current user: public




Query: 2fwm_X mol:protein length:250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogena, from PDB0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst GHMDFSGKNVWVTGAGKGIGYATALAFVEAGAKVTGFDQAFTQEQYPFATEVMDVADAAQVAQVCQRLLAETERLDALVNAAGILRMGATDQLSKEDWQQTFAVNVGGAFNLFQQTMNQFRRQRGGAIVTVASDAAHTPRIGMSAYGASKAALKSLALSVGLELAGSGVRCNVVSPGSTDTDMQRTLWVSDDAEEQRIRGFGEQFKLGIPLGKIARPQEIANTILFLASDLASHITLQDIVVDGGSTLGALast
1 -86.400[IQR] COG1028 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)  ali follow..  31  3...KLTGKTALITGASQGIGEGIARVFARHGANLILLDISLGGRGHRCTAVKADVRDFASVQAAVARAKETEGRIDILVNNAGVCRLGNFLDMSEEDRDFHIDINIKGVWNVTKAVLPEMIKRKDGRIVMMSSVTGDMADPGETAYALSKAAIVGLTKSLAVEYAQSGIRVNAICPGYVRTPMAESIARQSNPDDP--ESVLTEMAKAIPLRRLADPLEVGELAAFLASDESSYLTGTQNVIDGGSTL.. 255
2 -85.400[R] KOG0725 Reductases with broad range of substrate specificities  ali follow..  27  2.......SCALVIGATSTLGKAVVRRLAFTGYKVAAAADCNIKVGGDVTAFSLDVANAEHRKELITKVAEKLGGLDTLIIVPPQNEVGEIIETSGEDFDKLFANNLTTPFRLSQAAMSTLAKSQNGSIIYLTSCFGFTPSIDMGLYSVASSSVLSLTKSVAQSAAKQGVRVNSVVSGMIEGDGTGAVWDHASGEEA--RQIKQHLESMIPLGRLGRPSDVASYVEFLASTKARYITGENCIVGGGVSY.. 251
3 -72.300[I] KOG1200 Mitochondrial/plastidial beta-ketoacyl-ACP reductase  ali follow..  30  72..QKVESPVVVITGASRGIGKAIALALGKAGCKVLVNYARSAKEGGQAITFGGDVSKATDVDAMMKTALDKWGTIDVVVNNAGITRDTLLIRMKQSQWDEVIALNLTGVFLCTQ-----------GRIINISSVVGLIGNIGQANYAAAKGGVISFSKTAAREGASRNINVNVVCPGFIASDMTAEL-----------EDMEKKILGTIPLGRYGKAEEVAGLVEFLASPAASYITGQAFTIDGGIAI.. 308
4 -68.900[Q] KOG1204 Predicted dehydrogenase  ali follow..  24  2......GKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAADKFVYRVLDITDRSRMEALVEEIRQKHGKLDGIVANAGMLESQSNSEHDIKQWERLFDVNFFSIVSLVALCLPLLKSSPVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKVRAVCIAPGVVDTQMQKDI-RETLGPQGMTPKALERFTQLYKTSSLLDPKVPAAVLAQLVKGIPDSLNGQYLRYNDERLG.. 259
5 -60.600[R] COG4221 Short-chain alcohol dehydrogenase of unknown specificity  ali follow..  23  4...SLQGKIAVITGAASGIGLATTEALLEQGATVVMVDWNAAKLGERAIPQVTNLLDADSCNAMIPEILGKVDHIDILYCNAGTYIGGDLTETTPEAIDKMLNLNVNAVMKNVQAVVPHMSERKTGDIIVTCSIAGHFPTYWEPVYSGSKWAITSFVQGMRRQMIPHGVRVAQVSPGPVVSALLADWPE-------------ENLRKAKESGSLIDASEVADAVVYMLT-RKRTVTIRDMLV........ 235
6 -56.700[R] COG0300 Short-chain dehydrogenases of various substrate specificities  ali follow..  20  1....MRKKTIFITGASSGLGRQLAIDFSWEETVLCLFARSQEENGGEAHIYPVDLADPQSIDRSFAEAISAVGVVDVLINNAGYGVFEPFCDSQMDENERMFRVNVFGLMRATAAVLPTMREQGSGHIINIASQAGKIATAKSAIYSATKHAVLGFTNSLRMELKGTGIHVSAVNPGPIQTPFFDQADKEGAYTSKVQR--------------MLDPEDVSEKIVQLTKKPKRELN.............. 229
7 -46.800[Q] KOG1210 Predicted 3-ketosphinganine reductase  ali follow..  24  26KPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKDKQVVLCISVDVSDYNQVENVIKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSTFERLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSASKFAIRGLAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTKPLETRLISETTSVC----------KPEQVAKQIVKDAIQGNFNSS.............. 266
8 -45.400[Q] KOG1201 Hydroxysteroid 17-beta dehydrogenase 11  ali follow..  19  49...SIAGEVAVVTGAGHGLGRAISLELAKKGCHIAVVDINVSGAKVRAKAYKANVTNYDDLVELNSKVVEEMGPVTVLVNNAGVMMHRNMFNPDPADVQLMINVNLTSHFWTKLVFLPKMKELRKGFIVTISSLAGVFPLPYSATYTTTKSGALAHMRTLRMELNQKDIHVTTVLPSFLRTNSDVTQLTHTIGFGDVYP--------------LFTGEEVAQRIVAGMVRGEAEIT.............. 281
9 -44.800[Q] KOG1205 Predicted dehydrogenase  ali follow..  22  44...KVNGKVVIITGSSSGIGEHLAYEYARRGAYLTLVARREDRGSPDVAVVRGDVSVIKDCKRFVQETISRFGRLDHLVNNAGIAEAKFFEDYSESDVLPIVNTNFWGPVYATHFAIPHLKKTK-GKIIAVASPAGWSGVPRMSIYAASKAAMINFYETLRIELHP-EVGVTIVFPGLIENGNTNPDLLAESLLQKQDWSQVV---------TIESAAECAKAVVNGICRGKTFVA.............. 277
10 -42.300[Q] KOG1209 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases  ali follow..  22  6.....ESPVVLITGCSQGIGHALAREFTEKGCRVVATSRSRSEQDSRLFVKELDVQSDQNVSKVLSEVIDKFGKIDVLVNNAGVQCVGPLAETPISAMENTFNTNVFGSMRMTQAVVPHMVSKKKGKIVNVGSITVMAPGPWAGVYTATKAAIHALTDTLRLELRPFGIDVINVVPGGIRTNIANSAVAPELKLYKPYEEAIRERAFISQRMNPTPAETFARDTV......................... 256
11 -40.700[M] COG3967 Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein)  ali follow..  22  1..MKMTNNTVLITGGSAGIGLELAKRLLELGNEVIICGREAKQQLPNIHTKQCDVADRSQREALYEWALKEYPNLNVLVNNAGIQKEIDFKKGTEFVDGDEIELNFQAPVHLSALFTPHLMKQPEAAIVQVTSGLAFNPLAVYPVYCATKAALHSFSLTLRHHVRDTSVEVIEMAPPMVDTGLNQKSRDKQGLTYR-----------GISSEEY-----VQYFLDGLKEGKQEITNERV........... 229
12 -40.400[IR] KOG4169 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases  ali follow..  17  1..MDLAGKNVVYLGGFGGIGQKCVQELLQRPIKALAIKWKSQHPDTDVFYHKLDITQKSDIDAAYKATAERFGHFDVVVNGSGL--------MNDRLVELTIQINLLGVINSTLTALEYMDKAKGGLIVNISSVAGLQPTAIMAIYSAAKTGVTTFTRAMANPYAHSGVGFLTICPGFTDTGLLEDI------GNKTTFTYDTPMLAMFNRVKRQKAEDCARNLVSAIETSKNGTVLMLEMGETTEGL.. 248
13 -39.700[I] KOG1206 Peroxisomal multifunctional beta-oxidation protein and related enzymes  ali follow..  25  317.IKSLCNKVVVVTGAGGGLGKSHAIWFARYGAKVVVNDEEINKLYGEGTAIPDSHDVVTEAPLIIQTAISKFQRVDILVNNAGILRDKSFLKMKDEEWFAVLKVHLFSTFSLSKAVWPIFTKQKSGFIINTTSTSGIYGNFGQANYAAAKAAILGFSKTIALEGAKRGIIVNVIAP-HAETAMTKTIFSEKELSNHF------------------DASQVSPLVVLLASEELRRVIGQLFEVGGG..... 554
14 -35.800[Q] KOG1208 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)  ali follow..  22  40ERVSAKGLVAVVTGSNCGIGFETVRELNLRKADVYMLCRSEEKDATRLHFIECDLTDFESVRRAAKETLESTDTIDILINNAGIMFQSK-HEQTKDGHEKTWQSNHLGPFLLTELFLPAVKKSSYARIINVSSRIHLKSEKMMKSYRQSKLANVMHARALTKELRKDGVTVNSLHPGVVNTELARNTILNTPGIKQITAVFRWFL--------MKTSRDGAQTSIFLAGKKIGGISGK............ 298
15 -35.500[I] KOG1014 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3  ali follow..  21  48......GQWAVITGAGDGIGKAYSFELAKRGLNVVLISRTLEK-GRSVKIIQADFTKDDIYEHIKEKLAG---EIGILVNNVGMLPNLLHFLNAPDEIQSLIHCNITSVVKMTQLILKHMESRQKGLILNISSGIALFPWPLYSMYSASKAFVCAFSKALQEEYKAKEVIIQVLTPYAVSTAMTK................................................................. 237
16 -34.700[QR] KOG1610 Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases  ali follow..  23  25..SHLQDKYVFITGCDSGFGNLLARQLDARGLRVLAACLTEKGASDRLETVTLDVTKMESIAAATQWVKEHVGDRGLLVNNAGIL-ITLCEWLNTEDSMNMLKVNLIGVIQVTLSMLP-LVRRARGRIVNVSSILGRVAFFV-GGYCVSKYGVEAFSDILRREIQHFGVKISIVEPGYFRTGMTNM................................................................ 216
17 -34.500[R] KOG1611 Predicted short chain-type dehydrogenase  ali follow..  18  1....MSPKSVVVTGSNRGLGFGLVQQFLKDPNHVIATARDVDKATARLHILQLSLGSDESIANFAEKVSEIVGGLTLLINNAAVMPYVTKQKPDRKVVLDLFESNTIGPMMLTQSLVPLIIKSRGAIINIASEFLGSISENTSGAYRMTKCAVNQFTKTLSIDLKDDHILTAGICPGMVQTDM................................................................... 210
18 -33.200[I] COG0623 Enoyl-[acyl-carrier-protein] reductase (NADH)  ali follow..  21  4....LSGKRILVTGVALSIAYGIAQAMHREGAELAFTYQNFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSML--NPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKD--------FRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSI.. 253
19 -32.400[I] KOG1478 3-keto sterol reductase  ali follow..  22  3.......KVVLITGASSGIGLALCKRLLAEDDELVCAALLASHPTAEVTIVQVDVSNLQSVFRASKELKQRFQRLDCIYLNAGIMPNPQL-KITADGLQEVFETNVFGHFILIRELEPLLCHSDNSQLIWTSSRSARKSNFGKEPYSSSKYATDLLSVALNRNFNQQGLYSNVACPGTALTNLTYGI............................................................... 234
20 -17.600[S] COG3007 Uncharacterized paraquat-inducible protein B  ali follow..  14  35GPIANGPKRVLVIGASTGYGLAARITAAGCGADTLGVHKFAAQKGLYAKSINGDAFSDEIKQLTIDAIKQDLGQVDQVIYSLA-IKESVLQPATQSEIDSTVAVMGGEDWQMIDALLDAGVLAEGAQTTAFTYLGETHDIYWNGSIGAAKKDLDQKVLAIRESLAAHGGDARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEK-----GTHEGCIEQVYSLYKDSLCGDSPHMDQEGRLRADYK..... 335
21 -12.600[C] KOG2865 NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit  ali follow..  16  62GRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSPGQVVPMKFDPRDEDSIKAVMAKA-------NVVINLIGREYETRNFSFED--------ANHHIA----EKLALVCEHGGIMRYIQVSCLGASVSSP--SRMLRAKAAAEEAVLNALPE-------ATIMRPATMIGTEDRIL------------SMFVKKYGFLPLGTTKYPVDVAAAIVAALKDDGS-SMGKTYELGG...... 282
22 -12.200[V] KOG1502 Flavonol reductase/cinnamoyl-CoA reductase  ali follow..  16  6.....EGKVVCVTGASGYIASWLVKFLLSRGYTVKASVRDPSDP--KKTQHLVSLEGAKERLHLFKADLLEQGSFDSAIDGCGVFHTASPFFNDAKD-AELIDPAVKGTLNVLNSCAKASSVKR---VVVTSSMAAVGYNGKPPELCEASKMWYVLSKTLAEDAAEKGLDIVTINPAMVIGPLQPTLNTSAAAILNLINGAKTFPNLSFGWVNV---KDVANAHIQAFEVPSA................. 247
23 -12.100[MG] COG0702 Predicted nucleoside-diphosphate-sugar epimerases  ali follow..  12  29MTLANLPPLVTVFGGSGFVGRHVVRMLAKRGYRIRVAVRRPDLAGGQISFAQANLRYRDSIIKAVEDA-------DHVVNCVGILAESGRNTFD--------AVQEFGAKAIAEAA-----RDTGATLTHISAIGADAN--SQTGYGRTKGRAEAAIHSVLPG-------AVILRPSIIFGPEDDFFNK----------AKMARNLPFLPLIGGGKTKDVAEAVARSVDGKLK--PGAIYELGG...... 247
24 -11.200[IE] KOG1430 C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases  ali follow..  12  2..GNKSGEVLLVTGGSGFLGQHLIKQLLERKEELGIKEIRSHEETSLLRTYVADIGGD------LKALSPIFNGVDGVFHCAASVK------EYPPNYEELERVNVNGTLAVVDLCIQNNVKR----LVYTSCTSVCFVPFKIPGYASSKLNIVLNSNGAPLHNQKEYLATSAMRAGECDSHFITEIFDFLSTRGWVF-AGVGGKQQLVYAGNVAWGHICAYKAL---KVSDKAVNGLPVFVTDDTGI.. 283
25 -11.000[R] KOG4288 Predicted oxidoreductase  ali follow..  15  3.........IVVLGGSGFLGHNICKLAIAKGYEVVSVSRRGAGGLHNKEPWMDDVE-TLDAQKDPNSLLPVLRDASAVVNSVGILMENNYKKILQNPRGPV-AINRDLAIETAKIAAKANVPV----YCYVSAHAA--APGLDPRYIKTKREAEREI------SKISNLRSIFLRPGFMYNFNDRPFTGALASLFTVSSSINRATSGALNFLGTAS-EEVALAALEAISDPS.................. 254
26 -10.700[MG] COG0451 Nucleoside-diphosphate-sugar epimerases  ali follow..  20  3.........YLVTGTAGFIGFYVAKRLLDAGHFVTGFDGAILARSNGFRAEIGMLEDTDALKRAAEA--AEPEIIIHLAAQAGV-------RYSLENPRAYIDSNLIGSFNMLELARSLKVKH----LMLASTSSIYGANEKITLYAATKKSMELMAHSYA-KLPTTAFRFFTVYGPWGRPDMAPIKFVDAVSNGQPID-----YGQGNMSRDFTYIDDLVEGIVRLSA..................... 233
27 -10.000[R] COG1090 Predicted nucleoside-diphosphate sugar epimerase  ali follow..  15  35.........IILTGATGFVGCSLVPLLHQQGHELTLLVRSVSKAQRLFAPGSFPQLKAIAYEATKSG-QKVVDGQDAVINLAG---EPISERWTEAYKAEIFDSRKLGTEKLVEAIAKA---DRKPQVMISGSAIGYYGTSETATFTESSKPGDDFLAEVAHQVEQLGVRLVVFRIGIV-------LGADGGALAKML--PPFKLFAGGPLGSGEQ-RDLIALIDKALTDST.................. 256
28 -9.570[I] COG4982 3-oxoacyl-[acyl-carrier protein] reductase  ali follow..  17  354..GLYSSEIAVVTGASKGIAASVAARLLDGGATVIATTSKLDEEGAALWVVAANMASYSDIDALVEWIGNEQTEPTLLFPFAAPRVIGDLSEAGARS-EIEMKVLLWAVQRLIVGLSKIGTERRLHVVLPGSPNRGMFGGDGA--YGEAKSALDAVSRWHAESSWAARVSLAHALIGWTR----TGLMGHNDVIVSAVE------EAGV---TTYSTDEMAAMLLDLCNAESKVAAAGTITVDGGL.... 620
29 -9.510[GO] KOG1431 GDP-L-fucose synthetase  ali follow..  12  6.....GSMRILVTGGSGLVGKAIQKVVADGAGL-------PGEDWVFVSSKDADLTDTAQTRALFEKVQPTH--VIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVNVFGPGHVLPGLIHKVHLAKSSGSALT------WGTGNPRRQFIYSLDLAQLFIWVLRE---YNEVEPIILSVG..... 245
30 -9.300[Q] KOG1178 Non-ribosomal peptide synthetase/alpha-aminoadipate reductase and related enzymes  ali follow..  14  643.....NGQYFLLTGATGYFGRRFLEYLVKLNISVVCLVRESSDEAANIIVWAAHVEEIR--DAKWEFLVEN---VSRIYHMAAEVH---------KSYQELRPANVLGTKTVLE-----LSVMGPKALYFISGGGQQTQSAKASGYALSK-----VAELLCRKISDLGHLIYVIRPGFI---------IANDGEILSRDFFWRFVATALRMGIWPQSDELCMTLTQILEKEADAY............... 883

FFAS is supported by the NIH grant R01-GM087218-01
8 2 8 7 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Jaroszewski L, Ye Y, Godzik A. The interplay of fold recognition and experimental structure determination in structural genomics. Curr Opin Struct Biol. 2004 Jun;14(3):307-12.