current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: sp|A0JNW5|UH1BL_HUMAN UHRF1-binding protein 1-like OS=Homo sapiens GN=UHRF1BP1L PE=1 SV=2 (Range: 488-662), from NEW_HUMAN_DOMAINS

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# E-value Template Links and tools%idFirst KKSLYLPQEMSAVYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILWLNQFLLDLKQSLNQFMAVYKLNDNSKSDEHVDVRVDGLMLKFVIPSEVKSECHQDQPRAISIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKTYTSFPKSCDNFNLLHPIFQRHAHLast
1 7.000e-79gi|530636949|ref|XP_005305300.1| PREDICTED: UHRF1-binding protein 1-like isoform X1 [Chrysemys picta bellii]  clstr ali  86  489KKSLYLPPEMSAIHIEFTEYYYPDGKDYPIPCPNLYVQLNALQFTLDERSILWLNQFALDVKQSLNQFMAMYKLNDNSKSDEHVDVRMDGLMLKFIIPSEKKPEIHKDQPRAISIQSSEMIATNTRHSPNCRHSDLEALFQNFKDCEFFSRTFTNFPKSHDSFNLLHPIFQRHAH 663
2 5.000e-78gi|694842895|ref|XP_009462280.1| PREDICTED: UHRF1-binding protein 1-like [Nipponia nippon]  clstr ali  85  604KKSLYLPPEMPAIHIEFTEYYYPDGKDFPIPCPNLYGQLNALQFTLDERSILWLNQFVLDLKQSLIQFMAMYKLNDNSKSDEHVDVRVDGLMLKFIIPSENKPEIHKDQPRALSIQSSEMIATNTRYSANCRHSDLEALFQNFKDCEFFSRTFTTFPKSQKNFNLLHPIFQRHAH 778
3 2.000e-77gi|449270140|gb|EMC80855.1| UHRF1-binding protein 1-like protein [Columba livia]  clstr ali  84  478KKSLYLPPEMPAIHVEFTEYYYPDGKDFPIPCPNLYGQLNALQFTLDERSILWLNQFVLDLKQSLIQFMAMYKLNDNSKSDEHVDVRVDGLMLKFIIPSENKPEIHKDQPRALSIQSSEMIATNTRYSPNCRHSDLEALFQNFKDSEFFSRTFTTFPKSPKNFNLLHPIFQRHAH 652
4 3.000e-77gi|585668824|ref|XP_006888578.1| PREDICTED: LOW QUALITY PROTEIN: UHRF1-binding protein 1-like [Elephantulus edwardii]  clstr ali  92  487KKSLYLPQEMPAIYIEFTEYYYPDGKDFPTPSPNLYGQLNALQFTVDERSILWLNQFLLDLKQSLNQFMTVYKLNDNSKSDEHVDVRVDGLMLKFVIPSEMKSEGHPDQPHAISVQSSEMIATNTRHCPNCRHSDLEALFQDFKECDFFSKTYTSFPKSCGSFNVLHPIFQRHAH 661
5 3.000e-77gi|620975124|ref|XP_007668198.1| PREDICTED: UHRF1-binding protein 1-like [Ornithorhynchus anatinus]  clstr ali  90  475KKSLYLPQEMSAVYIEFTEYYYPDGKDFPIPCPNLYVQLNALQFTLDERSILWLNQFVLDLKQSLNQFMAMYKLNESSESDEHVDVRVDGLMLKFIIPSGKKSEHHQDQPHALSIQSSEMIATNTRHSPNCRHSDLEALFQEFKDCDFFSKTYTSFPKSCDNFNLLHPIFQRHAH 649
6 5.000e-77gi|530399970|ref|XP_005268796.1| PREDICTED: UHRF1-binding protein 1-like isoform X2 [Homo sapiens]  clstr ali  100  427KKSLYLPQEMSAVYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILWLNQFLLDLKQSLNQFMAVYKLNDNSKSDEHVDVRVDGLMLKFVIPSEVKSECHQDQPRAISIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKTYTSFPKSCDNFNLLHPIFQRHAH 601
7 6.000e-77gi|850279070|ref|XP_012859515.1| PREDICTED: LOW QUALITY PROTEIN: UHRF1-binding protein 1-like [Echinops telfairi]  clstr ali  95  482KKSLYLPQEMSAVYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILWLNQFLLDLKQSLNQFMAVYKLDDNSKSDEHVDIRVDGLMLKFVIPSEMKPESHQDQPRAISIQSSEMIATNTRHCPNCRHSDLEALFQDFKECDFFSKTYTSFPKTCDSFNLLHPIFQRHAH 656
8 8.000e-77gi|821125581|ref|XP_012384732.1| PREDICTED: UHRF1-binding protein 1-like isoform X1 [Dasypus novemcinctus]  clstr ali  94  488KKSLYLPQEMSAVYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILWLNQFLLDLKQSLNQFMTVYKLNDNSKSDEHVDIRVDGLMLKLVIPSETKSECHQDQPRAISIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKSYASFPKSSNSFNLLHPIFQRHAH 662
9 9.000e-77gi|821486978|ref|XP_012406045.1| PREDICTED: UHRF1-binding protein 1-like [Sarcophilus harrisii]  clstr ali  92  568KKSLYLPQEMSAVYIEFTEYYYPDGKDFPIPCPNLYVQLNALQFTLDERSLLWLNQFVLDLKQSLNQFMAMYKLNDNSKSDEHVDIRVDGLMLKLVIPSEKKSECHQDQPCAISVQSSEMIATNTRHSPNCRHSDLEALFQDFKDCNFFSKTYTSFPKSCDNFDLLHPIFQRHAH 742
10 2.000e-76gi|694845957|ref|XP_009463979.1| PREDICTED: UHRF1-binding protein 1 [Nipponia nippon]  clstr ali  56  490RKFFKLPDQVSAIHIEFTEYYFPDNQDFPVPCPNLYVQLNGLMLTLDTASVLWINFFCLDLYRSLEQFKAIYKLEDSGKHDEHVDVRLDGFRLKLNIPVEKKVTDHQDRPQTLCICTSEMTATNTRHAPFCSCQDLQSLFRKFASSEFFHSSYTKFPRSQDNFSLLHTLFLRHAY 664
11 2.000e-76gi|1011560521|gb|KYO17540.1| UHRF1-binding protein 1-like isoform B [Alligator mississippiensis]  clstr ali  85  495KKSLYLPPEMSAIHIEFTEYYYPDEKDYPIPAPNLYVQLNALQFTLDERSILWLNQFVLDLKQSLTQFMAMYKLNDNSKSDEHVDVRIDGLMLKFIIPSEKKPEIHKDQPRAISVQSSEMIATNTRHSPNCRHSDLEALFQNFKDCEFFNRTFTKFPKS-NNFNLLHPIFQRHAH 668
12 2.000e-76gi|617597583|ref|XP_007522124.1| PREDICTED: UHRF1-binding protein 1-like isoform X1 [Erinaceus europaeus]  clstr ali  93  206KKSLYLPQEMSAIYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILWLNQFLLDLKQSLNQFMAVYKLNDSSKSDEHVDIRVDGLMLKFVIPSEMKSECHKDQPHAVSIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKTYTRFPKSCNSFDLLHPIFQRHAH 380
13 2.000e-76gi|808866705|gb|KKF17377.1| UHRF1-binding protein 1-like protein [Larimichthys crocea]  clstr ali  64  510KKSLYLPPEMPAIHVEFTEYYFPDGKDYPIPCPNLYGQLNALQLVLDPRSLVWINLFALDLRQSLEQFMEIYKLSDSQKPDEHVDIKVDGLMLKVVIPTDRDASCPADLPRSISVQTSEMVATNTRHPANCTRSHLEALLQAFEEQPFFSSTFASFPRSSSSLPLLHPVFQRHAH 684
14 3.000e-76gi|918578191|ref|XP_013374040.1| PREDICTED: LOW QUALITY PROTEIN: UHRF1-binding protein 1-like [Chinchilla lanigera]  clstr ali  95  488KKSLYLPQEMSAVYIEFTEYYYPDGKDFPIPSPNLYGQLNALQFTVDERSILWLNQFLLDLKQSLNQFMTVYKLNDNSKSDEHVDVRVDGLMLKIVIPSEMKSECHRDQPHAVSIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSRTYTSFPKSCDNFNLLHPIFQRHAH 662
15 3.000e-76gi|831542649|ref|XP_012725182.1| PREDICTED: UHRF1-binding protein 1-like isoform X6 [Fundulus heteroclitus]  clstr ali  63  480KKSLYLPPEMPAIHVEFTEYYFPDGKDYPIPCPNLYAQLNALQLVLDPRSLVWINLFALDLRQSLEQFMEIYKLNDSQKPDEHVDIRVDGLMLKVVVPTDQDASCPADLPRSISIQTSEMVATNTRHPSNCTRSHLEALLQAFEGEAFFSPSFCSFPRSPSSVAILHPVFQQHAH 654
16 3.000e-76gi|658918023|ref|XP_008398773.1| PREDICTED: UHRF1-binding protein 1-like isoform X1 [Poecilia reticulata]  clstr ali  63  485KKSLYLPPEMPAVHVEFTEYYFPDGKDYPIPCPNLYAQLNALQLVLDPRSLVWINLFALDLRQSLEQFMQIYKLNDSQKPDEHVDIKVDGLMLKLVVPTEPDASYAADLPRSVSIQTSEMVATNTRHPPNCTRSHLEALLQAFEGEPFFSPSFSTFPRSPSSLPVLHPVFQRHAH 659
17 3.000e-76gi|831542639|ref|XP_012725177.1| PREDICTED: UHRF1-binding protein 1-like isoform X1 [Fundulus heteroclitus]  clstr ali  63  529KKSLYLPPEMPAIHVEFTEYYFPDGKDYPIPCPNLYAQLNALQLVLDPRSLVWINLFALDLRQSLEQFMEIYKLNDSQKPDEHVDIRVDGLMLKVVVPTDQDASCPADLPRSISIQTSEMVATNTRHPSNCTRSHLEALLQAFEGEAFFSPSFCSFPRSPSSVAILHPVFQQHAH 703
18 3.000e-76gi|831542643|ref|XP_012725179.1| PREDICTED: UHRF1-binding protein 1-like isoform X3 [Fundulus heteroclitus]  clstr ali  63  529KKSLYLPPEMPAIHVEFTEYYFPDGKDYPIPCPNLYAQLNALQLVLDPRSLVWINLFALDLRQSLEQFMEIYKLNDSQKPDEHVDIRVDGLMLKVVVPTDQDASCPADLPRSISIQTSEMVATNTRHPSNCTRSHLEALLQAFEGEAFFSPSFCSFPRSPSSVAILHPVFQQHAH 703
19 3.000e-76gi|803048423|ref|XP_012030255.1| PREDICTED: UHRF1-binding protein 1-like isoform X1 [Ovis aries]  clstr ali  97  523KKSLYLPQEMSAVYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILWLNQFVLDLKQSLNQFMAVYKLNDNSKSDEHVDIRVDGLMLKFVIPSEMKSECHQDQPRAISIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKTYTSFPKSGDNFNLLHPIFQRHAH 697
20 4.000e-76gi|658918027|ref|XP_008398775.1| PREDICTED: UHRF1-binding protein 1-like isoform X3 [Poecilia reticulata]  clstr ali  63  485KKSLYLPPEMPAVHVEFTEYYFPDGKDYPIPCPNLYAQLNALQLVLDPRSLVWINLFALDLRQSLEQFMQIYKLNDSQKPDEHVDIKVDGLMLKLVVPTEPDASYAADLPRSVSIQTSEMVATNTRHPPNCTRSHLEALLQAFEGEPFFSPSFSTFPRSPSSLPVLHPVFQRHAH 659
21 5.000e-76gi|836701504|ref|XP_012791586.1| PREDICTED: UHRF1-binding protein 1-like [Sorex araneus]  clstr ali  96  516KKSLYLPQEMSAVYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILWLNQFLLDLKQSLNQFMTVYKLNDNSKSDEHVDVRVDGLMLKFVIPSEMKPECHKDQPRAISIQSSEIIATNTRHCPNCRHSDLEALFQDFKECDFFSKTYTCFPKSCDNFNLLHPIFQRHAH 690
22 7.000e-76gi|557281493|ref|XP_006023705.1| PREDICTED: UHRF1-binding protein 1-like [Alligator sinensis]  clstr ali  85  491KKSLYLPPEMSAIHIEFTEYYYPDEKDYPIPAPNLYVQLNALQFTLDERSILWLNQFVLDLKQSLTQFMAMYKLNDNSKSDEHVDVRIDGLMLKFIIPSEKKPEIHKDQPRAISIQSSEMIATNTRHSPNCRHSDLEALFQNFKDCEFFSRTFTKFPKS-NNFNLLHPVFQRHAH 664
23 1.000e-75gi|698418607|ref|XP_009813164.1| PREDICTED: UHRF1-binding protein 1 [Gavia stellata]  clstr ali  56  574RKFFKLPDQVSAIHIEFTEYYFPDNQDFPVPCPNLYVQLNGLMLTLDTASVLWINLFCLDLYRSLEQFKAIYKLEDSGKRDEHVDVRLDGFRLKLNIPVEKKVADHQDRPQTLCICTSEMTATNTRHAAFCSCQDLQSLFRKFASSEFFHSSYTKFPRSQDNFSLLHTLFLRHAY 748
24 2.000e-75gi|637301671|ref|XP_008109025.1| PREDICTED: LOW QUALITY PROTEIN: UHRF1-binding protein 1-like [Anolis carolinensis]  clstr ali  79  488KKSLYLPPEMPAIHIEFTEYYYPDVKDFPIPNSNLYVQLNALQFTLDERSILWLNQFVLDLQQSLSQFMAMYKLNDSSKSEEHVDVRVDGLMIKFIIPSEKK-PNHRDGPRAISIQSSEMIATNTRHSPNCRHSDLETVLQNFKDSEFFSRTFTDFPKSPDCYNLLHPIFQRHAH 661
25 3.000e-75gi|852729245|ref|XP_012877249.1| PREDICTED: UHRF1-binding protein 1-like isoform X2 [Dipodomys ordii]  clstr ali  93  466KKSLYLPQEMSAVYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILWLNQFLLDLKQSLNQFMTVYKLNDS-KSDEHVDIRVDGLMLKIVIPSEMKSECHQDQPHTLSIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKTYTRFPKSSDSFHLLHPIFQRHAH 639
26 3.000e-75gi|625245109|ref|XP_007613799.1| PREDICTED: UHRF1-binding protein 1-like isoform X3 [Cricetulus griseus]  clstr ali  93  616KKSLYLPQEMSAIYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILWLNQFLLDLKQSLNQFMAVYKLNDNSKSDEHVDIRVDGLMLKFVIPSEMKEGCHQDQPHTVSIQSSEMTATNTRHCPNCRHSDLEALFQDFKDCDFFSKTYTRFPKSCDSFNLLHPIFQRHAH 790
27 5.000e-75gi|657756544|ref|XP_008313799.1| PREDICTED: UHRF1-binding protein 1-like isoform X3 [Cynoglossus semilaevis]  clstr ali  63  476KKSLYLPPEMPAIHVEFTEYYFPDGKDYPIPCPNLYAQLNALQLVLDSRSLVWLNLFALDLRQSLEQFMEIYKLSDSQKPDEHVDIKVDGLMLKLVIPTDQDASCPPDLPCSVSIQTSEMVATNTRQPANCTRSHLEALLQAFEEEPFFSSTFTSFPRTSTSLPLLHPVFQRHAH 650
28 5.000e-75gi|657756537|ref|XP_008313796.1| PREDICTED: UHRF1-binding protein 1-like isoform X1 [Cynoglossus semilaevis]  clstr ali  63  477KKSLYLPPEMPAIHVEFTEYYFPDGKDYPIPCPNLYAQLNALQLVLDSRSLVWLNLFALDLRQSLEQFMEIYKLSDSQKPDEHVDIKVDGLMLKLVIPTDQDASCPPDLPCSVSIQTSEMVATNTRQPANCTRSHLEALLQAFEEEPFFSSTFTSFPRTSTSLPLLHPVFQRHAH 651
29 1.000e-74gi|975128831|ref|XP_015280307.1| PREDICTED: UHRF1-binding protein 1-like [Gekko japonicus]  clstr ali  82  489KKSLYLPPEMPAIHIEFTEYYYPDGKDYPIPSSNLYIQLNALQFTLDQRSILWLNQFALDLKQSLNQFMTMYKLNENSKSEEHVDVRVDGLMIKFIIPSERK-QNHKDDPRAISIQSSEMIATNTRHSPNCRHSDLEAVFQNFKDYNFFSKTFTDFPKSPDCFNLLHPIFQRHAH 662
30 1.000e-74gi|719769417|ref|XP_010218719.1| PREDICTED: UHRF1-binding protein 1, partial [Tinamus guttatus]  clstr ali  54  367RKFLNLPDQVSAIHIEFTEYYFPDNQDFPVPCPNLYAQLNGLTLTLDTASVLWINLFCLDLYRSLEQFKAIYKLEDSGEHDEHVDVRLDGFRLKLNIPVEKKVADHRDRPRALCVRAAQVTATNTRHAPLCSCQDLQSLFRKFANSEFFHSTYSQFPRSQDNFSLLHTLFLRHAY 541
31 2.000e-74gi|972982171|ref|XP_015207368.1| PREDICTED: UHRF1-binding protein 1-like [Lepisosteus oculatus]  clstr ali  66  486KRTLYLPQEMPAVHLEFTEYYFPDGKDYPIPCPNLYVQLNALQLVLDGRSLVWLNQFALDLRQSLEQFMALYKLDDHEKPDEHVDFRVDGLMLKLIVPLEKELKGHPDLPRSISVQTSEMVATNTRHSSKCTRSSLEAVLQDFKEQEFFSSAFTSFPKRPDSFSVLHPVFQRHAH 660
32 9.000e-74gi|591378112|ref|XP_007063614.1| PREDICTED: LOW QUALITY PROTEIN: UHRF1-binding protein 1 [Chelonia mydas]  clstr ali  56  531RKSLNLPDQVSAIHIEFTEYYFPDNQEFPVPCPNLYLQLNGLMFTLDAVSVLWVNLFFLDLYRSLEQFKAIYKMEDSGKRDEHVDVRLDGFRLKLSIPVEKKVTDHRDRPKALSIHTLEMTATNSRYDPHCSCSALQNIFRRFASSEFFHSTYTQFPKSQDNFSILHTLFLRHAY 705
33 1.000e-73gi|507533085|ref|XP_004650607.1| PREDICTED: UHRF1-binding protein 1-like [Jaculus jaculus]  clstr ali  93  640KKSLYLPQEMSAIYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILWLNQFLLDLKQSLNQFMAVYKLNDNSKSDEHVDIRVDGLMLKFVIPSEVKSECHQDQPHTVSIQSSEMTATNTRQCPNCRHSDLEALFQDFKDWDFFSQTYTRFPKSCDSFNLLHPIFQRHAH 814
34 1.000e-73gi|929507272|ref|XP_014126615.1| PREDICTED: UHRF1-binding protein 1 [Zonotrichia albicollis]  clstr ali  54  477RKIFKLPDQVSAIHIEFTEYYFPDNQDFPVPCPNLYMQLNGLMLTLDTPSVLWINLFCLDLCRSLEQFKAIYKLEDSGKRDEHVDVRLDGFRLKLSIPVDKKVTEHQDRPRALCVCMSEVTATNTRHAPSCSCQDLQGLFRKFAGSEFFHSSYAAFPREQGSFSLLHTLFLRHA. 650
35 1.000e-73gi|950966303|ref|XP_014453761.1| PREDICTED: UHRF1-binding protein 1 isoform X1 [Alligator mississippiensis]  clstr ali  56  493RKSLNLPKEVSAIHIEFTEYYFSDNQEFPVPCPNLYVQLNGLMFTLDTVSMLWVNFFCLDLYRSLEQFKAIYKLETSGKQDEHVDVRLDGFGLKLNIPVEKKVTDHRDRPQTLSVRMSEMTATNTRHAPHCSCLALQNLFRRFANSEFFHSTYTHFPKSRDSFSILHTLFLRHAY 667
36 2.000e-73gi|767940279|ref|XP_011513016.1| PREDICTED: UHRF1-binding protein 1 isoform X1 [Homo sapiens]  clstr ali  50  467RKLHNLPTQVSAIHIEFTEYYFPDNQELPVPCPNLYIQLNGLTFTMDPVSLLWGNLFCLDLYRSLEQFKAIYKLEDSSQKDEHLDIRLDAFWLKVSFPLEKRERAELHRPQALVFSASGMIATNTRHAPHCSCSDLQSLFRGFAAAEFFHSNYDHFPKVPGGFSLLHMLFLHHA. 640
37 2.000e-73gi|915559685|ref|XP_013226340.1| PREDICTED: UHRF1-binding protein 1, partial [Columba livia]  clstr ali  54  523RKFLKCPDQVSAIHIEFTEYYFPDNQDFPVPCPNLYAQLNGLMLTLDTASVLWINLFCLDLYRSLEQFKAIYKLEDSGKRDEHVDVRLDGFRLKLNIPVEKKVADHPDRPQSLCVCASEVTATNTRHAPFCACQDLQGLFRRFASSEFFHSSYTKFPRAQDNFSLLHTLFLRHAY 697
38 3.000e-73gi|632978434|ref|XP_007905913.1| PREDICTED: UHRF1-binding protein 1-like isoform X1 [Callorhinchus milii]  clstr ali  71  500KKSLYLPPEMSAIHIEFTEYYFPDGKDFPIPSPNLYVQMNALQFTLDSRSMLWLNQFVLDLHQSLEQFTANYNLDDNGKKDEHVDIRVDGLMLKFIVPADKGPDDHQDHPQSISIQTAEVIATNTRHSPNCTCTDLETILQEFKDEEVFSKTFTTFPKSEDSFNLLHPVFQRHAH 674
39 4.000e-73gi|998736018|ref|XP_015506279.1| PREDICTED: UHRF1-binding protein 1 isoform X1 [Parus major]  clstr ali  53  490RKIFKLPDQVSAIHIEFTEYYFPDNQDFPVPCPNLYMQLNGLMLTLDTPSVLWINLFCLDLCRSLEQFKATYKLEDSGKRDEHVDVRLDGFRLKVSIPVDKKVTEHRDRPQALCVCMSEVTATNTRHAPSCSCQDLQSLFRKFTGSEFFHSGYAKFPRAQDRFSLLHTLFLRHAY 664
40 6.000e-73gi|859886688|ref|XP_012900233.1| PREDICTED: UHRF1-binding protein 1 [Mustela putorius furo]  clstr ali  49  476RKLHNLPTQVSAIHIEFTEYYFPDNQELPVPCPNLYIQLNGLTFTMDPVSLLWGNLFCLDLYRSLEQFKAIYKLEDSSQKDEHLDIRLDAFWLKVSFPLEKKEQAGLHRPQALVFSASGMTATNTRHAPHCSCPDLQSLFRGFAATEFFHSNYVHFPKVPGGFSLLHMLFLHHA. 649
41 1.000e-72gi|688547771|ref|XP_009298565.1| PREDICTED: UHRF1-binding protein 1-like isoform X1 [Danio rerio]  clstr ali  60  473KKSLYLPQEMPAIHAEFTEYYFPDGKDYPVPCPNLYVQLNALQLVLDSRSLVWLNLFALDLRQSLEQFMDLYKLNDSQKPEEHVDIKVDGLMLKLVIPADHEKT-QPDQPRSVSVQTSEMVATNTRHSSACSRSSLEALLQAFQEQPFFTSLSSTFPRAPSSFSVLHSVFQRHAH 646
42 1.000e-72gi|47216386|emb|CAG02444.1| unnamed protein product, partial [Tetraodon nigroviridis]  clstr ali  60  511KKTLYLPPEMPAIHVEFTEYYFPDGKDNPIPCPNLYAQLNALQLVLDPRSLVWINLFALDLRQSLEQFMEIYKLNDFQKPEEHVDIKVDGLMLKLVIPTDQEASYPADLPRSVSVQTSEMVATNTRHPSNCTRSNLAALLRAFEEETFFSPGFTSFPRSSSSLPILHPVFQHHAH 685
43 1.000e-72gi|528476490|ref|XP_005164806.1| PREDICTED: UHRF1-binding protein 1-like isoform X4 [Danio rerio]  clstr ali  60  473KKSLYLPQEMPAIHAEFTEYYFPDGKDYPVPCPNLYVQLNALQLVLDSRSLVWLNLFALDLRQSLEQFMDLYKLNDSQKPEEHVDIKVDGLMLKLVIPADHEKT-QPDQPRSVSVQTSEMVATNTRHSSACSRSSLEALLQAFQEQPFFTSLSSTFPRAPSSFSVLHSVFQRHAH 646
44 2.000e-72gi|821116850|ref|XP_004462064.2| PREDICTED: UHRF1-binding protein 1 isoform X1 [Dasypus novemcinctus]  clstr ali  49  497RKLYNLPTQVSAIHIEFTEYYFPDNQELPVPCSNLYVQLNGLTFTVDPVSLLWGNLFCLDLYHSLEQFKAIYKLEDSRQKDEHLDIRLDAFRLKVSFPLEKREEAGSHRPQALAISASGMTATNTRHAPHCSCPDLQSLFRGFTATEFFHSSYVHFPKVPGGFSLLHMLFLHHA. 670
45 2.000e-72gi|637295842|ref|XP_008107937.1| PREDICTED: UHRF1-binding protein 1 [Anolis carolinensis]  clstr ali  56  411RKSLNLPDETSAIHIEFTEYYLPDNPDFPVPCPNLYLQLHGLIFTLDTGSMLWVNLFCLDLYRSLQHFKAIYNLENSGKQDEHIDVRMDGFMLKLNIPVEKKVMDHQDRPHCLSIRTSEMTATNTRHAPHCSCLALQNLFRRFAASEFFHSSYTQFPKFQDNFSLLHTLFLRHAY 585
46 2.000e-72gi|938071438|gb|KPP69776.1| UHRF1-binding protein 1-like, partial [Scleropages formosus]  clstr ali  65  200KKSLYLPQEMPAIHVEFTEYYFPDGKDYPIPCPNLYAQLNALQLVLDPRSLVWLNQFALDLRQSLEQFMELYKLDDSQKPDEHVDIKVDGLMLKLVLPTEQELSGSSDMPGCVSIQTSEMVATNTRHAPGCRRSDLEEVLQDFQVEDFFVHGPTSFPRSTDAFRILHPVFQRHAH 374
47 4.000e-72gi|1016688071|ref|XP_016047892.1| PREDICTED: UHRF1-binding protein 1 [Erinaceus europaeus]  clstr ali  49  455RKLHNLPTQVSAIHIEFTEYYFPDNQELPVPCPNLYIQLNSLTFTVDPVSLLWGNLFCLDLYRSLEQFKAIYKLESSSQKDEHLDIRLDAFWLKVSFPLEKREHAGLHRPQALVFSASGMTATNTRHAPHCSCSDLQSLFRGFAATEFFHSNYVHFPKVPGGFSLLHMLFLHHA. 628
48 4.000e-72gi|1002589924|ref|XP_015673636.1| PREDICTED: UHRF1-binding protein 1-like [Protobothrops mucrosquamatus]  clstr ali  80  487KKSLYLPQEMPAIHIEFTEYYYPDGKDFPIPSANLYIQLNALQLTLDERSILWLNQFVLDMKQSLSQFMAMYKLNDNSKSEEHVDVRVDGLMIKLIIPSERK-QKHRDDPYAISIQSSEMVATNARHSANCRHSDLEAAFQNFKDSTFFSRTFTEFPKSSDCFNLLHPIFQRHAH 660
49 4.000e-72gi|507531527|ref|XP_004649841.1| PREDICTED: UHRF1-binding protein 1 [Jaculus jaculus]  clstr ali  48  580RKLHNLPSQVSAIHVEFTEYYFPDSPELPVPCPNLYIQLNGLTFTVDPVSLLWGNLFCLDLYRSLEQFKAIYKLEDSRQKDEHLDIRLDAFRLKVNFPLEKREQARLRRPQALVFFTSSMVATNTRHAPHCSCQDLQSLFRGFAAVEFFRSNYSRFPKVPGGFSLLHMLFLHHA. 753
50 5.000e-72gi|507618116|ref|XP_004624512.1| PREDICTED: UHRF1-binding protein 1 [Octodon degus]  clstr ali  48  548RKLHSLPSQVSAIHVEFTEYYFPDNQELPVPCPNLYIQLNDLTFTVDPVSLLWGNLFCLDLYHSLEQFKAIYKLEDSRQKDEHLDIRLDAFRLKVSFPLEKREQAKLHRPQALVFSSSSMIATNTRHAPHCGCADLQSLFRSFAAAEFFHSNYDHFPRVAGGFSLLHMLFLHHA. 721
51 6.000e-72gi|431916846|gb|ELK16606.1| UHRF1-binding protein 1 [Pteropus alecto]  clstr ali  48  707RKLHSLPSQVSAIHIEFTEYYFPDNQELPVPCPNLYIQLNGLTFTMDPVSLLWGNLFCLDLYHSLEQFKAIYKLEDSSQKDEHLDIRLDAFWLKVSFPLEKREQAGSHRPQALVFSASGMTATNTRHAPHCSCPDLQSIFQGFAAAEFFHSNFVHFPKVPGGFSLLHILFLHHA. 880
52 1.000e-71gi|975127270|ref|XP_015279457.1| PREDICTED: LOW QUALITY PROTEIN: UHRF1-binding protein 1 [Gekko japonicus]  clstr ali  54  503RKLLGLPDQISAIHMEFTEYYFPDNANFPVPCPNLYLQLNGLIFTLDTVSMLWVNLFCLDLYRSLQHFKAIYELESSGKRDEHIDVRLDGFKLKLNIPVEKKVINHRDRPHCLSIRTSEMTATNTRHAPHCSCLALQNLFRRFAASEFFHSSYTQFPKFQDNFSLLHTLFLRHA. 676
53 1.000e-71gi|765159812|ref|XP_011489477.1| PREDICTED: UHRF1-binding protein 1-like isoform X1 [Oryzias latipes]  clstr ali  62  480KKSLYLPPEMPAIHVEFTEYYFPDGKDYPIPCPNLYAQLNALQLVLDPRSLVWINLFALDLRQSLEQFMEIYKLNDSQKPDEHVDIKVDGLMLKLVVPTDSDASCPADLPRSISIQSSEMVATNTRHPTYCTRSHLEALLQAFEEEVFFSTSSNAFPHSSSSIPILHPVFQRHA. 653
54 2.000e-71gi|528949583|ref|XP_005206671.1| PREDICTED: UHRF1-binding protein 1-like isoform X1 [Bos taurus]  clstr ali  97  488KKSLYLPQEMSAVYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILWLNQFVLDLKQSLNQFMAVYKLNDNSKSDEHVDIRVDGLMLWFVIPSEMKSECHQDQPRAISIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKTYTSFPKSGDNFNLLHPIFQRHAH 691
55 3.000e-71gi|676267458|gb|KFO23144.1| UHRF1-binding protein 1 [Fukomys damarensis]  clstr ali  48  733RGLHSLPAQASAIHVEFTEYYFPDNQELPVPCPNLYIQLNDLIFTVDPVSLLWGNLFCLDLYRSLEQFKAIYKLEDSRQKDEHLDIRLDAFRLKVSFPLEKKEQAKLHRPQALVFSASGMIATNTRHAPHCSCPDLQSLFRGFAAAEFFHSNYDHFPKVPGGFSLLHMLFLHHA. 906
56 3.000e-71gi|884925887|ref|XP_013012058.1| PREDICTED: UHRF1-binding protein 1 [Cavia porcellus]  clstr ali  50  282RKLHNLPAQISAIHIEFTEYYFPDSQELPVPCPNLYIQLNDLTFTVDPVSLLWGNLFCLDLYHSLEQFKAIYKLEDSRRKDEHLDIRLDAYRLKVSFPLEKRELAKLYRPQALVISASGMVATNTRHAPHCGCSDLQNLFRGFAATEFFHSNYGHFPKVPGGFSLLHILFLHHA. 455
57 3.000e-71gi|533151928|ref|XP_005390174.1| PREDICTED: UHRF1-binding protein 1 [Chinchilla lanigera]  clstr ali  47  575RKLHSLPAQVSAIHVEFTEYYFPDNQELPVPCPNLYIQLNGLTFTVDPVSLLWGNLFCLDLYRSLEQFKAIYKLEDSRQKDQHLDIRLDAFRLKVSFPLEKREQAKLHRPQALVFSSSGMVATNTRHAPHCGCPDLQSVFRGFAAAEFFHSNYDHFPKVPGGFSLLHMLFLHHA. 748
58 3.000e-71gi|537271198|gb|ERE91988.1| UHRF1-binding protein 1 [Cricetulus griseus]  clstr ali  47  514RKRHHLPTQVAAIHVQFTEYYFPDNQELPVPCPNLYIQLNGLTFTVDPVSLLWGNLFCLDLYRSLEQFKAIYKLEDSRQKDEHLDIRLDAFLLKVSFPLEKREQAKLHRPQALVLSTSGLIATNTRHAPHCSCPDLQSLFRGFAAAEFFRSSYGHFPKAPGGFSLLHTLFVHHA. 687
59 3.000e-71gi|742171269|ref|XP_010885704.1| PREDICTED: UHRF1-binding protein 1-like isoform X1 [Esox lucius]  clstr ali  61  477KKSLYLPPEMPAVHIEFTEYYFPDGKDYPVPCPNLYVQQNALQLVLDPRSLVWCNLFALDLRQSLEQFMELYKLNEEQKPEEHMDVRVDGLMLKLVVPTDRDPSYPQDLPRSISVQCSEMVATNTRQPSNCTRSHLEALLLSFQEEQFFAASCSSFPRSSASFPLIHPIFQRHAH 652
60 5.000e-71gi|507709852|ref|XP_004717300.1| PREDICTED: UHRF1-binding protein 1 [Echinops telfairi]  clstr ali  46  501RKLHNLPTQVSAIHIEFTEYYFPDSQALPVPCPNLYIQLNGLTFTMDPVSLLWGNFFCLDLYRSLEQFKAIYKLEDSTQTDEHLDIRLDAFRLKVSFPLEKREQAGLHRPQTLAMSASGMTATNTRHALHCSCPDLQSLFRAFAATEFFHSSHVRFPKVPGGFSLLHMLFLHHA. 674
61 7.000e-71gi|565305049|gb|ETE60351.1| UHRF1-binding protein 1-like protein, partial [Ophiophagus hannah]  clstr ali  79  196KKSLYLPQEMPAIHIEFTEYYYPDGKDFPIPNANLYIQLNALQFTLDERSILWLNQFVLDMKQSLSQFMAMYKLNDNSKSEEHVDVRVDGLMIKLIIPSERK-QNHRDDPYAISIQSSEMIATNARHSAYCRHSDLEAAFQNFKDSTFFSRTFTEFPKSSDCFNLLHPIFERHAH 369
62 1.000e-70gi|556953041|ref|XP_005988457.1| PREDICTED: UHRF1-binding protein 1 [Latimeria chalumnae]  clstr ali  54  486RKSLRLPENVSAIHIEFTEYYFPDSQECPVPCPNLYIQLNGLQFTLDEVSMLWMNLFSLDLYQSLQQFKAIYKLEDSGKGDEHIDIRLDGARLKFVVPVEKKVVDHPNRPQSIAGHVLTMTATNSRHAPHCTHVDLQSMFRSFASSEFYHSTYTQFPRSEDSFNILHTLFLHHAY 660
63 2.000e-70gi|505848626|ref|XP_004617770.1| PREDICTED: UHRF1-binding protein 1 [Sorex araneus]  clstr ali  48  487RKPRDTPTQVSAVHIEFTEYYFPDNQELPVPCPNLYVQLNNLTFTVDPVSLLWGNLFCLDLYRSLEQFKAIYKLEDSRQKDEHLDIRLDAFWLKVSFPLEKRERAGPHRPQALVFSTSGLTATNTRHAPHCSASDLQSLFRAFAASEFFHSSSVHFPKAPGAFGLLHMLFLHHA. 660
64 2.000e-70gi|60359998|dbj|BAD90218.1| mKIAA4127 protein [Mus musculus]  clstr ali  48  575RKRHHLPPQVAAIHVQFTEYYFPDNQELPVPCPNLYIQLNGLTFTVDPVSLLWGNLFCLDLYRSLEQFKAIYKLEASRGRDEHVDVRLDAFWLKVSFPLETRELAKLHRPQALVLSTSSMIATNTRHAPNCTRPDLQSLFRGFAATEFFRCSYGHFPQVAGGFSLLHMLFLHHA. 748
65 3.000e-70gi|821483095|ref|XP_012404439.1| PREDICTED: UHRF1-binding protein 1 [Sarcophilus harrisii]  clstr ali  50  539RKLGNLPTQISAIHIEFTEYYFPDNQEFPVPCPNLYVQLNGLTFTLDPISLLWGNLFLLDLYRSLEQFKAIYKLEDSNQHDEHVDVLMDTFQLKLNFPLEKKELASLHRPQALVISTSAMTATNTRHALHCSCTDLQNIFRSFAATEFFHSNYSHFPKVPGGFSLLHMLFLHHA. 712
66 4.000e-70gi|831302820|ref|XP_012683476.1| PREDICTED: UHRF1-binding protein 1-like [Clupea harengus]  clstr ali  63  479KKSLYLPQEMPAIHAELTEYYFPDGRDYPIPCPNLYVQLNALQLVLDPRSLVWLNVFALDLKQSLEQFMQLYKLDDSQKIDEHVDIRVDGLMLKLVIPADLDPGTPPDLPRQLSVQTSEMVATNTRHSPSCSRSSLEALLQAFQEEPFFNTXHPLFPRSSDAFPLLHPVFQRHAH 661
67 5.000e-70gi|927181508|ref|XP_013926198.1| PREDICTED: UHRF1-binding protein 1 isoform X1 [Thamnophis sirtalis]  clstr ali  54  494RKLLNLPEHTSAIHIVFTEYYFPDHTTFPVPSPNLYLQMNGLVFTLDTRSMLWVNLFCLDLYRSLQQFKAIYKLESSGKREEHIDIRLDGFMLKVNIPVDKKVIEHQDRPQCLSISTSEVTATNTRHAPHCSCLALQNLFRRFAASEFFHSSYTKFPKFQDNFSLLHTLFLRHAY 668
68 7.000e-70gi|149043453|gb|EDL96904.1| rCG60530 [Rattus norvegicus]  clstr ali  46  376RKRHRLPSQVAAIHVQFTEYYFPDNQELPVPCPNLYIQLNGLTLTVDPVSLLWGNLFCLDLYRSLEQFKAIYKLEDPRGKDEHLDIRLDAFWLKVSFPLETRDLAKLHRPQALVLSTSGVIATNTRHAPHCSCPDLQGLFRGFAATEFFRSSYGHFPKVPGGFSLLHMVFLHHA. 549
69 1.000e-69gi|521035584|gb|EPQ17366.1| UHRF1-binding protein 1 [Myotis brandtii]  clstr ali  48  600RKLYNLPAQVSAIHIEFTEYYFPDNQELPVPCPNLYIELNGLTFTVDPVSLLWGNLFCLDLYRSLEQFKAIYKLEDSSQKDEHLDIRLDAFRLKVSFPLEKREQAGLHRPQALVFSASSMTATNTRHTPHYNCPDLHSLFQGFAAAEFFHSNYVQFPKVPGGFSLLHMLFVHHA. 773
70 2.000e-69gi|556769272|ref|XP_005979844.1| PREDICTED: UHRF1-binding protein 1 [Pantholops hodgsonii]  clstr ali  47  550RKLHNLPTQVSAIHIEFTEYYFPDNQELPVPCPNLYIQLNGLTFTVDPVSLLWGNLFCLDLYRSLEQFKAIYKLEGSSQKEEHLDLRLDAFWLKVSFPLEKRERAVSRRPQSLVLCASGVTATNTRHAPHCGCPDLQSLFRGFAAAEFFHSSYVRFPKVPGGFSLLHMFFMEHA. 723
71 2.000e-68gi|432094411|gb|ELK25988.1| UHRF1-binding protein 1-like protein, partial [Myotis davidii]  clstr ali  94  464KKSLYLPQEMSAVYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILWLNQFLLDLKQSLSQFMAIYKLNDNSKSDEHVDIRVDGLMLKVVIPSEMKSECHQDQPHAISIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKTYTSFPKSDAD............. 625
72 2.000e-68gi|632953282|ref|XP_007892333.1| PREDICTED: UHRF1-binding protein 1 [Callorhinchus milii]  clstr ali  54  494RQNYHLPTGISAIHIEFTEYYFPDSKAFPVPCPNLYVQLNTLQFTLDPTSMLWMNTFSLDLYQTLQQFKAIYKLDDSGKADEHVNFCMNGLMLKFVIPVEKKEMDHPDRPQYLTIQTSDMVATNTRHSVNCMYQDLQSVLMDFQNSEFFDSTYKEFPKSANSFNVLHNMFLQH.. 666
73 1.000e-67gi|148223109|ref|NP_001084948.1| UHRF1-binding protein 1-like [Xenopus laevis]  clstr ali  77  486KKSLYLPQEMSAIHIEFTEYYFPDGKNFPIPSPNLYVQLNALQFTLDEKSVLWLNQFVLDLRQSLDQFVAMYKLSDNSKSDEHVDIRVDGLMLKFIIPSQKKQDCHPDQPAGISIQTSEMIGSNTRQTANCRRSDLEAIFQDFKDYDFYSKNFTSFPRSHDHFDILHPIFQRHA. 659
74 4.000e-67gi|768944010|ref|XP_011611629.1| PREDICTED: UHRF1-binding protein 1-like isoform X1 [Takifugu rubripes]  clstr ali  65  479KKSLYLPPEMPAIHVEFTEYYFPDGKEYPIPCPNLYVQLNALQLVLDPRSLVWLNLFALDLRQSLEQFMEIYKLNDSQKPDEHVDIKVDGLMLKLVIPTDREASYPADLPRSISVQTSEMVATNTRHPSNCTRANLEALLQAFEEEPFFXXXXXXXXXXXXXXXVLHPVFQRHAH 653
75 5.000e-67gi|554875440|ref|XP_005947611.1| PREDICTED: UHRF1-binding protein 1-like isoform X1 [Haplochromis burtoni]  clstr ali  66  479KKSLYLPSEMPAIHVEFTEYYFPDGKDYPIPCPNLYAQLNALQLVLDPRSLVWLNLFALDLRQSLEQFMEIYKLNDSQKPDEHVDIRVDGLMLKLVIPTDQDSSSPADLPRSISIQTSEMAATNTRHPANCTRSHLEALLQAFEEEPXXXXXXXXXXXXXXXLPILHPVFQRHAH 653
76 6.000e-67gi|930767096|ref|XP_014184773.1| PREDICTED: UHRF1-binding protein 1-like isoform X4 [Haplochromis burtoni]  clstr ali  66  479KKSLYLPSEMPAIHVEFTEYYFPDGKDYPIPCPNLYAQLNALQLVLDPRSLVWLNLFALDLRQSLEQFMEIYKLNDSQKPDEHVDIRVDGLMLKLVIPTDQDSSSPADLPRSISIQTSEMAATNTRHPANCTRSHLEALLQAFEEEPXXXXXXXXXXXXXXXLPILHPVFQRHAH 653
77 6.000e-67gi|699688680|ref|XP_009904522.1| PREDICTED: UHRF1-binding protein 1 [Picoides pubescens]  clstr ali  49  487RKLFKLPDQVSAIHIEFTEYYFPDNQDFPVPCPNLYVQLNGLMLTLDTASVLWINLFCLDLYRSLEQFKAIYHLEDSGKQDEHIDVRLDGFRLKLSIPVEKKVAEHRDRPRALCVRLAEVAGTNKRXPPGRACRQLQSLFRRFAGSEFFHSSYSRFPRAGDSFSLLHSLFLRHAY 662
78 9.000e-67gi|966715296|gb|KTG47534.1| hypothetical protein cypCar_00026086 [Cyprinus carpio]  clstr ali  63  550KKSLYLPQEMPAIHAEFTEYYFPDGKDYPIPCPNLYVQLNALQLVLDSRSLVWLNLFALDLRQSLEQFMELYKLNDSQKPDEH-----------LVIPAEQE-RTQPDQPRSVSVQTSEMVATNTRHPSGCTRSSLEALLQAFQEQPFFTSLSASFPRSQSSFSVLHPVFQRHAH 712
79 2.000e-66gi|657592679|ref|XP_008300879.1| PREDICTED: UHRF1-binding protein 1 [Stegastes partitus]  clstr ali  39  492RKALRLPDNVPAVHLQFTEYYFPDNPSLPVPTSNLYAQLNSLQLCVDPASVLWINLFSRGLLHTLDQVKAFYHLQDSSKAEEHVDIRMDAAQLKLIIPLDSSILDHPERPQSLSVTVPQMVLSNTRHCPHGSRADLSSTCDKFASCPFFFTPPCPYPRDLSAFQPIPSTFLQHSQ 667
80 2.000e-66gi|837816953|ref|XP_012783869.1| PREDICTED: UHRF1-binding protein 1 [Ochotona princeps]  clstr ali  47  514RQLHNLPTQVSAIHIEFTEYYFPDNQELPVPCPNLYVQLNGLTFTMDPVSLLWGNLFCLDLYHSLEQFKAIYKLEDSRQKDEHLDIRLDAFWLKVSFPLEKRERAELHRPQALVLSASGVTATNTRHAPHCSCQDLQSLFRAFAAAEFFHSSYDRFPKVPGGFSLLHMLFLHHA. 687
81 6.000e-66gi|657568049|ref|XP_008287438.1| PREDICTED: UHRF1-binding protein 1-like isoform X2 [Stegastes partitus]  clstr ali  67  479KKSLYLPPEMPAIHVEFTEYYFPDGKDYPIPCPNLYAQLNALQLVLDPRSLVWLNLFALDLRQSLEQFMEIYKLNDSQKPDEHVDVKVDGLMLKLVIPTDRDASCPPDLPRSISVQTSEMVATNTRHPANCTRSHLEALLQAXXXXXXXXXXXXXXXXXXXXLPILHPVFQRHAH 653
82 2.000e-65gi|736297274|ref|XP_010791860.1| PREDICTED: UHRF1-binding protein 1-like isoform X1 [Notothenia coriiceps]  clstr ali  64  479KKSLYLPPEMPAIHVEFTEYYFPDGKDYPIPCPNLYAQLNALQLVLDPRSLVWINLFTLDLRQSLEAFMEIYKLSDSQKPEEHVDIKVDGLMLKLVIPTDQDTSCPPDLPRSISVQTSEMVATNTRHPANCTRSHLEALLQAFEQEXXXXXXXXXXXXXXXXXXLLHPVFQRHAH 653
83 4.000e-65gi|736297278|ref|XP_010791861.1| PREDICTED: UHRF1-binding protein 1-like isoform X2 [Notothenia coriiceps]  clstr ali  64  491KKSLYLPPEMPAIHVEFTEYYFPDGKDYPIPCPNLYAQLNALQLVLDPRSLVWINLFTLDLRQSLEAFMEIYKLSDSQKPEEHVDIKVDGLMLKLVIPTDQDTSCPPDLPRSISVQTSEMVATNTRHPANCTRSHLEALLQAFEQEXXXXXXXXXXXXXXXXXXLLHPVFQRHAH 665
84 6.000e-65gi|929105600|ref|XP_014063976.1| PREDICTED: UHRF1-binding protein 1-like isoform X1 [Salmo salar]  clstr ali  61  500KKSLYLPPEMPAIHVEFTEYYFPDGKDYPIPCPNLYVQLNALQLVLDPRSLVWCNLFALDLRQSLEQFMELYKLNDEQKPEEHIDIRVDGLMLKLVVPTDRDPSYPKDLPRSVSVQCSEMVATNTRHPPNCSRSHLEALLLSFQEQQFFSTSFSSFPRSSTSFPVIHPIFQRHAH 675
85 6.000e-65gi|929105606|ref|XP_014063979.1| PREDICTED: UHRF1-binding protein 1-like isoform X4 [Salmo salar]  clstr ali  61  500KKSLYLPPEMPAIHVEFTEYYFPDGKDYPIPCPNLYVQLNALQLVLDPRSLVWCNLFALDLRQSLEQFMELYKLNDEQKPEEHIDIRVDGLMLKLVVPTDRDPSYPKDLPRSVSVQCSEMVATNTRHPPNCSRSHLEALLLSFQEQQFFSTSFSSFPRSSTSFPVIHPIFQRHAH 675
86 1.000e-64gi|1007708380|ref|XP_015815603.1| PREDICTED: UHRF1-binding protein 1-like isoform X2 [Nothobranchius furzeri]  clstr ali  63  481KKSLYLPAEMPAVHVEFTEYYFPDGKDYPIPCPNLYAQLNALQLVLDPRSLVWINLFALDLRQSLEQFMEIYKLNDSQKPDEHVDIKVDGLMLKLVVPTDQDACCPADLPRSVSVQTSEMTATNTRHPANCTRSHLEALLQAFEAEXXXXXXXXXXXXXXXXVPILHSVFQQHAH 655
87 1.000e-64gi|765125836|ref|XP_011475722.1| PREDICTED: UHRF1-binding protein 1 [Oryzias latipes]  clstr ali  39  494RKLLRLPDNVPAVHLQFTEYYFPDNSSLPVPTSNLYAQLNSLQLCVDSASILWISLFSKGLLHTLDQVKAFYHLQDSNKVEEHVDIRMDASQLKLIVPLDSSILDHPERPQSLSVIIPQMALSNTRHCPHGSRADLSSTCEKFSSCSFFQPAACPFPRDPSAFHPIPSAFTQHAN 669
88 1.000e-64gi|972960263|ref|XP_015197634.1| PREDICTED: UHRF1-binding protein 1 isoform X1 [Lepisosteus oculatus]  clstr ali  40  490RRSLHLPDTVSAIHFQFMEYYFPDNPQLPVPCSNLYLQLNGLQLCLDPASLVWMNLFAQGLRRSLEQVKAFYKLQDSGKAEEHVDVRMDASQLKLLVPLDSSILDHPDRPQTLCIHVWQAVMTNTRHSTHGTRADLQGVYHSFAACPFFQPSADPFPRDQASFHPLPPAFLQHA. 664
89 1.000e-64gi|831289392|ref|XP_012676140.1| PREDICTED: UHRF1-binding protein 1 [Clupea harengus]  clstr ali  43  502RKALHLPDNVPAIHLQFTEYYLPNNPDLPIPYSNLYAQLNGLQLCVDPASVLWVNTFSRGLLRTLDQVKAFYHLQDSSKSDEHVDLRMDAAQLKLIIPLESSILDHPDRPQSLSISVPQMVLSNTRHAPHGSRADLGSTYGCFSSRPFFQRTPSNFPCDRGSFHPLPPAFL.... 673
90 1.000e-64gi|1020506321|ref|XP_016092129.1| PREDICTED: UHRF1-binding protein 1-like [Sinocyclocheilus grahami]  clstr ali  39  438RKSLHLPDNTPAIHLQFTEYYFPDNPGLPVPCSNLYAQLNGLQLYLDAPSVLWMTLFSRGLHKTLDQVKAFYHLQDSSKMDEHIDIRLDATQLKLIIPLESSILDHPDRPQSLSVSLPQIVLSNTRHAPHGSHSDLNSTYSSFSARPFFHPMVCQFPRDQSVLHPLPSAFLQH.. 611
91 2.000e-64gi|929229008|ref|XP_013990991.1| PREDICTED: UHRF1-binding protein 1-like [Salmo salar]  clstr ali  40  496RKALNLADNIPAIHLQFTEYYFPDNPGLPVPNTNLYAQLNGLQLCLDPASLLWVNLFSRGLLRTLEQVKAFYHLQDSSKAEEHMDIHMDAAQIKLIIPLESSIMDHQDRPQSLSITVPQMVLSNTRHSPHGTRADLHTTYSSFSTCHFFQSTPPSFPRDQSSFLPLPSAFLQHS. 670
92 2.000e-64gi|528764597|gb|EPY84256.1| UHRF1-binding protein 1 isoform 1 [Camelus ferus]  clstr ali  48  572RKLHNLPTQVSAIHIEFTEYYFPDNQELPVPCPNLYIQLNGLTFTMHPVSLLWGNLFCLDLYRSLEQFKAIYKLEDSSQKDEHLDIRLDAFWLKVSFPLEKREQAGLHRPQALVFSVSGMTATNTRHAPYCSCPDLQSLFRGFAAAEFFHSSYVQFPKR................ 730
93 3.000e-64gi|928076931|ref|XP_013888456.1| PREDICTED: UHRF1-binding protein 1 [Austrofundulus limnaeus]  clstr ali  40  484RKALNLPDNVPAVHLQFTEYYFPDSSSLPAPTSKLYAQLNGLQLCVDPVSMLWINLFSRGLLHTLDQVKAFYHLQDSSKADEHMDVRLDAAQLKLIIPLDSSILDHPERPQSLSVVMPQIVVSNTRHCPHGSKADLSSTCEKFSGRSFFQPTPPPYPRDLSAFHPLPSCFLRHAQ 659
94 4.000e-64gi|1007771555|ref|XP_015823924.1| PREDICTED: UHRF1-binding protein 1 isoform X1 [Nothobranchius furzeri]  clstr ali  38  496RKALRLPDKVPAVHLQFTEYYFPDNSGVPVPTSSLYAQLNGLQLCVDPASMLWINLFSRGLLHTLDQVKAFYHLQDSGKPEEHVDLRLDAAQLKVIIPLDSSILDHPERPQSLSVIVPQMVLSNTRHCPHGSRSDLSSACENFASSPFFQPPPCPYPRDLNTFHPIPSTFLQHSQ 671
95 9.000e-64gi|951567510|ref|XP_014482358.1| PREDICTED: UHRF1-binding protein 1 isoform X1 [Dinoponera quadriceps]  clstr ali  29  508RDRFCLPEDVTILHAEFTYYYYPGDITFPLPPPKFYVQLNPIQVNFDVCSCLWFNSFALNLHHSL--IGKNKQLSHSSTRLMYFDVKIEAILPRIVFESQQDYPNQKDRPKSLHLQTSRASITNVRSTERSSRADLAQCLNAFQMGQMFFG--AEFPSKSGDFHVVTEKFLAH.. 676
96 9.000e-64gi|936679661|ref|XP_014232852.1| PREDICTED: UHRF1-binding protein 1-like isoform X1 [Trichogramma pretiosum]  clstr ali  29  507RERFYLPEDVNIIHAEFTYYYYPGDLNFPSPPPKFYVQLNPIQINFDLSSCLWFNSFLLNLYHSL--MSNGSNMASANSNLMYFDVKIEAILPRVIFESQQDYPNQKDRPKSLHLQTSRATITNVRSSERSSRADLAQCLNAFQMGQLFFGT--EYPNRPDDYNVISEKFLAH.. 675
97 1.000e-63gi|597757747|ref|XP_007240599.1| PREDICTED: UHRF1-binding protein 1 [Astyanax mexicanus]  clstr ali  40  487RKTLQLPENTPAIHMQFTEYYFPHSPGTPVPCSNLYAQLNGLQLCVDAPSLLWMALFSRGLLRTLDQVKAFYHLQDSSKTDEHVDVRVDATQLRLVVPLDSSILDHPDRPQSLSFSLPQAVLSNTRHCPHGSLSDLQGVYSSFSAQPFFQSPSPPFPRDRNTFHPLPPEFLH... 659
98 1.000e-63gi|1016165593|gb|KZC12755.1| UHRF1-binding protein 1-like [Dufourea novaeangliae]  clstr ali  29  514RDRFCLPEDVTILHAEFTYYYYPGDITFPLPPPKFYVQLNPIQVNFDVCSCLWFNSFALNLHHSL--MSKDKHTTHTSTNLMYFDVKIEAILPRIVFESQQDYPSQKDRPKSLHMQTSRASITNVRSTERSSRADLAQCLNAFQMGQMFFSS--EFPNKMDDFHVITDKFLAH.. 682
99 1.000e-63gi|974063340|ref|XP_015228954.1| PREDICTED: UHRF1-binding protein 1 [Cyprinodon variegatus]  clstr ali  38  494RKALHLPDNIPGVHLQFTEYFFPDNSSLPVPTSNLYVQLNGLQLCVDAASLLWINLFSRGLLQTLDQVKAFYHLQDSKKAEEHVDIRMDAAHLKMIIPLDSSILDHPERPQSLSVIVPQMALSNTRHCPHGSTADLSSTYERFSGCSFFQSPPCPYPRDQSAFHPIPSTFLWH.. 667
100 2.000e-63gi|928023048|ref|XP_013859680.1| PREDICTED: UHRF1-binding protein 1-like isoform X3 [Austrofundulus limnaeus]  clstr ali  65  527KKSLYLPPEMPAVHVEFTEYYFPDGKDDPIPCPNLYAQLNALQLVLDPRSLVWINLFALDLRQSLEQFMEIYKLNDSQKPDEHIDIKVDGLMLKVVVPTDQDASCPADLPRSVSIQTSEMVATNTRHPANCTRSHLEALLQAXXXXXXXXXXXXXXXXXXXXVPVLHPVFQRHAH 701
101 2.000e-63gi|928023044|ref|XP_013859678.1| PREDICTED: UHRF1-binding protein 1-like isoform X1 [Austrofundulus limnaeus]  clstr ali  65  527KKSLYLPPEMPAVHVEFTEYYFPDGKDDPIPCPNLYAQLNALQLVLDPRSLVWINLFALDLRQSLEQFMEIYKLNDSQKPDEHIDIKVDGLMLKVVVPTDQDASCPADLPRSVSIQTSEMVATNTRHPANCTRSHLEALLQAXXXXXXXXXXXXXXXXXXXXVPVLHPVFQRHAH 701
102 3.000e-63gi|742187924|ref|XP_010889737.1| PREDICTED: UHRF1-binding protein 1 isoform X1 [Esox lucius]  clstr ali  41  496RKALNLADNVPAIHLQFTEYYFPDNPGLPVPNTNLYAQLNGLLLRLDPASLLWVNLFSRGLLQTLEQVKAFYHLQDSSKAEEHVDIRVDAAQIKLIIPLESTIMDHQDRPRSLSVILPQTVLSNTRHSPSGTRADLSSTYSSFSACPFFQSTPPSFPRDQSTFLPLPSAFLQHS. 670
103 3.000e-63gi|742187930|ref|XP_010889738.1| PREDICTED: UHRF1-binding protein 1 isoform X2 [Esox lucius]  clstr ali  41  496RKALNLADNVPAIHLQFTEYYFPDNPGLPVPNTNLYAQLNGLLLRLDPASLLWVNLFSRGLLQTLEQVKAFYHLQDSSKAEEHVDIRVDAAQIKLIIPLESTIMDHQDRPRSLSVILPQTVLSNTRHSPSGTRADLSSTYSSFSACPFFQSTPPSFPRDQSTFLPLPSAFLQHS. 670
104 3.000e-63gi|768914754|ref|XP_011600953.1| PREDICTED: UHRF1-binding protein 1 isoform X1 [Takifugu rubripes]  clstr ali  38  528RKVLRLPDNVPAVHLQFTEYYFPDNPYISVPTSNLYAQVNGLQFTVDPPSVLWISLFSRGLLQTLDQVKAFYHLQDSNKADEHIDIRMDAAQLKLIIPLDSSILDHPERPQSLSGTVPQMVLSNTRYCPHGSRADLNSTFHRFASSSFFRPTPPPYPRDQSAFHAVPAAFLQHCQ 703
105 3.000e-63gi|410900093|ref|XP_003963531.1| PREDICTED: UHRF1-binding protein 1 isoform X2 [Takifugu rubripes]  clstr ali  38  492RKVLRLPDNVPAVHLQFTEYYFPDNPYISVPTSNLYAQVNGLQFTVDPPSVLWISLFSRGLLQTLDQVKAFYHLQDSNKADEHIDIRMDAAQLKLIIPLDSSILDHPERPQSLSGTVPQMVLSNTRYCPHGSRADLNSTFHRFASSSFFRPTPPPYPRDQSAFHAVPAAFLQHCQ 667
106 5.000e-63gi|928023050|ref|XP_013859681.1| PREDICTED: UHRF1-binding protein 1-like isoform X4 [Austrofundulus limnaeus]  clstr ali  65  479KKSLYLPPEMPAVHVEFTEYYFPDGKDDPIPCPNLYAQLNALQLVLDPRSLVWINLFALDLRQSLEQFMEIYKLNDSQKPDEHIDIKVDGLMLKVVVPTDQDASCPADLPRSVSIQTSEMVATNTRHPANCTRSHLEALLQAXXXXXXXXXXXXXXXXXXXXVPVLHPVFQRHAH 653
107 5.000e-63gi|642069730|emb|CDQ88890.1| unnamed protein product [Oncorhynchus mykiss]  clstr ali  39  220RKALNLADNIPAIHLQFTEYYFPDNPGLTVPNTNLYAQLNGLQLCLDPASLLWVNLFSRGLLRTLEQVKAFYHLQDSSKAEEHIDIHMDAAQIKLIIPLESSIMDHQDRPQSLSITVPQIVLSNTRHSPHGTRADLHTTYSSFSTCHFFQSTPPSFPRDQSSFLPLPSAFLQHS. 394
108 6.000e-63gi|1009384881|gb|KYN07307.1| UHRF1-binding protein 1-like protein [Cyphomyrmex costatus]  clstr ali  30  497RDRFSLPEDVTILHAEFTYYYYPGDITFPLPPPKFYVQLNPIQVNFDVCSCLWFNSFALNLYHSLMR-----KDKLSSSRLMYFDVKIEAILPRVIFESQQDYPNQKDRPKSLHIQTSRASITNVRSTERSSRADLAQCLNAFQMGQMFFG--AEFPNKSGDFHVVTDKFLAH.. 662
109 6.000e-63gi|749749903|ref|XP_011137184.1| PREDICTED: UHRF1-binding protein 1-like isoform X4 [Harpegnathos saltator]  clstr ali  30  498RDRFCLPEEVTILHAEFTYYYYPGDITFPLPPPKFYVQLNPIQVNFDLCSCLWFNSFALNLHYSL--MGKDKQLSHSSARLMYFDVKIEAILPRIVFESQQDYPNQKDRPKSLHLQTSRASITNVRSTERSSRADLAQCLNAFQMGQMFFG--AEFPSKSGDFHVVTEKFLAH.. 666
110 1.000e-62gi|571500227|ref|XP_006559909.1| PREDICTED: UHRF1-binding protein 1-like isoform X2 [Apis mellifera]  clstr ali  31  508RDKFCLPEDVTIVHAEFTYYYYPGDITFPLPPPKFYVQLNPIQVNFDVSSCLWFNSFALNLYYSL--MNKDKQTTYTSTTLMYFDVKIEAILPRIVFESPQDYPNQKDRPKSLHIQTSRASITNVRCTERSSRADLAQCVNAFQMGQMFFST--EFPNRSNDFHVLTDKFLAH.. 676
111 1.000e-62gi|992198388|ref|XP_015460221.1| PREDICTED: UHRF1-binding protein 1-like isoform X1 [Astyanax mexicanus]  clstr ali  67  476KKTLYLPQEMPAIYAEFTEYYFPDGKDYPIPCPNLYVQLNALQLVVDSRSLVWLNLFALDLRQSLEQFMELYKLDDSQKPDEHVDVRVDGLMLKLVIPADQE-QLQPDLPRSISVQMSEMVATNTRHSSGCSRSDLESLLQAFREQAXXXXXXXXXXXXXXXXPVLHPVFQRHAH 649
112 1.000e-62gi|954565496|ref|XP_014606699.1| PREDICTED: UHRF1-binding protein 1 isoform X1 [Polistes canadensis]  clstr ali  29  508RDRFCLPEDLTILHAEFTYYYYPGDITFPLPPPKFYVQVNPIQVNFDICSCLWFNSFLLNLHHSLMKKNE----PSNLKNMMYFDVKIEAILPRIVFENQQDYPNQKDRPKSLHIQTSRASITNVRSVERSSRADLAQCLNTFQMGQMFFG--AEFPSKENDFHVVTDKFLAH.. 674
113 1.000e-62gi|817089903|ref|XP_012267843.1| PREDICTED: UHRF1-binding protein 1-like [Athalia rosae]  clstr ali  29  509RDRFSFPDDVTILHAEFTYYYYPGDIPFPLPPPKFYVQLNPIQVNFDVSSCLWFNSFALNLHHSLMNRNE--NISATAPNLMYFDVKIEAILPRVVFESQQEHPNQRDRPKSLHIQTSRASVTNVRSSERSSRADLAQCLNAFQMGQMFFGT--EFPNQSEDFHVVTDKFLRH.. 677
114 1.000e-62gi|992198398|ref|XP_015460225.1| PREDICTED: UHRF1-binding protein 1-like isoform X4 [Astyanax mexicanus]  clstr ali  67  476KKTLYLPQEMPAIYAEFTEYYFPDGKDYPIPCPNLYVQLNALQLVVDSRSLVWLNLFALDLRQSLEQFMELYKLDDSQKPDEHVDVRVDGLMLKLVIPADQE-QLQPDLPRSISVQMSEMVATNTRHSSGCSRSDLESLLQAFREQAXXXXXXXXXXXXXXXXPVLHPVFQRHAH 649
115 1.000e-62gi|607361092|gb|EZA55392.1| UHRF1-binding protein 1-like protein [Cerapachys biroi]  clstr ali  29  480RDRFSLPEDVTILHAEFTYYYYPGDITFPLPPPKFYVQLNPIQLNFDVCSCLWFNSFALNLYHSLI----GKNKQLSSSRLMYFDVKIEAILPRIVFESQQDYPNQKDRPKSLHLQTSRASITNVRSMERSSRADLAQCLNAFQMGQMFFG--AEFPSKSGDFHVVTDKFLAH.. 646
116 3.000e-62gi|815816017|ref|XP_012229083.1| PREDICTED: LOW QUALITY PROTEIN: UHRF1-binding protein 1-like [Linepithema humile]  clstr ali  29  510RDRFSLPEDVTILHAEFTYYYYPGDITFPLPPPKFYVQLNPIQINFDVCSCLWFNSFALNLHHSLM----GKNKQLNPSRLMYFDVKIEAILPRIVFESQQDYPNQKDRPKSLHLQTSRASITNVRSTERSSRADLAQCLNAFQMGQMFFG--AEFPSKSGDFHVVTDKFIAH.. 676
117 3.000e-62gi|1009399841|gb|KYN19957.1| UHRF1-binding protein 1-like protein [Trachymyrmex cornetzi]  clstr ali  30  514RDRFSLPEDVTILHAEFTYYYYPGDITFPLPPPKFYVQLNPIQVNFDVCSCLWFNSFALNLYHSLM-----GKDKLSSSRLMYFDVKIEAILPRVIFESQQDYPNQKDRPKSLHIQTSRASITNVRSTERSSRADLAQCLNAFQMGQMFFG--AEFPSKSGDFHVVTDKFLAH.. 679
118 5.000e-62gi|1000751673|ref|XP_015598695.1| PREDICTED: UHRF1-binding protein 1-like isoform X1 [Cephus cinctus]  clstr ali  28  508RDRFCLPEDVTILHAEFTYYYYPGDINFPLPPPKFYVQLNPIQVNFDLCSCLWFNSFALNLHHSL--LDRNNKGANNQANLMYFDVKIEAILPRIVFESQQDYPNQKDRPKSLHLQTSRATVTNVRSTERSSRADLAQCLNVFQMGQMFFG--AEFPSKAGDYHVVTNKFLEH.. 676
119 6.000e-62gi|444729084|gb|ELW69512.1| UHRF1-binding protein 1 [Tupaia chinensis]  clstr ali  47  573RKLHNLPTQVSAIHIEFTEYYFPDNQELPVPCPNLFLKLNGLTFTMDPVSLLWGNLFCLDLYRSLEQFKAIYKLEDSRQKDEHLDIRLDAFRLKVGFPLEKREQAEVHRPQALAVSASGMVATNTRHAPHCSCPDLQSLFRGFAASEFFHSSYDHFPKVPGGFSLLHMLFLHHA. 802
120 9.000e-62gi|938061225|gb|KPP63566.1| UHRF1-binding protein 1-like, partial [Scleropages formosus]  clstr ali  37  514RKALHAGDRVPAIHGQFTEYYFPDNPGLPVPCSNLYAQLSGLQLYLDPASVLWVSLFCRGLLRTLDQVKAFYHLQDRGKGEEHVDTRLDATQLRLVIPLESSILDHPDRPQSLSITVPQAVLSNTRHCPHSSRANLHATCSTFSACPFLQPPPPAFPRDQSTFHPLPRAFLHHA. 688
121 1.000e-61gi|657770276|ref|XP_008317394.1| PREDICTED: UHRF1-binding protein 1 [Cynoglossus semilaevis]  clstr ali  37  494RKTLQLPDGVPAVHLQFTEYYFSDNPSLSVPTSSLSAPLNRLQLCVDPASVLWINLFSRGLLHTLEQVKAFYHLQDSCKAEEHVDVRMDAVHLKLIIPLDSSILDHPERPQSLSVTLPQMVLSNTRHCPHGSRADLSSVYDKFANCSFFQSSPPSYPREQSAFHPIPSTFFQHSQ 669
122 2.000e-61gi|528754223|gb|EPY73882.1| UHRF1 binding protein 1-like protein [Camelus ferus]  clstr ali  94  149.............................VPSPNLYSQLNALQFTVDERSILWLNQFLLDLKQSLNQFMAVYKLNDNSKSDEHVDIRVDGLMLKFVIPSEMKSECHRDQPHAVSIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKTYTSFPKSGDNFNLLHPIFQRHAY 294
123 2.000e-61gi|817196152|ref|XP_012273649.1| PREDICTED: UHRF1-binding protein 1 [Orussus abietinus]  clstr ali  31  498RDRFCLPEDVQILHAEFTYYYYPADIAFPLPLPKFYVQLNPIQVNFDVCSCLWFNSFILNLHHSL--MSAEGRTSRNSSNSLFFDVKIEAILPRLVFESQQDYPAQRDRPKSLHLQTSRATLTNVRSTDNSSRADLAQCLNAFQMGQMFFGT--EFPSKQGDFRVVAEKFVEH.. 666
124 5.000e-61gi|970916517|ref|XP_015124698.1| PREDICTED: UHRF1-binding protein 1-like [Diachasma alloeum]  clstr ali  30  495RDKFCLPDDVTIIHAEFTYYYYPGDISFPLPPPKFYVQANPLQINYDVFSCLWFNSFALNLYQSL--LGGENKMEDT--DVMYFDVKLEAILPRIVLEAQHDYPNQRDRPKSLHLQISRVSVTNVRSTERSSRADLAECLNAFQMGQMFFST--EFPCKDSDFHVISEKFLSH.. 661
125 9.000e-61gi|766932475|ref|XP_011498457.1| PREDICTED: UHRF1-binding protein 1-like [Ceratosolen solmsi marchali]  clstr ali  30  496RERFCLPENVNILHAEFTYYYYPGDLNFPLPPPKFYVQLNPIQINFDVCSCLWFNSFLLNLYHSL--LXXXXXXXXXXXXFMYFDVKIEAILPRIIFESLEDYPNQKDRPKSLHMQTSRATITNVRSSESSSRADLAQCLNAFQMGQMFFGS--EFPNKSGDFHVITNKFFEH.. 664
126 6.000e-60gi|646696950|gb|KDR08914.1| UHRF1-binding protein 1-like [Zootermopsis nevadensis]  clstr ali  28  34RDRYSLPEDLPILHAEFTYYYYPGDIPFPLPQPKFYVQVNPIQIHFDVCSCLWLNSFALNLHQSLLSSNP--EQQQAAAALMYMDVKLEAIMPRVIFESSAEHPNQRDRPKSLHFQVSRVSVTNVRSMEHSSRADLAKCIDTYQLGSLFFG--ADFPALPDDYHVVTDKFLKH.. 202
127 3.000e-59gi|936591784|ref|XP_014209115.1| PREDICTED: UHRF1-binding protein 1-like [Copidosoma floridanum]  clstr ali  27  508..KFPLPEDVNIIHAEFTYYYYPGDLNFPLPPPKFYVQVKPIQINFDVCSCLWFNSFFLNLYHSL--LNNSNGMTHPSSDLMYFDVKIEAILPRIIFESQQDYPSQKDRPKSLHVQTSRAIITNVRSTERSSRADLAQCLNAFQMGQMFFG--VDFPNKSKDFHVVTDKLLQH.. 674
128 8.000e-59gi|665817421|ref|XP_008557479.1| PREDICTED: UHRF1-binding protein 1 [Microplitis demolitor]  clstr ali  30  495REKFSLPEDVTILHAEFTYYYYPGDLIFPLPPPKFYVQVNPIQINYDIYSCLWFNSFLLNLYKSL----ASSENKTNAVNDMYFDVKLEAILPRIIVESQNDYPNQRDRPKSLNIQTSRVTLTNVRSTDSSSRADLAECLNALQMGQMFFSS--SFPSNNNDYNIVTDKFLRH.. 662
129 4.000e-58gi|528516982|ref|XP_001921467.4| PREDICTED: UHRF1-binding protein 1 [Danio rerio]  clstr ali  41  482RKSLHLPENTPAIHLQFTEYYFPDIPGLPVPSSNLYAQLNGLQLCVDAPSVLWMTLFSRGLHRTLDQVKAFYHLQDSSKTDEHIDIRLDATQLKLIVPLESSILDHPDRPQSLSISFPQIILSNTRQSPHGAHSDLNSTYSSFSSRSFFNTTQCPFPRDQSVLHPLPSAFLQHS. 656
130 7.000e-58gi|345492046|ref|XP_001601171.2| PREDICTED: UHRF1-binding protein 1-like isoform X1 [Nasonia vitripennis]  clstr ali  28  498RDKFHLPEDVNILHAEFTYYYYPGDLNFPLPPPKFYVQLNPIQINFDICSCLWFNSFLL--NLYYSLLXXXXXXXXXXXXFMYFDVKIEAILPRLIFESQQDYPNQKDRPKSLHMQTSRATITNVRSTERSSRADLAQCLNAFQMGQMFFGS--EFPNKTGDYHVVTNKFLEH.. 666
131 1.000e-56gi|1009421906|gb|KYN40299.1| UHRF1-binding protein 1-like protein [Trachymyrmex septentrionalis]  clstr ali  32  514RDRFSLPEDVTILHAEFTYYYYPGDITFPLPPPKFYVQLNPIQVNFDVCSCLWFNSFALNLYHSLM-----GKDKLSSSRLMYFDVKIEAILPRVIFESQQDYPNQKDRPKSLHIQTSRASITNVRSTERSSRADLAQCLNAFQMGQMFFG--AEFP-STDNIRQIPPNF..... 675
132 1.000e-56gi|1012980594|gb|KYQ54512.1| UHRF1-binding protein 1-like protein, partial [Trachymyrmex zeteki]  clstr ali  32  494RDRFSLPEDVTILHAEFTYYYYPGDITFPLPPPKFYVQLNPIQVNFDVCSCLWFNSFALNLYHSLM-----GKDKLSSTRLMYFDVKIEAILPRVVFESQQDYPNQKDRPKSLHIQTSRASITNVRSTERSSRADLAQCLNAFQMGQMFFG--AEFP-STDNIRQIPPNF..... 655
133 7.000e-56gi|620952521|ref|XP_007655040.1| PREDICTED: UHRF1-binding protein 1, partial [Ornithorhynchus anatinus]  clstr ali  48  16.........................SPFLVPCPNLYVQLNGLTFTLHPISLLWGNLFSLDLYRSLRHFKAIYKLEDSSQQDEHLDTRLDAFQVKVSIPLEKRDQAGPQRPQALAISASAMTATNTRHAPHCSHLDLQNLFRRFAAAEFFHPTYARFPKAAGGFGLLHPLFLHHA. 164
134 8.000e-56gi|328698591|ref|XP_001944744.2| PREDICTED: UHRF1-binding protein 1-like [Acyrthosiphon pisum]  clstr ali  27  454KERHKLPHDSKVIHAEFTHYYYPGDVAFPLPPSKFYAQLNPVQMNFDTLTVLWLNTFALNVYKSLMTTNVAN--QDNLGNMIYFDILVEAIMPRFIFEEEKLCNNQKDRPKSLNLQTSRATLSNVRSNEHGSRSDLANCVNGLQFASLFYSS--EYPAKDGDYHPVTEKLLNHAQ 625
135 2.000e-55gi|546677847|gb|ERL88604.1| hypothetical protein D910_05989 [Dendroctonus ponderosae]  clstr ali  30  223RNRMSLPKEASIIHAEYIYYYYPSEVPFPLPAPKFYVQVNPIQIVFDRDTCLWLNCFLLNLYRSLLTTEA----KDSASSFTYIDIKVEAILPRLNFESTAEYHNQRDRPKCLSMQVTRATITNVRSLEHSSRADLAKCIDSFSMASLFFGT--DFPSKVGDFYVVTEKFLDH.. 389
136 1.000e-54gi|478253300|gb|ENN73667.1| hypothetical protein YQE_09724, partial [Dendroctonus ponderosae]  clstr ali  30  485RNRMSLPKEASIIHAEYIYYYYPSEVPFPLPAPKFYVQVNPIQIVFDRDTCLWLNCFLLNLYRSLLTTEA----KDTASSFTYIDIKVEAILPRLNFESTAEYHNQRDRPKCLSMQVTRATITNVRSLEHSSRADLAKCIDSFSMASLFFGT--DFPSEIGDFYVVTEKFLDH.. 651
137 2.000e-54gi|1008435796|ref|XP_015834568.1| PREDICTED: UHRF1-binding protein 1 isoform X1 [Tribolium castaneum]  clstr ali  31  506RDHMTLPKDASIVHAEFIYYYYPSDIPFPLPPPKFYVHLNPVQIVFDVDSCLWLNSFGLNLYQSLMS----SKQPTGASNYTYVDVKIEAILPRLNFESTIDYPNQRDRPKTLSFQVTRVNITNVRSLEQSSRADLAKCVDSFHMGSLFFGT--DFPSQPADFYVVTQKFLDH.. 672
138 6.000e-54gi|554831443|ref|XP_005926286.1| PREDICTED: UHRF1-binding protein 1 isoform X2 [Haplochromis burtoni]  clstr ali  45  492RKALHLPDNIPAVHLQFTEYYFPDNPNLPVPTSNLYAQLNSLQLCVDPASVLWINLFTRGLLHTLDQVKAFYHLQDSNKSDEHVDIRMDAAQLK-------------------------IILSNTRHCPHGSNVDLNTTCEKFASCTFFQSTPPPYPRDLSAFHPIPSIFLQHAQ 642
139 2.000e-52gi|762092770|ref|XP_011428821.1| PREDICTED: UHRF1-binding protein 1-like isoform X1 [Crassostrea gigas]  clstr ali  34  508KKHLHLPPDMSVIHAEFTDYFFPEGVDYPVPHANLYVLLNPIRLNLDWLTLLWANFFMLNLSKSIESI----ELEDA--PLEHVDMKLEAIMPRIVMPVEDQKCVLPDFPKSVQLQISRMCATNTRVSGASSWESLSEVITNYTASPLFSS--KSFPNDNNSLRAVPDKFNNHA. 673
140 2.000e-52gi|405953876|gb|EKC21449.1| UHRF1-binding protein 1-like protein [Crassostrea gigas]  clstr ali  34  500KKHLHLPPDMSVIHAEFTDYFFPEGVDYPVPHANLYVLLNPIRLNLDWLTLLWANFFMLNLSKSIESI----ELEDA--PLEHVDMKLEAIMPRIVMPVEDQKCVLPDFPKSVQLQISRMCATNTRVSGASSWESLSEVITNYTASPLFSS--KSFPNDNNSLRAVPDKFNNHA. 665
141 3.000e-52gi|242008775|ref|XP_002425175.1| conserved hypothetical protein [Pediculus humanus corporis]  clstr ali  30  470KDRFGFPESQTVVHAEFTYYYYPGDDPFPLPAPKFYAQFNPIQIYFDVISILWVNAFALNLYQSLLQTN--TSQNTSTNDIMYFDVKIEAILLRIIMESPIDYPGQKDRPKSLHFVVPRATVTNVRSDKQSSRYDLKKCVDLLKMCSLFFAN--DFPSSETDYPLVSQKFLNH.. 638
142 2.000e-51gi|585659579|ref|XP_006816217.1| PREDICTED: UHRF1-binding protein 1-like [Saccoglossus kowalevskii]  clstr ali  29  35.EAFSLPPEMSSLHVEYTSYYFLDGLEYPVPQPNIYVKLNPIKLEMDYMTVLWINLFANHMASGV-QMKPDGGESDILSELYHNDIRIDALMPRITIPAEKMVPDQPDRPNALQIQFSQVILSNCRIATEASRSDLASAIQNLYGGTLFTD-QQQYPNEKSDLTAVSQMLWNHAY 206
143 4.000e-51gi|939674378|ref|XP_014283394.1| PREDICTED: UHRF1-binding protein 1-like [Halyomorpha halys]  clstr ali  29  476KERYSFPTDVS-LHAEFTYYYYPGDIAFPLPSPKFYVQINPVYINFDLLTVLWLNSFALNLHQSLVNTK------QESAALNYIDVKIEAIMPRLIFESNNENQYQRDRPKSLQFQVSRALLSNVRSVDCCSRSDLAKCLYASELGSLFYGS--EFPVKNGDLVVVSKKFLDH.. 640
144 7.000e-50gi|170031454|ref|XP_001843600.1| conserved hypothetical protein [Culex quinquefasciatus]  clstr ali  24  459RDRYSLPPDMPTLHAEFTYFYYPGDFVFPLPPSKAFVHVNPVQINFDLDSCLWFSSFALNLHESLLRTNNVXXXXEQPPNLMYMDVKVEVIMPRVVFEASTGAPMQRDRPKSMHVQVSRVAMTNIREMGASRADLAQAISSLQEGSLVFGSG---FPSKPGDLCIVTDRILSH.. 643
145 1.000e-49gi|585659626|ref|XP_006816227.1| PREDICTED: UHRF1-binding protein 1-like [Saccoglossus kowalevskii]  clstr ali  38  615KKALFLPPEISSLHVEYTSYYFPEGLDFPVPQANVFVKLNPLQLTLDIPTILWLSQFA--------SHMATGVKDDGGPVIEHRDIRIDALMPKFVLPAEPEVLHQPDRPKSLQIQSSQITISNCRSATNSTKSDLGSTLQNMYSGKLFCE-RKSYPGDKNDLNGVPKMFWNHAY 782
146 1.000e-49gi|966699164|gb|KTG31405.1| hypothetical protein cypCar_00014594, partial [Cyprinus carpio]  clstr ali  39  458..............................PCSNLYAQLNGLQLYLDAPSVLWMTLFSRGLHKTLDQVKAFYHLQDSSKTDEHIDIRLDATHLKLIIPLESSILDHPDRPQSLSISLPQIVLSNTRHAPHASHSDLNSTYSSFSARPFFRPTASPFPRDQSVLHPLPSAFLQH.. 601
147 2.000e-49gi|919079199|ref|XP_013420768.1| PREDICTED: UHRF1-binding protein 1-like [Lingula anatina]  clstr ali  40  512KKSLHLPPEMSSIHVEYTSYYFPQGVDYPVPSSNLFVKVTPFQLTVDYRTILWLNAFMLSLAHT-----ADIEIEDGPK--EHVDIRIDLLMPKLILPAEKSVEDQPDRPDSLHIHASRMIITNVEDNDKATLSHLDQLVKKQTSAKLFCST--GFPNMKEDLESLPDIYATH.. 675
148 2.000e-48gi|906469604|gb|KNC30311.1| hypothetical protein FF38_03958 [Lucilia cuprina]  clstr ali  31  531KDRYSFPAEMPILHAEFTYFYYPGDFIFPLPPSKVFVHINPLQVYFDLCSILWLNSFALNLHESLSSKLSLYNEPENEPSLMYMDVKVEAIMPRIVIESSVETPNQKDRPKMMQIQISRFALTNIREMGSSRADLAQALHSLQEGSLVFG---TGFPSAAGDMCIVTDRILSH.. 734
149 3.000e-48gi|443720162|gb|ELU09962.1| hypothetical protein CAPTEDRAFT_105822 [Capitella teleta]  clstr ali  32  496KRQLLLPPEMSSIHADYTEYYFPEGIDFPVPASNLYVVLNPIRLMMDFLTVLWLNAFTLNLLKKAD-------LPQQVEPKQHVDIKINALMPRIILPAEEDQSNVPERPEALQIQISRLMATNCRLDQKASVNELSASLDAFNAAKLYASRR-KFPQKSTDLLNIPDSFCKHAN 662
150 4.000e-48gi|751794609|ref|XP_011207036.1| PREDICTED: UHRF1-binding protein 1 isoform X7 [Bactrocera dorsalis]  clstr ali  30  554KERYSFPADMSVVHAEFTYFYYPGDFIFPLPPSKVFVHINPLQVHFDLSSILWLNSFALNLHESLLRTSAAISQAEQEPNLMYMDVKIEAIMPRVVIESTVDVPNQKDRPKIMQIQISRFAITNIREMGSSRADLAQALHSLQEGSLVFG---TEFPAVNGDMCIVTDRILSH.. 760
151 8.000e-48gi|1013901105|ref|XP_016023519.1| uncharacterized protein Dsimw501_GD23317, isoform D [Drosophila simulans]  clstr ali  26  541KDRYSFPAEMPIIHAEYTYFYYPGDFVFPLPPSKVFVHVNPIQVHFDLSSILWLNSFGLNLHESLLRTSVGSQSTEQEPNLMYMDVKVEAIMPRIVMEAALDAPSQKDRPKTMQIQVSRFALTNIREMGSSRADLAQALHSLQEGSLVFGSG---FPSNEGDMCIVTDRILSH.. 737
152 1.000e-47gi|969516241|ref|XP_002088692.2| LOW QUALITY PROTEIN: uncharacterized protein Dyak_GE11293 [Drosophila yakuba]  clstr ali  26  531KDRYSFPAEMPIIHAEYTYFYYPGDFVFPLPPSKVFVHVNPIQVHFDLSSILWLNSFGLNLHESLLRTSVGSQSTEQEPNLMYMDVKVEAIMPRVVMEAALDAPSQKDRPKTMQIQVSRFALTNIREMGSSRADLAQALHSLQEGSLVFGSG---FPSKEGDMCIVTDRILSH.. 730
153 1.000e-47gi|1000189248|gb|KXJ68451.1| hypothetical protein RP20_CCG003462 [Aedes albopictus]  clstr ali  24  508RDRYSLPPEMPTLHAEFTYFYYPGDFVFPLPPSKAFVHINPVQINFDLDSCLWFSSFVLNLHESLLRTNNVXXXSEPQPNLMYMDVKVEVIMPRVIFEASPGAPQQRDRPKEMHVQVARCALTNIREMGASRADLAQAISSLQEGSLVFGSG---FPSKPGDLCIVTDRILSH.. 689
154 6.000e-47gi|195161276|ref|XP_002021494.1| GL26540 [Drosophila persimilis]  clstr ali  27  526KDRYSFPAEMPIIHAEYTYFYYPGDFVFPLPPSKIFMHVNPIQVHFDLGSILWLNSFGLNLHESLLRTSVGSQNTDQEPNLMYMDVKVEAIMPRVVMEAALDAPNQKDRPKTMQIQVSRFALTNIREMGSSRADLAQALHSLQEGSLVFGSG---FPSVEGDMCIVTDRILSH.. 727
155 8.000e-47gi|807041885|ref|XP_012161549.1| PREDICTED: UHRF1-binding protein 1-like isoform X1 [Ceratitis capitata]  clstr ali  29  564KERYSFPTDMSIVHAEFTYFYYPGDFIFPLPPSKVFVHINPLQVHFDLSSVLWLNSFALNLHESLLRTSVGTAQAEQEPNLMYMDVKIEAIMPRIVIESVVDVPNQKDRPKIMQIQISRFAVTNIREMGSSRADLAQALHSLQEGSLVFG---TEFPSVNGDMCIVTDRILSH.. 776
156 1.000e-46gi|907708395|ref|XP_013111000.1| PREDICTED: UHRF1-binding protein 1-like isoform X5 [Stomoxys calcitrans]  clstr ali  31  545KDRYSFPAEMPIIHAEFTYFYYPGDFIFPLPPSKVFVHINPLQIHFDLCSILWLNSFALNLHESLLRTSAVSPTNSNEPNLMYMDVKVEAIMPRIVIESSLETANQKDRPKMMQIQISRFALTNIREMGSSRADLAQALHSLQEGSLVFG---TGFPSARGDMCIVTDRILSH.. 749
157 1.000e-46gi|907708383|ref|XP_013110995.1| PREDICTED: UHRF1-binding protein 1-like isoform X1 [Stomoxys calcitrans]  clstr ali  31  545KDRYSFPAEMPIIHAEFTYFYYPGDFIFPLPPSKVFVHINPLQIHFDLCSILWLNSFALNLHESLLRTSAVSPTNSNEPNLMYMDVKVEAIMPRIVIESSLETANQKDRPKMMQIQISRFALTNIREMGSSRADLAQALHSLQEGSLVFG---TGFPSARGDMCIVTDRILSH.. 749
158 2.000e-46gi|675378060|gb|KFM70962.1| UHRF1-binding protein 1-like protein, partial [Stegodyphus mimosarum]  clstr ali  32  431.KNAHMPSDIKTIHLEQTSYYLPGEIDFPVPSPNLFLHFGPLKLYLDTPTILWINAFYLNLQKCLMSMKTGVP-----ETPSYVNIRAEALLPQVVIPTDVNSPTQPDRPRTVQLLSSRAIATNCRLGDHTTRSDLKECLQALSADEMFSNT-SKFPWKKDK-KPIPQALFNH.. 595
159 2.000e-46gi|751469667|ref|XP_011190029.1| PREDICTED: UHRF1-binding protein 1-like isoform X1 [Bactrocera cucurbitae]  clstr ali  31  562KERYMFPAEMSVVHAEFTYFYYPGDFIFPLPPSKVFVHINPLQVHFDLSSILWLNSFALNLHESLLRTSVGTASGASSPNLMYMDVKIEAIMPRVVIESTVDVPNQKDRPKIMQIQISRFAITNIREMGSSRADLAQALHSLQEGSLVFG---TEFPAVNGDMCIVTDRILSH.. 767
160 4.000e-46gi|966671208|gb|KTG04589.1| hypothetical protein cypCar_00023795 [Cyprinus carpio]  clstr ali  39  462.....................................QLNGLQLCLDAPSVLWMTLFSRGLHRTLDQVKAFYHLQDSSKTDEHIDIRLDAKQLKLIIPLESSILDHPDRPRSLSISLPQIVLSNTRHAPHGSHSDLNSTYSSFSARPFFHPTASQFPRDQSILHPLPSAFLQH.. 598
161 6.000e-46gi|924554058|gb|ALC39333.1| CG34126 [Drosophila busckii]  clstr ali  28  525KDRYSFPAEMPIVHAEYTYFYYPGDFVFPLPPSKLFMHINPLQVHFDLSSILWLNSFGLNLHESLLRTSVGSQTNQQEPNLMYMDVKLEAIMPRVVMEAALDAPNQKDRPKIMQIQISRFALTNIREMGSSRADLAQALHSLQEGSLVFGSG---FPAKPQDMCIVTDRILSH.. 729
162 1.000e-45gi|158296730|ref|XP_555063.3| AGAP008379-PA [Anopheles gambiae str. PEST]  clstr ali  23  530......PPDMATLHAEFTYFYYPGDFVFPLPPSKAFVHINPVQVHFHLDSLLWLSSFVLNLHESLLRTNNVTSDAEQQPNIMYMDVKVECIMPRLIFEASPGAPQQRDRPKAMHVEVSRFALTNIRETGSSRADLAQAISSLQEGSLVFGSG---FPSKPGDLCIVTDRILSH.. 707
163 3.000e-45gi|968078847|ref|XP_002066642.2| LOW QUALITY PROTEIN: uncharacterized protein Dwil_GK24601 [Drosophila willistoni]  clstr ali  28  532KDRYSFPAEMPIVHAEYTYFYYPGDFVFPLPPSKIFVHVNPLQVHFDLSSILWLNSFGLSLRESLXXXXXXXXVDLEEPSLMYMDVKVEAIMPRVVLEAAVDAPNQKDRPKTMQIQISRFALTNIREMGSSRADLAQALHSLQEGSLVFGS---EFPSNEGDMCIVTDRILSH.. 730
164 5.000e-45gi|999978406|gb|KXJ17580.1| UHRF1-binding protein 1-like [Exaiptasia pallida]  clstr ali  33  509KKALYLPSDMPAFQVDYTTYYYPVGVQSPVPNPNLFVQLNPVQVTLDTTTCIWFNRFLNAIFTSADSATCMQPQQPA--KPSHVDMRIEALMPRVTLPCPSEPGCHYRRPQALQIQMSQVALTNSRVGSNTSQTELLMLLQQFSSSKLYTE-YSXFPNELNDVRPLSNL...... 676
165 5.000e-45gi|961114893|ref|XP_014780318.1| PREDICTED: UHRF1-binding protein 1-like isoform X1 [Octopus bimaculoides]  clstr ali  34  533KRVLHLPQDMPILHMEFTEYYYPEGVNLPVPHANLYVLLNPVQLRVDYLTLLWLNYFVLQLSKNLK--------ENTDGPREHIDIKFEALMPKLLIPAESSYPQVAERPDTLLVQISKMSATNKQSEEDTSHEKLLLALEEQSQCCLLKST--EFPMDQNELLVCPQHVCSH.. 696
166 7.000e-45gi|668462067|gb|KFB49571.1| hypothetical protein ZHAS_00017580 [Anopheles sinensis]  clstr ali  24  533......PPDMATLHAEFTYFYYPGDFVFPLPPSKAFVHINPVQVHFHLDSFLWLSSFVLNLHESLLRTNNVTXXXEQQPNIMYMDVKVECIMPRLIFEASPGAPQQRDRPKAMHVEVSRFALTNIRETGASRADLAQAISSLQEGSLVFGSG---FPSKPGDLCIVTDRILSH.. 711
167 3.000e-44gi|930665870|gb|KPJ06996.1| UHRF1-binding protein 1-like [Papilio machaon]  clstr ali  27  23.EKATLPGDAGLLHAELTFFYYPGDVCFPVPSPKLYVQLSPVRVSVDVPSVVWLSAFLPHVGRALATATA------AEDQTSYIDVRTEAIMPKLVLEAGPEHSQQRDRPKELHICTARATFTNVRESPRSNTAGTRADLASIISCLRRAAPHGQFPCMPDDLDPIHEQFLLHA. 191
168 6.000e-44gi|321470006|gb|EFX80984.1| hypothetical protein DAPPUDRAFT_318097 [Daphnia pulex]  clstr ali  26  487RGRFPLPDSTPIVHMEFTQFYYPGDMEFPLPQPKCFVQLNPLQVNFDGLTILWLHTFIRGLEKNLSTGASESESKSSSGPVPQLEIRLEALMPRMIFELPG-----WERPRSLQLQVSRLVCSNYRSIDNGSRADLAACLEKIQGCGGGLCFASAFPARDDDLSPISETLLKHA. 664
169 1.000e-43gi|909571009|ref|XP_013141075.1| PREDICTED: UHRF1-binding protein 1-like [Papilio polytes]  clstr ali  26  467.EKATLPGDAGLLHAELTFFYYPGDVCFPVPSPKLYVQLSPVRVSVDVASVVWLSAFLPHVARALASAADD--------QASYIDVRTEAIMPKLVLEAGPEHSQQRDRPKELHICTARATFTNVRESPRSTRADLASIISSVRGA---APRAGQFPCASGDLDPVHEQFLLHA. 633
170 1.000e-43gi|926637602|ref|XP_013784785.1| PREDICTED: UHRF1-binding protein 1-like [Limulus polyphemus]  clstr ali  31  491RTTILLPPDMKAVHLEMTYYYFPGDLDFPVPSPYVHMHLGPVYGTYDSQTVLWLNAFFLNIQNS----MXXXXXXXXXXXXXXXDVRFEALMSKVIFPCDQSYPHQLEWPQALHLQASRIVATNRRLGDHASKSHLSQCLETFSEGTLLYENNT-YPWRMGDFKPIPEGLLE... 657
171 2.000e-43gi|827538609|ref|XP_012551608.1| PREDICTED: UHRF1-binding protein 1-like isoform X1 [Bombyx mori]  clstr ali  26  493.EKATLPGDAGLLHAELTFFYYPGDDCFPVPAPKLYVQLSPVRVSLDVNSAVWLGAFLPHVAGALAPPRRGAADPDTPPPAPYMDVRMEAIMPKIVLEAGSEHSQQRDRPKELHVCTARAMLTNVRESPRGTRADLAAILSALRRAT---PPRGEFPASTEDLDPIHEQFVLHA. 667
172 2.000e-42gi|568257247|gb|ETN65576.1| hypothetical protein AND_002642 [Anopheles darlingi]  clstr ali  22  1.........MATLHAEFTYFYYPGDFVFPLPPSKAFVHINPVQVHFHLDSFLWLSSFVLNLHESLLRTSNVTSGAEHQPNIMYMDVKLECIMPRVIFEASPGAPLQRDRPKSMHVEVSRFALTNIRETGASRADLAQAISSLQEGSLVFGSG---FPSKPGDLCIVTDRILSH.. 173
173 1.000e-41gi|357623577|gb|EHJ74669.1| hypothetical protein KGM_20460 [Danaus plexippus]  clstr ali  29  489.EKATLPGDAGLLHAELTFFYYPGDICFPVPAPKLYVQLSPVRVSVDVTSLLWLTAFLPHVG------AAVVHTDDDSS--SYMDVRAEAIMPKIVLEAGPEHSQQRDRPKELQICTARATITNIRESPRGTRADLACIIASIRER---APPRGKFPTSTQDMDPVHENFVLHA. 655
174 2.000e-41gi|910336368|ref|XP_013171699.1| PREDICTED: UHRF1-binding protein 1-like isoform X1 [Papilio xuthus]  clstr ali  29  491.EKATLPGDAGLLHAELTFFYYPGDVCFPVPAPKLYVQLSPVRVSVDVPSVVWLSAFLPH------XXXXXXXXXXXXXXXSYIDVRTEAIMPKLVLEAGPEHSQQRDRPKELHICTARATFTNVRESPRSNTAGTRADLASIISCVRRAAPRGEFPCSPDDLDPIHEQFLLHA. 659
175 2.000e-41gi|930655922|gb|KPI98249.1| UHRF1-binding protein 1-like [Papilio xuthus]  clstr ali  29  450.EKATLPGDAGLLHAELTFFYYPGDVCFPVPAPKLYVQLSPVRVSVDVPSVVWLSAFLPH------XXXXXXXXXXXXXXXSYIDVRTEAIMPKLVLEAGPEHSQQRDRPKELHICTARATFTNVRESPRSNTAGTRADLASIISCVRRAAPRGEFPCSPDDLDPIHEQFLLHA. 618
176 4.000e-41gi|459177704|ref|XP_002121271.2| PREDICTED: UHRF1-binding protein 1-like [Ciona intestinalis]  clstr ali  33  465RKELLLPDDMPLGYVSITDYFYPDGRDYPAPHSNIFVRVNAPRVRVHWPSFLWCNQLALSTVRSVQKMLEDLGISSDPKEEDHVDIRVETLMPRIFIPSFKT-TEDTNSPIGLEIQVSQSTITNCRYGENCSRSSLSKVLQSIKDSYIFNNS-GSFPCEPG-YDLDHTHHALHSH 639
177 9.000e-41gi|544428522|ref|XP_005553307.1| PREDICTED: UHRF1-binding protein 1 isoform X3 [Macaca fascicularis]  clstr ali  49  496RKLHNLPTQVSAIHIEFTEYYFPDNQELPVPCPNLYIQLNGLTFTMDPVSLLWGNLFCLDLYRSLEQFKAIYKLEDSSQKDEHLDIRLDAFWLKMDSCLSQPNTLPPQRPKA............................................................... 607
178 6.000e-40gi|768442420|ref|XP_011562981.1| PREDICTED: UHRF1-binding protein 1-like, partial [Plutella xylostella]  clstr ali  26  248.ERATLPGDAGLLHAEMTHFYYPGDVCFPVPPPKLYAQLSPVRLCVDVESLIWLSAFLPHVASAL--------ISNSQPDVFYMDVRMEAIMPKIILEAGSEHSQQRDRPRELHVCTARANITNIRESNRSTRSDLASILSLLRRA---APPPGQFPGAP-PRGPLHELFTLHA. 413
179 1.000e-38gi|828219023|ref|XP_002154554.3| PREDICTED: UHRF1-binding protein 1-like [Hydra vulgaris]  clstr ali  29  454KEALYLPKEMPAIYIDHSMYYYAQNVNLPVPLANMFISLNPIQLTFHPLTCVWLNRFSQSVIAGLDWTKEL--ISREPGFAEHIDIRLEALMPKINIPLEFPDLFHTNRPKSMQIQISQAIVSNCRVGDKCTQPDILNDLQSFISSRNYADMNC-FPNMESDVTPLSN....... 620
180 4.000e-37gi|913322912|ref|XP_013192699.1| PREDICTED: UHRF1-binding protein 1-like isoform X1 [Amyelois transitella]  clstr ali  27  489.EKATLPGDAGLLHAELTFFYYPGDVCFPVPAPKLYVQVSPVRVSVDSSSVIWLGAFLPHVARALDSG------DDDGKPA-YMDVRCEAIMPKIVLEAGSEHSQQRDRPKELQICTARAILTNVRESARGTRADLAAILSALRRT---APPRGEFPCTPEDLDPIHEQFILHA. 656
181 4.000e-37gi|594626894|ref|XP_007198067.1| PREDICTED: UHRF1-binding protein 1 isoform X3 [Balaenoptera acutorostrata scammoni]  clstr ali  52  496RKLHNLPTQVSAIHIEFTEYYFPDNQELPVPCPNLYIQLNGLTFTMDPVSLLWGNLFCLDLYRSLEQFKAIYKLEDSSQKDEHLDIRLDAFWLKASSPAELKPPGDKD................................................................... 612
182 2.000e-36gi|351703722|gb|EHB06641.1| UHRF1-binding protein 1-like protein [Heterocephalus glaber]  clstr ali  84  383KKSLYLPQEMSAVYVEFTEYYYPDGKDFPIPSPNLYGQLNALQFTVDERSILWLNQFVLDLKQSLNQFMTVYKLNDNSKSDEHVDIRVDGLMLKVAINTSQSESSD..................................................................... 488
183 3.000e-36gi|908467346|ref|XP_013087362.1| PREDICTED: UHRF1-binding protein 1-like [Biomphalaria glabrata]  clstr ali  30  688...........ILHIMFNSQVLADSKAFCFPHANMYVLVNPVRLTLDFLTLLWSNVFLLTLTNSLDL------DSNEQKPSEHVDIKIEMLMPRVIVPAEEKVEGQPDRPEAVQLQISKLVVSNLRTEEKMSREDLKKLLDEYKVARLF--SQTDFPNEDGEQRLIPSMFLEHA. 850
184 3.000e-33gi|662200290|ref|XP_008473347.1| PREDICTED: UHRF1-binding protein 1-like, partial [Diaphorina citri]  clstr ali  29  488....NVPGGDVLLHAEFTYYYYPGDIKFPLPSPKFYVQLNPIQIIFDLITLLWLNAFTLNLHKNLMSTQAVTQATSSSEKLMYFDVKIEAIMMKDRLNGRSTVSSQPGRPPDTARDVSRTTLHHTRSSEQGMVADLAKCIQ.................................. 630
185 1.000e-32gi|47229287|emb|CAG04039.1| unnamed protein product, partial [Tetraodon nigroviridis]  clstr ali  48  482RKVLRLPDNVPAVHLQFTEYYFPDNPNISVPTSNLYAQVNGLQFTVDPPSVLWISLFSRGLLQALDQVKAFYHLQDSSKTDEHIDIRMDAAQLKEEEPL............................................................................ 580
186 1.000e-31gi|954253229|gb|KRX47642.1| UHRF1-binding protein 1-like [Trichinella murrelli]  clstr ali  23  470RAVMKLPSDTPTLHVELTDFYYPGTKTFTLPPSSSFLRLHPVRVFLDLRTIRWINYVFLKVNQSLSS---DSYTNEAMKNALHKDIYMDVMMPRVIVPLAPDVDWLQKVPTSMVLYSSRICLTNCLPDHSDTSHQLQQLVTEIEEQEM........................... 630
187 2.000e-31gi|954266889|gb|KRX59507.1| UHRF1-binding protein 1-like [Trichinella sp. T9]  clstr ali  23  459RAVMKLPSDTPTLHVELTDFYYPGTKIFTLPPSSSFLRLHPVRVFLDLRTIRWINYVFLKVNQSLSS---DSYTNEAMKNALHKDIYMDVMMPRVIVPLAPDVDWLQKVPTSMVLYSSRICLTNCLPDHSDTSHQLQQLVTEIEEQEM........................... 619
188 2.000e-31gi|954253228|gb|KRX47641.1| UHRF1-binding protein 1-like [Trichinella murrelli]  clstr ali  23  508RAVMKLPSDTPTLHVELTDFYYPGTKTFTLPPSSSFLRLHPVRVFLDLRTIRWINYVFLKVNQSLSS---DSYTNEAMKNALHKDIYMDVMMPRVIVPLAPDVDWLQKVPTSMVLYSSRICLTNCLPDHSDTSHQLQQLVTEIEEQEM........................... 668
189 2.000e-31gi|669328997|gb|KFD69183.1| hypothetical protein M514_01476, partial [Trichuris suis]  clstr ali  21  424REALKLPLDLPIIHAEMNDFYNLEQTDIPVPPSSRFVQVHPIRVHWHHRTFRWINYVLSQINSSLFSHST---TTDALTNALHADVFIELTMPWIQLPLGSMSEYGGRMPMAIVIRATRVTLTNCIYAQSFDRADLEKSISS-ERSYIFDRSKPSLPSDTEAYKL.......... 593
190 4.000e-31gi|954266887|gb|KRX59505.1| UHRF1-binding protein 1-like [Trichinella sp. T9]  clstr ali  23  483RAVMKLPSDTPTLHVELTDFYYPGTKIFTLPPSSSFLRLHPVRVFLDLRTIRWINYVFLKVNQSLSS---DSYTNEAMKNALHKDIYMDVMMPRVIVPLAPDVDWLQKVPTSMVLYSSRICLTNCLPDHSDTSHQLQQLVTEIEEQEM........................... 643
191 5.000e-31gi|597838030|gb|EYB87648.1| hypothetical protein Y032_0259g495 [Ancylostoma ceylanicum]  clstr ali  26  445RHLRSLPNDQYIVHFEFANFNHPMSNTLPVPAPASFLQLGPFSILFDKRTLRWCLYIVHNISTAFEQSLGF-----EMEPIPHSDVRIDLLMPKVIIPFPAPSSDDRRFPLRLLISFSTLSLSNTR................................................. 565
192 9.000e-31gi|954253230|gb|KRX47643.1| UHRF1-binding protein 1-like [Trichinella murrelli]  clstr ali  23  511RAVMKLPSDTPTLHVELTDFYYPGTKTFTLPPSSSFLRLHPVRVFLDLRTIRWINYVFLKVNQSLSS---DSYTNEAMKNALHKDIYMDVMMPRVIVPLAPDVDWLQKVPTSMVLYSSRICLTNCLPDHSDTSHQLQQLVTEIEEQEM........................... 671
193 1.000e-30gi|732853381|gb|KHJ85512.1| hypothetical protein OESDEN_14760, partial [Oesophagostomum dentatum]  clstr ali  26  269RHLRSLPNDQYIVHFEFANFIHPMSSTLPVPAPASFLQLGPFSILFDRRTLRWCLYVAHNLATALEQSLGV-----DMEPIPHSDLRVDLLMPKVIIPFPTPPTEDRRFPMRLLVSFSTFSLSNT.................................................. 388
194 1.000e-30gi|351704048|gb|EHB06967.1| UHRF1-binding protein 1 [Heterocephalus glaber]  clstr ali  44  588.........VSAIHIEFTEYYFPDNQKLPVPCSNLYVQLNNLIFTVDPVSLLWGNLFCLDLYRSLEQFKAIYKLEDSRQKDEHLDIRLDAFRLKGRESTFRPPAWNRLRSSCMVVRVD......................................................... 696
195 3.000e-30gi|915234985|ref|XP_013291783.1| hypothetical protein NECAME_15230 [Necator americanus]  clstr ali  28  458RHSRSLPNDQYIVHFEFANFVHPMSNSLPVPSPASFLQLGPFSILFDKRTLRWCLYIVHNLATAFEQSLGV-----NMEPIPHSDIRIDLLMPKVIIHFPSPSSNDRRFPLRLLISFSALSLSNT.................................................. 577
196 1.000e-29gi|826349393|ref|XP_012519440.1| PREDICTED: UHRF1-binding protein 1-like [Propithecus coquereli]  clstr ali  95  391............................................................................................TQLVIPSEMKSECHQDQPRAISIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKTYTSFPKSCDNFNLLHPIFQRHAH 473
197 3.000e-28gi|1005963978|ref|XP_015790170.1| PREDICTED: UHRF1-binding protein 1-like [Tetranychus urticae]  clstr ali  20  440RKLLKFPRDIPAFYLEFNQFYYYEARTRPVPDPVLFANVAPVKILFDAPSLIWLNALQSNLHKPLMELKQIIPRSETNVTISRFEILMPTIIVDLGIPSTDAFQSSTYNIESIQINCSRAVITNSIKEP-TYLDRLNDSLVSMGSCSLFIE-RDKFPWIEGPSRPISSGFLK... 620
198 4.000e-28gi|734555702|gb|KHN82696.1| UHRF1-binding protein 1-like [Toxocara canis]  clstr ali  28  511KSKASLPSDQPLVHLEFAAFYHPATETMPMPPNATHLLLGPFSFLLDQRTIRWVLYVYEDINNALQSLDASLEMDYIPRT----DVRVDLLMPKIIIPLGECGTRDSRMPRRVLVSMSTVLATNCES------------VHSQDACSFFSS........................ 645
199 2.000e-27gi|934159651|gb|KPM08664.1| UHRF1-binding protein 1-like protein [Sarcoptes scabiei]  clstr ali  20  479.....LPGNVPPIYIEMINYFFYDSLDLPMPEP------TPLKINFEPLTIIWINAFFANLRNALLKLQQAFPMSENHSQAE-PNVRVEVFMPTVCCRLPNDNDFQFGY-DCLELKISKIVLYNCDSYINRDYRNLDNLIKQFSMNIDFFYEHSEYPWLDCDMRPISSKFIK... 641
200 3.000e-27gi|672058470|ref|XP_003750355.3| PREDICTED: UHRF1-binding protein 1-like, partial [Rattus norvegicus]  clstr ali  87  3.............................................................................................QFVIPSEVKPGCHRDQPHTVSIQSSEMIATNTRHCPNCRHSDLEALFQDFKDIDFFSKTYTRFPKSCDSFNLLHPIFQRHAH 84
201 5.000e-27gi|768184433|gb|KJH41699.1| hypothetical protein DICVIV_12324 [Dictyocaulus viviparus]  clstr ali  19  402RHLKSLPSDQFIFHFEFVNFMHPSSNILRAPAPISFLQLGPFSILFDRRTVRWCLYVVHNISTAFKQ-----SVDTEMEFPYHSDLRIDLLLPKIIISLPMPSIDDRRFPLRLLISFSTISLSNCIIGRNMPFEMLNDAITYMRQLDLLSGGH...................... 549
202 6.000e-25gi|780027880|ref|XP_011666276.1| PREDICTED: UHRF1-binding protein 1-like [Strongylocentrotus purpuratus]  clstr ali  36  352KNTFHLPPEIPSIHVEYMSFYFPNELDFPVPAPVIYAQINPMQLRLDNTTLLWLNQFAFNVMQTLPEIDEIAPASQTSSGQDHIDIRVDALMQK................................................................................. 445
203 2.000e-24gi|1004693506|ref|XP_015746129.1| PREDICTED: UHRF1-binding protein 1-like [Python bivittatus]  clstr ali  75  52...........................................................................................MGKFIIPSERK-QKHRDDPYAISIQSSEMIATNARHSANCRHSDLEAAFQNFKDSTFFSRTFTDFPKSPDCFNLLHPIFQRHAH 134
204 5.000e-24gi|1005458329|ref|XP_015766297.1| PREDICTED: LOW QUALITY PROTEIN: UHRF1-binding protein 1-like [Acropora digitifera]  clstr ali  38  424KKALYLPTDMPAFQLDFTQYYYPNSVNSPVPCPNMFIQLNPIQVTLDTATCLWFNNFIQNVIG--ERGCSTNSPEQVKQSSRHIDIRIEALMPK................................................................................. 515
205 1.000e-23gi|802659215|gb|KKA63631.1| hypothetical protein PRIPAC_14667 [Pristionchus pacificus]  clstr ali  20  457..KRKFPGEQFVLHAEFANFFHPMSDSLPVPPPLTHVQFGPFSLLFDKRTIRWILYVAHHLTVALSQVEA-----PDMEPLPVTDFKLDLLMPKVILRLP-DPSSDSRLPHRLTVSLSTLSISNRSTEEQNHFTLLDTHLMDY................................ 591
206 1.000e-23gi|308488069|ref|XP_003106229.1| hypothetical protein CRE_15383 [Caenorhabditis remanei]  clstr ali  19  449RHLHSLPSDQQIVHVEFGTFYHPASDQLPVPNSAVYFQLGPFTITFDERTTRWCCYVAHALSSAIEDGHLIPEKELDIQPPT---IKISLVMPRLVLNLPGPFT-DFNFPRRLVTSMSTLTVS.................................................... 567
207 3.000e-23gi|576698082|gb|EUB61618.1| UHRF1-binding protein 1-like protein [Echinococcus granulosus]  clstr ali  22  467.EMHKLPVKANLISIDLTQCFALGNIDATLPI-ILYAQVNPLHLKFDVDTMIWLNAFFLNVTTNLHSLFGESELFVEQETSLPLFCRAEALMPRVVFPLHPPPPNPWTGPSALVVQVDTVILTVPRPLTTSMAKTLEDCLDKLE............................... 618
208 4.000e-23gi|954347217|gb|KRY20022.1| UHRF1-binding protein 1-like [Trichinella patagoniensis]  clstr ali  22  476..........................DVALPPSSSFLRLHPVRVFLDLRTIRWINYVFLKVNQSLSS---DSYTNEAMKNALHKDIYMDVMMPRVIVPLAPDVDWLQKVPTSMVLYSSRICLTNCLPDHSDTSHQLQQLVTEIEEQEM........................... 596
209 1.000e-22gi|954390583|gb|KRY53165.1| UHRF1-binding protein 1-like [Trichinella britovi]  clstr ali  22  454.............................LPPSSSFLRLHPVRVFLDLRTIRWINYVFLKVNQSLSS---DSYTNEAMKNALHKDIYMDVMMPRVIVPLAPDVDWLQKVPTSMVLYSSRICLTNCLPDHSDTSHQLQQLVTEIEEQEM........................... 571
210 2.000e-22gi|392927949|ref|NP_510427.2| Uncharacterized protein CELE_C44H4.4 [Caenorhabditis elegans]  clstr ali  20  450RHLHSLPSDQQIVHVEFGAFYHPHSDKLPVPNSAVYFQLGPFTISFDERTMRWCCYVAHALSSAIEDGNLIPENELDIQPPT---IKVNLVMPRLVLNLPGPFT-DFNFPRRLV............................................................. 559
211 2.000e-22gi|954390585|gb|KRY53167.1| UHRF1-binding protein 1-like [Trichinella britovi]  clstr ali  22  419.............................LPPSSSFLRLHPVRVFLDLRTIRWINYVFLKVNQSLSS---DSYTNEAMKNALHKDIYMDVMMPRVIVPLAPDVDWLQKVPTSMVLYSSRICLTNCLPDHSDTSHQLQQLVTEIEEQEM........................... 536
212 2.000e-22gi|954366343|gb|KRY32874.1| UHRF1-binding protein 1-like [Trichinella spiralis]  clstr ali  22  495...........................SSIPPSSSFLRLHPVRVFLDLRTIRWINYVFLKVNQSLFS---DSYTNEAMKNALHKDIYMDVMMPRVIVPLAPDVDWLQKVPTSMVLYSSRICLTNCLPDHSDTSHQLQQLVTEIEEQEM........................... 614
213 5.000e-22gi|340372813|ref|XP_003384938.1| PREDICTED: uncharacterized protein LOC100636695 [Amphimedon queenslandica]  clstr ali  25  518KETFNLPNDIPAFQCGITTYYYPEGNRFLVPRPNIFIYISPIHVNFHQEQCLWLAEFVQGVAQTLSAHDEGQHLLQELKAKRDVVNKLNGVDMKFYLPLPVNEVSTDGRPRALQIETGGITVEN------------HTLLFLIKDETFFPNSQNQFPHSSNDPSLLPS....... 699
214 5.000e-22JGI.Meta 7064312629 SRS019064_WUGC_scaffold_15813__gene_15583 hypothetical protein [Human Right Retroauricular crease microbiome from visit  ali  20  30....NFPGDLPALYFELNQYFYYESTTQLAPDPTLFINIAPLILLFDNPTLLWLNVLYLNLHKSLLALKDLIPENNQQTC---MLSRIEILMPTITADLGSSSLDPCEKPEFFEFKCSRIVIGNN-LRDSSKTESVNCLFHVMASSSLFIK-VNRYPW................. 187
215 7.000e-22gi|954266891|gb|KRX59509.1| UHRF1-binding protein 1-like [Trichinella sp. T9]  clstr ali  22  483.............................LPPSSSFLRLHPVRVFLDLRTIRWINYVFLKVNQSLSS---DSYTNEAMKNALHKDIYMDVMMPRVIVPLAPDVDWLQKVPTSMVLYSSRICLTNCLPDHSDTSHQLQQLVTEIEEQEM........................... 600
216 7.000e-22gi|954500523|gb|KRZ29166.1| UHRF1-binding protein 1-like [Trichinella pseudospiralis]  clstr ali  22  502.............................LPPSSSFLRLHPVRVFLDLRTIRWINYVFLKVNQSLFS---DSYTNEAMKNALHKDIYMDVMMPRVIVPLAPDVDWLQKVPTSMVLHSSRICLTNCLPDHSDSSHQLQQLVTEIEEQEM........................... 619
217 8.000e-22gi|954303622|gb|KRX91953.1| UHRF1-binding protein 1-like [Trichinella pseudospiralis]  clstr ali  25  458RAVMKLPSDTPTLHVELTDFYTKERTHYPVPPSSSFLRLHPVRVFLDLRTIRWINYVFLKVNQSLFS---DSYTNEAMKNALHKDIYMDVMMPRV................................................................................ 549
218 1.000e-21gi|954483349|gb|KRZ13110.1| UHRF1-binding protein 1-like [Trichinella zimbabwensis]  clstr ali  22  385.............................LPPSSSFLRLHPVRVFLDLRTIRWINYVFLKVNQSLFS---DSYTNEAMKNALHKDIYMDVMMPRVIVPLAPDVDWLQKVPTSMVLHSSRICLTNCLPDHSDNSHQLQQLVTEIEEQEM........................... 502
219 1.000e-21gi|954483346|gb|KRZ13107.1| UHRF1-binding protein 1-like [Trichinella zimbabwensis]  clstr ali  22  430.............................LPPSSSFLRLHPVRVFLDLRTIRWINYVFLKVNQSLFS---DSYTNEAMKNALHKDIYMDVMMPRVIVPLAPDVDWLQKVPTSMVLHSSRICLTNCLPDHSDNSHQLQQLVTEIEEQEM........................... 547
220 1.000e-21gi|391326686|ref|XP_003737843.1| PREDICTED: UHRF1-binding protein 1-like [Metaseiulus occidentalis]  clstr ali  23  468...........AIFIDFTSYYYPGSSDLSPPQPYCYVNLGPSIIRLDIPTLLWGVAFMRSIIRNLFIFSHETPITM---------CRVEIYLTKVMF-------------DEVVAQCSRIICSNSREGISSSRAELKQALDSFSRGPLFFET-NKYPWSDGDLRAVSQHIVNH.. 614
221 2.000e-21gi|268581685|ref|XP_002645826.1| Hypothetical protein CBG07557 [Caenorhabditis briggsae]  clstr ali  19  441RHLHSLPSDQQIVHVEFGTFYHPHSDKLPVPNSAVYFQLGPFTVSFDERTTRWCCYVVHALSSAIEDGNLIPEKDLDVRPPT---IKISLLMPRLVLNLPGPFT-DFNFPQRLV............................................................. 550
222 2.000e-21gi|312078896|ref|XP_003141939.1| hypothetical protein LOAG_06355 [Loa loa]  clstr ali  28  451.......DNSSLFHLEFTSFYHPTSENFPVPSNITHLLLGPFFFVVDQRTIRWLLFIIDDIKYALQISNAVPEVTKIPRT----YLRINLLMPKIIIPLKDPFVSDLRFARRIVISMNTLLATNCEAVSGGRSNSISANIIDFINC............................. 589
223 2.000e-21gi|954600425|gb|KRZ77396.1| UHRF1-binding protein 1-like [Trichinella papuae]  clstr ali  22  459.............................LPPSSSFLRLHPVRVFLDLRTIRWINYVFLKVNQSLFS---DSYTNEAMKNALHKDIYMDVMMPRVIVPLAPDVDWLQKVPTSMVLHSSRICLTNCLPDHSDNSHQLQQLVTEIEEQEM........................... 576
224 9.000e-21gi|510853600|gb|EPB69659.1| hypothetical protein ANCCEY_11245 [Ancylostoma ceylanicum]  clstr ali  28  412...........................FTIPAPASFLQLGPFSILFDKRTLRWCLYIVHNISTAFEQSLGF-----EMEPIPHSDVRIDLLMPKVIIPFPAPSSDDRRFPLRLLISFSTLSLSNTR................................................. 505
225 1.000e-20gi|313224737|emb|CBY20528.1| unnamed protein product [Oikopleura dioica]  clstr ali  29  418.KKLNLPSEIPLFHYEATEYYTPDGSDYVLPHNNQYIQVNAPVIDFDEETVIWMSKILKNASKCINEALVELGIDEDASTNDHVDMLVDIILPSINF-------------GELHLEASSISLTN................................................... 529
226 3.000e-20gi|309362795|emb|CAP27564.2| Protein CBG07557 [Caenorhabditis briggsae]  clstr ali  21  462RHLHSLPSDQQIVHVEFGTFYHPHSDKLPVPNSAVYFQLGPFTVSFDERTTRWCCYVVHALSSAIVR-NLLSEEDGNLIPEKDLDVRISLLMPRLVLNLPGPFT-DFNFPQRLV............................................................. 578
227 7.000e-20gi|954347216|gb|KRY20021.1| UHRF1-binding protein 1-like [Trichinella patagoniensis]  clstr ali  19  522RAVMKLPSDTPTLHFHRVAVFYD---------------------CILFETIRWINYVFLKVNQSLSS---DSYTNEAMKNALHKDIYMDVMMPRVIVPLAPDVDWLQKVPTSMVLYSSRICLTNCLPDHSDTSHQLQQLVTEIEEQEM........................... 647
228 1.000e-19gi|1009541130|ref|XP_015906902.1| PREDICTED: UHRF1-binding protein 1-like [Parasteatoda tepidariorum]  clstr ali  28  436............................................................................TTETPSYVNIRVEALLPQVVIPSDAHSPTQPDRPRTLQLQASRVVATNCRLGDHTTKNDLKECLYILNSKEIFSNT-SKFPWR-NDRKPYSNVFFEH.. 530
229 2.000e-19gi|685836168|emb|CEF71088.1| Vacuolar protein sorting-associated protein 13A N-terminal domain-containing protein [Strongyloides ratti]  clstr ali  23  450.....LPVDMGIIHFEYCTYEYGEDKTLPPPSPSAYVAIGPIEAKIDPRTIRWLVYIGDQLKE-VVPIDELNNLSSETSPGDEVVVRIEMISTKIILEQSCSHNMDERYPKEFFINIDKANITNC.................................................. 568
230 2.000e-19gi|353231643|emb|CCD78998.1| hypothetical protein Smp_141600 [Schistosoma mansoni]  clstr ali  30  433KLLHNLPDTSSFLTIEFKNYYCPSSSNQSLPCS-LFCQINPFYINFDPDTVIWLNTFLLALQSNLSTFLCGRDMNPSNQSNRLFDVRLEALMPRLIFSLFGQSNRHTNGPHALILQSDQIIAPISSHVADCLKKLLDNL.................................... 592
231 2.000e-18gi|844865020|ref|XP_012798991.1| UHRF1-binding protein 1-like [Schistosoma haematobium]  clstr ali  30  357KLLHNLPDTSSFLTIEFKNHYCVDDTNQSLPCS-LFCQINPFYINFDPDTVIWLNIFLLALQLNLSTFLSGRDTNHPSKQPNRLHVRLEALMPRLIFSLFGQSNRHTNGPHALILQSDQIIAPISSHVADCLKKLLDNL.................................... 516
232 2.000e-18gi|402580209|gb|EJW74159.1| hypothetical protein WUBG_14932, partial [Wuchereria bancrofti]  clstr ali  29  122.......GDYPVFHLEFTSFYHP-----TLPSNITHLLLGPFFFVVDQRTIRWLLFIIDDIKYALQISSAMPEASKIPKT----YLRINLFMPKIIIPLKDSFVSDTRFARRIVISMSTLLATN................................................... 229
233 2.000e-17gi|1009588523|ref|XP_015923525.1| PREDICTED: UHRF1-binding protein 1-like, partial [Parasteatoda tepidariorum]  clstr ali  37  183.KSAHMPSDIKTIHLEQTSYYLPGDFDFFVPSPNLFLHIGPLKLYLDTPTMLWINAFYLNLEKCL.............................................................................................................. 246
234 6.000e-17gi|871249257|ref|XP_012940999.1| PREDICTED: uncharacterized protein LOC101863599 [Aplysia californica]  clstr ali  27  56............................................................................EDKPAEHKDIKVELLMPRVIIPAEEKVESQPDRPDALQLQISKLVVCNRRTEERMGREDLRTLLEQYASERLLSS--KEFPMDEAAATAIPQLLFQHAN 158
235 6.000e-17gi|674594318|emb|CDS26893.1| UHRF1 binding protein 1 [Hymenolepis microstoma]  clstr ali  24  393...HKLPVKTDLIAMDFTQCLSSESPDTVLPM-ILFAQINPLHIKFDVDTIIWLNAFLLNLTANLQSLFGETENTAHQTTPPPLFYRVESLMPRVILPMVPPPYNPWTGPSALVMQIDQVIL..................................................... 520
236 4.000e-16gi|939259065|ref|XP_014249349.1| PREDICTED: UHRF1-binding protein 1-like [Cimex lectularius]  clstr ali  26  494.............................................................................................KVIFESNVEIQCQRDRPKALHIQVSRALISNVRSSDGCSRADLAKCVNALQLGSLFFGN--EFPVKEGDFAVIPDKFIDH.. 572
237 3.000e-14gi|358341102|dbj|GAA48862.1| UHRF1-binding protein 1-like [Clonorchis sinensis]  clstr ali  22  478KKLHCLSESVYFLTVELNNIYRPGMEADTLPC-FFFAQLKPFYVRFDADTVIWLNMFLLTLHLNLYTLMRQTSLQDTGEPKSY-HLRCEALMPRLLLPLCSAKPNNSPGPDMLVLQADQL....................................................... 609
238 6.000e-14gi|684374782|ref|XP_009164855.1| hypothetical protein T265_12977, partial [Opisthorchis viverrini]  clstr ali  24  473KKLHCLPESVYFLTVELNNIYYPSKQRPTLPC-FFFAQLKPFYVRFDADTVIWLNMFLLTLHLNLYTLMRQTSLQDTGEPKSY-HLRCEALMPRLLLPLCSAKPSSSPGPDMLVLQADQL....................................................... 605
239 3.000e-13gi|470296426|ref|XP_004345332.1| hypothetical protein CAOG_06583 [Capsaspora owczarzaki ATCC 30864]  clstr ali  26  509..LLNLPPGTPVLHADMVAYYIVAADQLSMPPSNVFFNLNPIQLVFDR--LQWLNVF--DFMESITNMTAHLELPKRADDDERVVVRVELLLPKIILPPYAGHHGPPEIAQVLSLSASKICVTN................................................... 650
240 6.000e-09gi|675849914|ref|XP_009010517.1| hypothetical protein HELRODRAFT_116796 [Helobdella robusta]  clstr ali  31  467KKRLILPQDMSTLHVDVTN-YTSVGPSSEL-SSSMFITINPICLSVDYLSLVWLHTFILNVMKKAVSFL.......................................................................................................... 533
241 8.000e-05gi|1020537661|ref|XP_016106928.1| PREDICTED: UHRF1-binding protein 1-like [Sinocyclocheilus grahami]  clstr ali  48  494RKSLHLPDNTPAIHLQFTEYYFPDNPGLP.................................................................................................................................................. 522
242 8.000e-05gi|966645589|gb|KTF80501.1| hypothetical protein cypCar_00019336, partial [Cyprinus carpio]  clstr ali  75  456KKILYLPQEMPAIHAEFTEYYFPDGKDYP.................................................................................................................................................. 484

FFAS is supported by the NIH grant R01-GM087218-01
1 1 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40.