current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: sp|A0JNW5|UH1BL_HUMAN UHRF1-binding protein 1-like OS=Homo sapiens GN=UHRF1BP1L PE=1 SV=2 (Range: 488-662), from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst KKSLYLPQEMSAVYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILWLNQFLLDLKQSLNQFMAVYKLNDNSKSDEHVDVRVDGLMLKFVIPSEVKSECHQDQPRAISIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKTYTSFPKSCDNFNLLHPIFQRHAHLast
1 -107.000sp|A0JNW5|UH1BL_HUMAN UHRF1-binding protein 1-like OS=Homo sapiens GN=UHRF1BP1L PE=1 SV=2 (Range: 488-662)  ali  100  1KKSLYLPQEMSAVYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILWLNQFLLDLKQSLNQFMAVYKLNDNSKSDEHVDVRVDGLMLKFVIPSEVKSECHQDQPRAISIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKTYTSFPKSCDNFNLLHPIFQRHAH 175
2 -93.600sp|Q6BDS2|URFB1_HUMAN UHRF1-binding protein 1 OS=Homo sapiens GN=UHRF1BP1 PE=1 SV=1 (Range: 498-728)  ali follow..  49  1..LHNLPTQVSAIHIEFTEYYFPDNQELPVPCPNLYIQLNGLTFTMDPVSLLWGNLFCLDLYRSLEQFKAIYKLEDSSQKDEHLDIRLDAFWLKVSFPLEKRERAELHRPQALVFSASGMIATNTRHAPHCSCSDLQSLFRGFAAAEFFHSNYDHFPKVPGGFSLLHMLFLHHAF 173
3 -6.840sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 610-741)  ali follow..  15  16.................................RLNVSTRPLNIIYNPQAIKKVADFFYKTKAEIRQTLDRLLVGDFIEESKRWTVRLDISAPQVIFPDDFKFKN----PVLVVVDLGRMLL..................................................... 132
4 -6.480sp|Q13057|COASY_HUMAN Bifunctional coenzyme A synthase OS=Homo sapiens GN=COASY PE=1 SV=4 (Range: 24-170)  ali follow..  12................................HTLYVHLQP-----GMSLEGPAQPQSSPVQATFEVLDFITHLYAGADVHRHLDVR-------ILLTNIRTKSTFLPPLPTSVQNLAHVVLTDFQTLDGSQYNPVKQQLVRYATSCYS.......................... 119
5 -5.980sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 1753-1883)  ali follow..  14  1..................................................................................RLLMDINLKAPVIIIPQSSVS------PNAVIADLGLIRVENKFSLVPMEHYSLPPVIDKMN............................... 56
6 -5.770sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 1239-1372)  ali follow..  14  1...................................................................................VSINIDLKAPVIVIPQSSIS------TNAVVVDLGLIRVHNQFSLVSDEDYLNPPVIDRMD............................... 55
7 -5.680sp|Q6STE5|SMRD3_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3 OS=Homo sapiens GN=SMARCD3 PE=1 SV=1 (Range: 103-258)  ali follow..  14  1................MADKILPQRIRELVPESQAYMDLLAFERKLDQTIMR------VDIQEALKRPMKQKRKEDSDGSIASWELRVEG---KLLDDPSKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTPTTQETDGFQ............................... 137
8 -5.650sp|Q2TAZ0|ATG2A_HUMAN Autophagy-related protein 2 homolog A OS=Homo sapiens GN=ATG2A PE=1 SV=3 (Range: 583-711)  ali follow..  1.................................ELALDLANFQADVELGALDRLAALLRLAVPAEPPAGLLTEPLPAMEQQTVFRLSAPRATLRLRFPIADLRPEPDPRAEQLRLELSEPQFRSELSSGPGPPVPTHLELTCSDLHGIYEDGGKP.................... 129
9 -5.530sp|Q14444|CAPR1_HUMAN Caprin-1 OS=Homo sapiens GN=CAPRIN1 PE=1 SV=2 (Range: 145-257)  ali follow..  13  3................................................KTVLELQYVLDKLGDDEVR-TDLKQGLNGVPILSEEELSLLDEFYKLVDPERDMSLRLNEQYEHASIHLWDLLEGKEKPVCGTTYKVLKEIVERVFQSNYFDSTHN..................... 107
10 -5.380sp|Q96GM5|SMRD1_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 OS=Homo sapiens GN=SMARCD1 PE=1 SV=2 (Range: 134-290)  ali follow..  1......................PQRIRELVPESQAYMDLLAFERKLDQTIM-----------------RKRLDIQEALKRPIKQKRKLRIFISNTFNPAKSDAEDGEGTVASWELRVEGRLLEDSALSKYDATKQKRKFSSFFKSLVIELDKDLYGPDNH............... 121

FFAS is supported by the NIH grant R01-GM087218-01
1 1 3 7 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.