEIVTLGRPE------------LDLVRPENVLQALREA-----KPDVVVSAAAYTA----VDKAESEPDIAFAVNRDGAKAVAQAA-----KELGVPVIHLST--GSKATAYVESDPTGPTSIYGRSKLKGERAVSEATDNYVV----LRTAWVYSEYGNN---KTMLKLSESRDEINVVADQFGCPTDIAAAVVAIARK.................... 198
32 -10.600[Q] COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes  ali follow..  16  7.....EVRTVLLTGATGFLGRYLALKWLER-GKVIALVRAKSNEDAHLEVIAGDKGEVD--RQTWRRLADT---VDLIVDPAALVN--------VLPYSELFGPNTLGT----AELIRIALTSKQKPYIYVSTIGVGINNNYANGYGNSKWAGEVLLREAHDL---CGLPVTVFRCDMILSLAATGIAPGSFYELDAESNRQRAHYDGLPV------EFIAEAISTLGDQSLH................. 284
33 -10.300[I] KOG1221 Acyl-CoA reductase  ali follow..  19....YANKTILITGATGFMGKVLVEKLLRSCADLNVIYLLIRTKKGVDPSVRKE-EKNPGIVDKVRVVKGDLLNVEVVFHCAANVR--------DQPLRPMVMMNVVGTLKVLR-LAEKMSQLQALVHVSTSYCQCNESVLEERAYPAPQPNTYAYSKALSEDLYNNKLPIIITRPSIVTAAIHEPLPGWIEGVNRSMHCNPDYASTVIPV------DKAINGMILCGYQRGK................. 305
34 -9.960[M] COG1088 dTDP-D-glucose 4,6-dehydratase  ali follow..  16  2.......RKILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNRFAFEKVDICDRAELARVFTE------QPDCVMHLAAESH----VDRSIDGPAAFIETNIVGTYTLLEAARAYWNALTEDK-ISTDEVYGDLHSTDSSPYSASKASSDHLVRAWLRTYGLPTLITNC-----------SNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRD---LYVEDHARALVGETYNIGG...... 253
35 -9.530[G] KOG0747 Putative NAD+-dependent epimerases  ali follow..  15  1.MASYTPKNILITGAAGFIASHVANRLIRSDYKIVVLDKNPSKHSPNFKFVKGDIASADLVNHLLIT------GIDTIMHFAAQTH----VDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRR----VSTDEVYGETDEDALVGYSATKAGAEMLVMAYGRSYGLPVITTNVYGP--------------NQFPEKLIPKFILLAMRGQVLPIHGDGSNVRSYL---CEDVAEAFVGHVYNIGTK..... 253
36 -9.500[M] KOG1371 UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase  ali follow..  13  95.......THVLVTGGAGYIGSHAALRLLRDSYRVTIVDQQLFPQTGRLQFIYADLGDPLAVEKIFSE-----NAFDAVMHFAAVAYVGESTLYPLKYYHN----ITSNTLGVLEAMARHKVKK-----LIYSSTCATYGEPEKM-YGKAKKMAEDMILDFSKNSDMAVMILRYFNV---------------------IGSDPGGRLGEAPRPELREQGRISGACFDAARGFIPGLQGTDYKTSDGTCI.. 327
37 -9.100[Q] KOG1178 Non-ribosomal peptide synthetase/alpha-aminoadipate reductase and related enzymes  ali follow..  14  643.....NGQYFLLTGATGYFGRRFLEYLVKLNISVVCLVRESSDEAANIIVWAAHVEEIR--DAKWEFLVEN---VSRIYHMAAEVH---------KSYQELRPANVLGTKTVLE-----LSVMGPKALYFISGGGDDTQSAKASGYALSK-----VAELLCRKISDLGHLIYVIRPGFI---------IANDGEILSRDFFWRFVATALRMGIWPQSDELCMTLTQILEKEAD................. 881

FFAS is supported by the NIH grant R01-GM087218-01
5 7 2 2 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Li Z, Li W, Godzik A. FFAS03: a server for profile--profile sequence alignments. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W284-8.