current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: sp|A0JNW5|UH1BL_HUMAN UHRF1-binding protein 1-like OS=Homo sapiens GN=UHRF1BP1L PE=1 SV=2 (Range: 488-662), from NEW_HUMAN_DOMAINS

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst KKSLYLPQEMSAVYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILWLNQFLLDLKQSLNQFMAVYKLNDNSKSDEHVDVRVDGLMLKFVIPSEVKSECHQDQPRAISIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKTYTSFPKSCDNFNLLHPIFQRHAHLast
1 -90.900sp|A0JNW5|UH1BL_HUMAN UHRF1-binding protein 1-like OS=Homo sapiens GN=UHRF1BP1L PE=1 SV=2 (Range: 451-750)  ali follow..  100  38KKSLYLPQEMSAVYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILWLNQFLLDLKQSLNQFMAVYKLNDNSKSDEHVDVRVDGLMLKFVIPSEVKSECHQDQPRAISIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKTYTSFPKSCDNFNLLHPIFQRHAH 212
2 -89.100sp|Q6BDS2|URFB1_HUMAN UHRF1-binding protein 1 OS=Homo sapiens GN=UHRF1BP1 PE=1 SV=1 (Range: 451-750)  ali follow..  49  46RKLHNLPTQVSAIHIEFTEYYFPDNQELPVPCPNLYIQLNGLTFTMDPVSLLWGNLFCLDLYRSLEQFKAIYKLEDSSQKDEHLDIRLDAFWLKVSFPLEKRERAELHRPQALVFSASGMIATNTRHAPHCSCSDLQSLFRGFAAAEFFHSNYDHFPKVPGGFSLLHMLFLHHAF 220
3 -62.300sp|A0JNW5|UH1BL_HUMAN UHRF1-binding protein 1-like OS=Homo sapiens GN=UHRF1BP1L PE=1 SV=2 (Range: 301-600)  ali follow..  100  188KKSLYLPQEMSAVYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILWLNQFLLDLKQSLNQFMAVYKLNDNSKSDEHVDVRVDGLMLKFVIPSEVKSECHQDQPRAI.............................................................. 300
4 -58.900sp|Q6BDS2|URFB1_HUMAN UHRF1-binding protein 1 OS=Homo sapiens GN=UHRF1BP1 PE=1 SV=1 (Range: 301-600)  ali follow..  52  196RKLHNLPTQVSAIHIEFTEYYFPDNQELPVPCPNLYIQLNGLTFTMDPVSLLWGNLFCLDLYRSLEQFKAIYKLEDSSQKDEHLDIRLDAFWLKVSFPLEKRERA...................................................................... 300
5 -31.700sp|Q6BDS2|URFB1_HUMAN UHRF1-binding protein 1 OS=Homo sapiens GN=UHRF1BP1 PE=1 SV=1 (Range: 601-900)  ali follow..  45  1.........................................................................................................ELHRPQALVFSASGMIATNTRHAPHCSCSDLQSLFRGFAAAEFFHSNYDHFPKVPGGFSLLHMLFLHHAF 70
6 -27.600sp|A0JNW5|UH1BL_HUMAN UHRF1-binding protein 1-like OS=Homo sapiens GN=UHRF1BP1L PE=1 SV=2 (Range: 601-900)  ali follow..  100  1.................................................................................................................SIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKTYTSFPKSCDNFNLLHPIFQRHAH 62
7 -11.500sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 1051-1350)  ali follow..  13  130.................................VLSLNVGCIQIVYLHKFLMSLLNFLNNFQTAKESLSAATAVKDLAQRSFRVSINIDLKAPVIVIPQSSIS------TNAVVVDLGLIRVHNQFSLVSDEDYLNPPVIDRMD............................... 243
8 -11.500sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 1951-2250)  ali follow..  13  1..................KYGRPDPLLRREHDIRVSLRMASVQYVHTQRFQAEVVAFIQHFTQLQDVLGRQRAVRDQAQRCSRVLLDIEAGAPVLLIPESSRS------NNLIVANLGKLKVKN................................................... 106
9 -10.800sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 1501-1800)  ali follow..  13  195.................................KLSFKVGCIQIVYVHKFFMSLLNFLNNFQTAKEALSTATVMKDLAQKSFRLLMDINLKAPVIIIPQSSVS------PNAVIADLGLIRVENKFSLVPMEHYSL....................................... 300
10 -10.800sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 1651-1950)  ali follow..  12  9KKAVSILGD-EVFRFQLTLYPDATEGE------KLSFKVGCIQIVYVHKFFMSLLNFLNNFQTAKEALSTATVMKDLAQKSFRLLMDINLKAPVIIIPQSSVS------PNAVIADLGLIRVENKFSLVPMEHYSLPPVIDKMN............................... 158
11 -10.700sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 (Range: 1051-1350)  ali follow..  98.................................QVNLIVGCIEVVFVTKFLYSILAFIDNFQAAKQALAEATVVKELAQRSSRMALDINIKAPVVVIPQSPVS------ENVFVADFGLITMTNTFHMITESQSSPPPVIDLIT............................... 211
12 -10.300sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 1801-2100)  ali follow..  12  140.......SGEEALIFQTFKYGRPDPLLRREHDIRVSLRMASVQYVHTQRFQAEVVAFIQHFTQLQDVLGRQRAVRDQAQRCSRVLLDIEAGAPVLLIPESSRS------NNLIVANLGKLKVKN................................................... 256

FFAS is supported by the NIH grant R01-GM087218-01
1 1 6 5 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40.