current user: public




Query: gi|13507742|ref|NP_109691.1| DNA gyrase subunit B MPN003 [Mycoplasma pneumoniae M129], from M.pneumoniae

Results of PSI-BLAST search in nr85s
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650
# E-value Template Links and tools%idFirst MEDNNKTQAYDSSSIKILEGLEAVRKRPGMYIGSTGEEGLHHMIWEIIDNSIDEAMGGFASTVKLTLKDNFVTIVEDDGRGIPVDIHPKTNRSTVETVFTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSSFKVWVAREHQQYFLAFHNGGEVIGDLVNEGKCDKEHGTKVEFVPDFTVMEKSDYKQTVIASRLQQLAFLNKGIQIDFVDERRQNPQSFSWKYDGGLVQYIHHLNNEKEPLFEDIIFGEKTDTVKSVSRDESYTIKVEVAFQYNKTYNQSIFSFCNNINTTEGGTHVEGFRNALVKIINRFAVENKFLKETDEKITRDDICEGLTAIISIKHPNPQYEGQTKKKLGNTEVRPLVNSIVSEIFERFMLENPQEANAIIRKTLLAQEARRRSQEARELTRRKSPFDSGSLPGKLADCTTRDPSISELYIVEGDSAGGTAKTGRDRYFQAILPLRGKILNVEKSHFEQIFNNVEISALVMAVGCGIKPDFELEKLRYNKIIIMTDADVDGAHIRTLLLTFFFRFMYPLVEQGNIYIAQPPLYKVSYSNKDLYMQTDVQLEEWKQQHPNLKYNLQRYKGLGEMDAIQLWETTMDPKVRTLLKVTVEDASIADKAFSLLMGDEVPPRREFIEQNARNVKNIDILast
1 0.000e+00gi|294155877|ref|YP_003560261.1| DNA gyrase, B subunit [Mycoplasma crocodyli MP145]  clstr ali  53  2....EKNNNYEASNIKFLEGLEHVRRRPGMYIGTTSKDGLHHMIWEIVDNSVDEAMAGFANIIQITITDDDRIIVEDNGRGIPVGIHERFGISALEVVLTKLNAGGKFESNAYKVSGGLHGVGASVVNALSDSMKAWVKREGKIHFAEFANGGVTIKSTEVIGTYEGDSGTKIEFHPDFTIMEKVPFDKELVVDHAKQIAHLNKGLFVSVKDLRDNTY--EEFKFDNGIIDYVNELNEGYTPINQEVIFAEGTYLS--VHNGNERSIGVEIAAQYLSDFRSNIISYANNIATHEGGTHVSGFYDSVMRIVNNYAIENGIIKNEAEKFSREDLTEGLTAIISVKHPDPQFEGQTKGKLGSKDARMAVNKVFSEVFERLLNENPVLSKKIIENAVYARKGRLAANAARDNAKRKSAFDNGGLPGKLADCASKNAEVSELYLVEGNSAGGSAKMGRDRNTQAILPLRGKVLNVERARQDRVVNNEEIMSLVTALGTSLGDTFNINKLRYHKIVIMTDADVDGAHIRTLLLTFFYRYFKPLIEYGFIYIAQPPLYKIQQNKTVEYAYNDAQKDEIITKLPTQKINIQRYKGLGEMDPEQLWETTMDPKNRKMLQVQIEDAYKADWAFSTLMGENVEPRREFIEKNAKYVKNID. 645
2 0.000e+00gi|73697709|gb|AAZ81471.1| DNA gyrase subunit B [Acholeplasma palmae]  clstr ali  55  1.......................VRKRPGMYIGSTGERGLHHLVWEIVDNSIDEALAGYADTITVEVLKDNIIRVTDNGRGIPVGIHHKTGKPAVETILTTLHAGGKFDGSSYKVSGGLHGVGASVVNALSSYFIVEVHVNGKIHKQRFEKGFPVTG-LDIIGDTTHQ-GTVITFLADPDVFETTIYDFETLRSRVQQLAFLNRNIKITITDDRKEEPVSFTYHYEGGLLEYIDFLTGTKTKINANKFYAEK----------EVDGITLEVALQYTDSYATNLYSFTNNIPTHEGGMHEDGFKMALNRVLAKYAKDNNLLK-KDEPFISDDTREGLTAIISVKHPDPQFEGQTKTKLGNVEVRQIASQVVGETFERYLLENPTDAKAIIDKSLLXXXXXXXXXXXXXXTRRKSPLDALGFASKLADCRSKNPAISELYIVEGDSAGGSAKQGRESEYQAILPLRGKVLNVEKARIDKVLSNNEILSLIQAIGTGIGEEFNPEKARYHKIVIMTDADVDGAHIRTLLLTFFFRYFKPLIDLGYIYFAQPPLYKLQFGKKVEYVYDDEALPKALEQLGG-KPSMQRYKGLGEMNPEQLWETTMDPETRTLLQVTMKDAIEADQVFN.......................... 588
3 0.000e+00gi|163838775|ref|YP_001623180.1| DNA gyrase subunit B [Renibacterium salmoninarum ATCC 33209]  clstr ali  49  35...SPEESHYDASDITVLEGLEAVRKRPGMYIGSTGPRGLHHLITEVVDNSVDEALAGYCTHIEITLQADGGVRVDDDGRGIPVDMHPTEGKPTVEVVMTVLHAGGKFGGGGYAVSGGLHGVGISVVNALSTRVETTVKRQGFAWHQSFADGGQPVGTLRK-GEPTDETGTTQLFYADGSIFESTEYDFETLRARFQQYSFLNKGLRITLTDERVTESVEEEYQYDNGLIDYVTYLNSSKEVINPDVIAFESENKDLNG-----RSIALELAMQWTTAYSESVHTYANTINTHEGGTHEEGFRAAMTSLINRYAREKNIIKEKDENLTGDDIREGLTAVISVKLSEPQFEGQTKTKLGNSEAKGFVQRVVTDELGDWLERNPGPARDVIRKSIQAAQARLAARKARESTRRKGLLESGGMPGKLKDCQSKDPSKSEIYLVEGDSAGGSAVRGRNPETQAILPLRGKILNVERARLDRALGNAEVQAMITAFGAGIGEDFDVEKARYHKIVLMADADVDGQHITTLLLTLLFRYMRPLVEHGYVYLAQPPLYRIKWSNAPHYVYSDKERDEALTKGAAAGHRIQRYKGLGEMDYTELWETTMDPDHRTLLQVTMDDAASADQTFSILMGEDVESRRHFIQTNAKDVRFLDI 702
4 0.000e+00gi|403251938|ref|ZP_10918253.1| type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit [actinobacterium SCGC AAA027-L06]  clstr ali  46  13...KKEHKGYDASNITVLEGLDAVRKRPGMYIGSTGERGLHHLVYEVVDNSVDEALAGYCTEINIVLQKDGSVKVIDNGRGIPVDIHPVEKKPALEVVLTVLHAGGKFGDGGYSVSGGLHGVGISVVNALSTDLSVEVKRDGFNWNQSYKLGVP-TAPVKK-GSATEDSGTTVIFWPSKEIFETTDFSFETLSTRFREMAFLNKGLILTLTDERKGNPLNVRYEYSDGIIDFVKHLNMSKGATHKSIISFATEEAKHK--------MSLEVAMQWNTGFSESVYTFANTINTQEGGTHEEGFRTSLTSIVNKFGEEWGFIRKKEDRLTGDDVREGLTAIVSIKIGEPQFEGQTKTKLGNTEAKSFTQKAMNDHLTSWFEKNPSEGKDIVRKSIDXXXXXXXXXXXXDLSRRKGLLEGRGMPGKLADCQWTEPEKCELYIVEGDSAGGSTKGGRDSRYQAVLPIRGKILNVEKARIDRVLQNNEVQALITALGTGIHDDFDLAKLRYHKIILMADADVDGQHIRTLLLTLLFRFMKPLIENGFVYLAQPPLYKLKWGGKEQYAFSDKERDGFIQMGLDNGKRIQRFKGLGEMPAKELWDTTMDPATRVLIKVTLEDAAAADDLFSVLMGEDVELRRSFIQRNAKDVRFLDI 664
5 0.000e+00gi|366088550|ref|ZP_09455023.1| DNA topoisomerase IV subunit B, partial [Lactobacillus acidipiscis KCTC 13900]  clstr ali  46  1.........YNDDSIQVLKGLEAVRKRPGMYIGSTDTHGLHHLVYEIVDNAVDEALSGYGKKIDVTIHADESITVCDYGRGMPVGMHS-TGIPTVEVIFTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSSSLTVNTVRDGIEYEEDFKDGGQPIGTLRKIGKTKRPSGTKVTFKPDQTIFSTTHYHYDVLAERLRESAYLLKGVQITLTDERND--QQDIFLYEEGIKEFVSYLNEDKETIGDVMYF-----------DGSKQGMEVEVAAQYNDGYSENVLSFVNNVRTKDGGTHEAGLRSAWTKAFNDYARSVGLLKDKDKNMEGSDVREGLSAVISVRVPEEQFEGQTKEKLGTPEARTIVDGIVAEQLNYYLMENGEFAQDLVRKSLXXXXXXXXXXXXXDESRKKRRKKDQLLSGKLTPAQSKNAKKNELFLVEGDSAGGSAKQGRDRKFQAILPLRGKVLNTERAKLQDIVKNEETNTMIYTIGAGVGAEFNLEDANYDKIVIMTDADTDGAHIQILLLTFFYKYMRPMIDAGRVYIALPPLYKVKKKQVIEYAWTDEELKKVSQEMG-KGYSLQRFKGLGEMNADQLWETTMDPETRTLVRVKIDDGALAEKRVTTLMGDKVEPRRKWIEKNVKF...... 628
6 0.000e+00gi|386774998|ref|ZP_10097376.1| DNA gyrase subunit B [Brachybacterium paraconglomeratum LC44]  clstr ali  48  48....RAPEHYEASDITVLEGLEAVRKRPGMYIGSTGERGLHHMVQEIVDNSVDEAMAGHGDTIEVTLLADGGVRVVDHARGIPVDMHPTENKPAVELVLTVLHAGGKFGGGGYAVSGGLHGVGSSVVNALSIRMEVEIRRQGHVWRQAYSRGVP-EAPLEK-GEETDETGTTITFWADGEIFDSTEYDFETLRKRFQQMAFLNKGLRITLTDERADEPRTVSYLYERGLQDFVEFINSAKEVIHPDIISFESEDTDAK--------ISVEVAMQWTGAYTDSVHTYANTINTHEGGTHEEGFRSSLTSIVNRYGRAQGLLKEKDANLTGEDIREGLTAVISVKLGEPQFEGQTKTKLGNTIARTFMVKVMTDQLTDWFESHPNEAKAIVMKGQXXXXXXXXXXXXXDATRRKSPLETGGMPGKLRDCSSRNPAESEIFIVEGDSAGGSAVQGRDPRTQAILPIRGKILNVEKARLDRALDNQEVRSLITAFGTGIGEDFDATKLRYHKIILMADADVDGQHICTLLLTLLFRYMRPLIELGHVFIAMPPLYRLKWSNAHEYVFSDEERDERLTAGQSAGRRIQRYKGLGEMDWKELQSTTMDTATRTLKQVTVDEAADADTIFSVLMGDDVESRRRFIQENAKDVRFLDI 716
7 0.000e+00METAHIT MH0012 GL0032081 [Complete] locus=scaffold7392_9:5000:6955:+  ali  46  2.......SNYNAGDLQVLKGLDAVRMRPGMYIGTTGTKGLHHLLWEIVDNSIDEAANGYGDTVRVTLYKDGSASVEDNGRGIPVDIHPQLGISGVEVVYTQLHAGGKFSGKNYNYSGGLHGVGASVVNALSEWLVCESYIGYTAYRQEFAISGKPMTPLVKIGNTRKK-GSKTTFLPDKRVFEDTVFNHDTVDRRLRELAYLNKGVSIVFTDERPVAEREVTYCYEGGIVDYVRYLNAEKNPLHEDVIYLE----------GGKDDFYYRCAFQLTDSYTESMFSYVNSIPTGEGGTHETGFKAAYTRAMNEYARRVGILKEKDANLTGDDYREGMTVVLTCFVKNPQFEGQTKGRLGNSEVRPLIEGLVYDQLNEYLENHQETAAKLMEKACAAASVREAARKAKDIARQKSSLEAAPLVGKLSSCTGRRPEENELFIVEGDSAGGSAKQGRDRRFQAILPLRGKPLNAEKKRLDQVLMNEEFRSLITALGTGIGEEFKLSALKYHRIIILADADQDGAHIRAILLTFFFRYMKELILNGHVYIGTPPLYLVKKGQMSEYVYDDKALPAAVKRMG-KGYAIQRYKGLGEMNPEQLWDTTMNPAHRTLVQVTLEDAAMAERMVTILMGDKVEPRRVYISEHA........ 637
8 0.000e+00gi|293400718|ref|ZP_06644863.1| DNA topoisomerase IV, B subunit [Erysipelotrichaceae bacterium 5_2_54FAA]  clstr ali  48  1MAE----KTYDGSSIQILDGLDAVRKRPGMYIGSTDGRGLHHLVWEIVDNSIDEALNGFGETIKITIEKDGVICVEDEGRGMPVDMH-VSGVPTLQVIHTVLHAGGKFSQGGYKTSGGLHGVGASVVNALCSWMEVSVYRDGKIYQMRFEDGGKKIGKLEVIGKTNK-TGSKTRFMPDKKIFSTTRFSFSQIAERAQEDAFLLEGLRLVVRDEREGKEREEVYHYEEGLVAFMEYLHEDKQTFHKPVAF-----------SGEVNGIKVDCAFQYTDEYQENIFSFVNIVRTKDGGTHETGARNAFTKVFNDYARRNGLLKEKEKNFEGSDVREGLTIILSLGIPENQFEGQTKGKLGTPEAKNAVDSIVSEKLNFFLEENKELATTLIKKMQRASTAREAARKAREDARKGKSKGKSELSGKLASAQSKDARKKELYLVEGDSAGGSAKQGRDSKYQAILPLRGKVLNTEKASITNIEKNEELNTIIHALGAGVGANFHAEDSNYHKVIIMTDADDDGAHIQILLLTFFYRYMRELIEKGMVYIAMPPLYKLQKGKEMRYAWTDEELDQLRKNFP-KGYTLQRYKGLGEMNADQLWDTTMCPETRTLIQVSIEDAVVAEKRVSVLMGDKANLRRDWIEEN......... 628
9 0.000e+00gi|374290406|ref|YP_005037459.1| DNA gyrase subunit B [Blattabacterium sp. (Cryptocercus punctulatus) str. Cpu]  clstr ali  48  1MS---KKIDYTADSIQSLEGIEHIRMRPSMYIGDVGIRGLHHLVYEVIDNSVDEALAGFCNRIFVTIHKNGFITVIDNGRGIPIEIHKKEGKSALEVVMTKIGAGGKFDKNSYKVSGGLHGVGISCVNALSRTLIVTIYRNGKIYQQEYFKG-KTLYNVKCLGKTNRK-GTKIYYLADQSIFSSITYDYNILVKRLQELSFLNKGLHLFLKDERTENQKKEYFFSKNGLNEYLTILDKNKESLTKNIIFFE----------GEKDSTIIELAMQYNTSFKEEIYSYVNNIHTSDGGTHLTGFRRALTRTLKKYTDGYIFSSNKDKEFTGDDFREGITAILSIRVMDPKFEGQTKTKLSNHEVGGIVEKFVGERLNSYLEENPNDRKKIIDKVILAAKARQASKKARELIQKKNPIYNNILPGKLADCSFNDPENCEIYLVEGDSAGGTAKQGRDRKFQAILPLRGKILNVEKAMEYKIFENEEIINIFTSLGVSIDDNLNIQKLRYNKIIIMTDADIDGSHISTLILTLFFRYMKPLIEKGHIYIATPPLYLIRKGNRSQYAWSDQERESIIHQLGGRKINIQRYKGLGEMNAEQLWETTMNPKKRTLRKINIENIFEADKIFSILMGDEVPPRRNFIEKNAIHAK-IDV 645
10 0.000e+00gi|268610497|ref|ZP_06144224.1| DNA gyrase subunit B [Ruminococcus flavefaciens FD-1]  clstr ali  49  1MSQQN-NNNYDENDIQVLEGLEAVRKRPGMYIGSTGPGGLHHLVYEIVDNSIDEALAGYCTEINVEILEGDVIRVSDNGRGIPVGIHPKEGISAATVVYTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLELTVKDGEHIYFQRFERG-HYDEQLKIIGDTT-ETGTSVMFKADGEIFEHTVYDYEILLKRLREQAFLNAGIKIVFTDKRDDNIVGETLHYEGGIREFVDHIHATRESLSGEVIYVS----------GTQGDSFAEIAMQYNDSYNEVILSFANNIHTKDGGSHETGFKNALTKVINEYGSKMGKLKEGE-KLKGEDVREGLTAIISVKLTECEFEGQTKGRLGNPEVKPFVEKLVTEKLMNFLEENPETANIIFDKCMSALXXXXXXXXXXXXXXXXNAFGNAAMPEKLADCSERDNRYTEIYIVEGDSAGGSAKQGRDRRYQAILALWGKMLNVEKARVDRIYGNDKLAPVVTALGTGLGEDFDIEKLRYGKVIIMADADVDGMHIRTLLLTFFFRYMRPLITNGNVYIAQPPLFRVERKKQVRYAFSDEERDQYIAELSEDGVAVQRYKGLGEMDPEQLWETTMDPEHRTIVKISMEDALKADEIFTILMGDKVEPRRLFIEKNAKFAQNLDV 643
11 0.000e+00gi|242052563|ref|XP_002455427.1| hypothetical protein SORBIDRAFT_03g010630 [Sorghum bicolor]  clstr ali  45  81MHEKRVAAEYTAANVQVLEALDGVRTRPGMYIGSTGPRGLHHLVYEILDNAVDEGQAGHASKIDVVLHDDNSVSVTDNGRGIPTDMHPQTKKSCVETVLTLMHAGGKFGGSKYSVSGGLHGVGLSVVNALSEALEVTVWRDGNKYRQSYSRG-KPTTPLSSIGETSPRQGTSIRFWPDKDIFTTTDFDFNTISSRIRELAFLNPELTITLTKEEGHTVQHNEYCYAGGLVEYVKWLNTDKKPLHDPIAF-----------RKELDGITVDVSLQWSDSYSDTVLGYANSIRTIDGGTHIDGLKASLTRTINNFAKKSKTIKDKDITLSGEHVREGMTCVISVKVPSPEFEGQTKTRLGNPEVRRIVEQAVQENLTEYLELHPDVLDSILSKSLNALKASLAAKRARELVRSKSVLKSSSIPGKLADCASTNPEESEIFIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIERRDEAAMYKNEEIQNLILALGLGVGEDFKKEALRYHKIVILTDADVDGAHIRTLLLTFFFRYQRALFDEGCIYVGVPPLYKVERGKQAHYCYDDADLKEIVNTFPNASYHIQRFKGLGEMMPVQLWETTMDPERRLLKQLKVEDAAEANVVFSSLMGSRVEYRKQLIQEAAISMDQLDI 729
12 0.000e+00gi|383788300|ref|YP_005472868.1| DNA gyrase subunit B [Caldisericum exile AZM16c01]  clstr ali  50  20........EYNAGSLKVLEGLEHVRKRPSMYIGSTSESGLHHLVFEVVDNSIDEAMAGFCTEIIVKMGKDGSITVIDNGRGIPVDEHPELHISGVEVALTKLNAGGKFEGKVYHVSGGLHGVGVSVVNALSKYLKVRVFRNGKIYEQEYAKG-KPLYSLKEVGNSFENTGTEITFIPDDTIFETVEFKEDIIKEKLKELAYLNKGLKIKFINEKTGE--ENIYESKEGIVELVKDINKGEQVIPENPIYF----------NYEEDHFFLEIAMQYNSGFSSEILSFVNNIRTTEGGTHELGLKLALTKLLNDEGLQLKMIK--DEALTFDDVKEGLTAIINVKMLEPQFEGQTKTKLGNAEVKNKVYNIVKTQLTLYFDKHVDELQKILKKVLLAQSARIAAKKAKELVRRKGALDFSGLPGKLADCSLNDPAQTELYIVEGESAGGSAKQARDRKFQAVLPLRGKILNVEKVNMAHALSSEEIKNLITSLGCGVGEDFREEHLRYHKIIIMTDADVDGAHIRTLLLTFFFRYMRPLIEKGYLYIAQPPLYRVSYDKDVRYAYSDEELKHVMEHIKDNKAEVQRYKGLGEMDPQQLWETTMDPTRRIIKRVTIEEAEQADKLFELLMGSEVQPRKEFIMNHAKEVVNLDI 649
13 0.000e+00gi|408356714|ref|YP_006845245.1| DNA topoisomerase IV subunit B [Amphibacillus xylanus NBRC 15112]  clstr ali  47  8.........YTDDSIQVLEGLEAVRKRPGMYIGSTDARGLHHLVFEIVDNAVDEALAGFGNKITVTIHKDNRISISDEGRGMPIGMH-QSGKSTPEVILTVLHAGGKFSEGGYKTAGGLHGVGASVVNALSEELIVTIQRDGKIVQQKFINGGQVASPLTQIGTTKKTG-TTIQFKPDASIFSTTSFQYEILAERLRESAFLLKGIQIELNDERTQN--KETFQYPEGLKSFIEYLNEEKDSLHSVVYF-----------EGKQQNIEVDFAFQFNDGYAENMLSFVNNVRTKDGGTHEVGAKAAITRVFNDYARKNNLLKEKDKNLEGNDIREGLTAVVSVRIPEEQFEGQTKARLGTSEARSAVDAVVSEHLAYFLEENANKAVVLIKKALQAREARELARKAREDARSKNRKRRSSLSGKLTPAQSRRPDRNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTEKAKVEDILKNEEIATIIHTIGAGVAGDFNLEDVQYDKIIIMTDADTDGAHIQVLLLTFFYRYMRELVEAGKVYIALPPLYKISKGKEIHYAWNEEELRRITNNIGS-GYTLQRYKGLGEMNADQLWDTTMNPETRTLIRVTIDDVARTERRVTTLMGNKVAPRRKWIESN......... 631
14 0.000e+00gi|299822648|ref|ZP_07054534.1| DNA topoisomerase (ATP-hydrolyzing) subunit B [Listeria grayi DSM 20601]  clstr ali  46  1MS--KPMNEYNDDSIQVLEGLDAVRKRPAMYIGSTDVRGLHHLVYEIVDNSVDEALAGFGERITVKIYKDQSISIEDEGRGMPVGTH-KTGKSTVEVILTVLHAGGKFGQGGYKTSGGLHGVGSSVVNALSEWLKVTVYRDGAIYEQNFADGGKPVDKLKKIGKT-KRRGTKIHFKPDPAIFPMTSFNYDTLSERLRESAFLLKGMAIELSDERTGA--EEIFQFEEGVKNFVEYINEGKDVLHPVV-----------DIDGESGSIEMELAFQFNDGYSENILSFVNNVRTRGAGTHESGMKAAMTRVFNDYARRVGMLKEKDKNLEGSDIREGLSAVLSIRVPENQFEGQTKEKLGTAEARAAVDAVVTEHLAYFLAENPDTSSLLVKKAIXXXXXXXXXXXXXXXTRKKRKRSETILSGKLTPAQSRNPNKNELYLVEGDSAGGSAKQGRDRRFQAILPLRGKVINTEKAKLPDILKNEEISTIIHTVGAGVGAEFNLEDCNYDKIVIMTDADTDGAHIQVLLLTFFYRYMTPLIEAGKIFIALPPLYKVSKGKKEEYAWTDDELEGAISKIG-KGYMIQRYKGLGEMNADQLWETTMDPETRTLIRVRIDDIARAERRVATLMGDKVEPRRKWIEKH......... 632
15 0.000e+00gi|333917684|ref|YP_004491265.1| DNA gyrase subunit B [Amycolicicoccus subflavus DQS3-9A1]  clstr ali  51  16.........YGASSITVLEGLEAVRKRPGMYIGSTGERGLHHLIWEVVDNSVDEAMAGHASQVHVRLLEDGGVEVRDDGRGIPVGMHS-MGRPTVEVVLTQLHAGGKFDSDSYAVSGGLHGVGISVVNALSTRLEVEIDREGSLWNQVYTYSVP--GELTQVEPSSK-TGTVVRFWADPDIFETTEYNFETVSRRLQEMAFLNKGLTISLTDERTDEVVSDTYHYPGGLEDFVKHINKTKQAIHTSVVGFTAKGTGH----------ELEIAMQWNNGYSESVHTFANTINTHEGGTHEEGFRAALTSVVNRYAKEKKLLKEKDPNLSGDDVREGLAAVVSVKISEPQFEGQTKTKLGNTEVKSFVQKACNENLGHWFEANPTEAKIIINKAVSSAQARMAARRARELVRRKSATDLGGLPGKLADCRSSDPSISELYIVEGDSAGGSAKSGRDSMFQAILPLRGKIINVEKARIDRVLKNTEVQAIITALGTGIHDEFDVAKLRYHKIILMADADVDGQHISTLLLTLLFRFMRPLIEQGHVFLAAPPLYKLKWSKGEDFAYSDRERDGLLQRGANRKINVQRYKGLGEMNAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGEDVSARRSFITRNAKDVRFLDV 679
16 0.000e+00gi|295426266|ref|ZP_06818926.1| DNA topoisomerase (ATP-hydrolyzing) ParE [Lactobacillus amylolyticus DSM 11664]  clstr ali  43  17.....KANTYDDSSIQILHGLEAVRKRPGMYIGSTDIHGLNQLVYEIVDNSVDEAMAGYGKEINVTIHKDNSVTVRDFGRGMPTGMH-KSGKPTIEVILTVLHAGGKFTEQNYKTSGGLHGVGSSVVNALSSYLKVRVVRGGKAYEEEFQNGGHPIGTLKCVGETNDKTGTTITFKPDATIFSTTKYKYETIQERIRESAFLLKGVKFTLTDER-DPEHHDVFQYDDGIKSFVKYLNEGKGTI-SDVFYFE----------GKQDGMEIEFSGQYSDGYSENLVSFVNNVRTADGGTHEVGARSGFTRAFNDYAKKQGLFTKKDKNIDGSDYREGLSAVLSVKIPEEEFEGQTKGKLGTPQARSAVDALVYEKMSYYLMENGELAQELVKKAQRARDAREAAKKARDESRNKKRRKKEVLSGKLTPAQSKNPKKNELFLVEGDSAGGSAKQGRDRRFQAILPLRGKVLNTQKAKLQDIFKNEEINTMIYTIGAGVGTEFKVDDSNYDKVIIMTDADDDGAHIQILLLTFFYRYMRPMIEKGKVYIALPPLYRLQKGREIKYDWTDEELAEDEKKMGR-GYSLQRFKGLGEMNAEQLWQTTMNPESRMLIRVRIDDAALAERRVTTLMGDKVAARRKWIEENVKF...... 648
17 0.000e+00gi|350268404|ref|YP_004879710.1| DNA gyrase subunit B [Oscillibacter valericigenes Sjm18-20]  clstr ali  48  1MAENEAENEYDASEIQVLEGLEAVRKRPGMYIGSTSSSGLHHLVYEIVDNAIDEALAGYCTEILVQINADGTITVVDNGRGIPVDIQIQTGKPALEVVYTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLVVQVHRDGNIYEMHFSRGE-ITREMKVVGTTDHTG-TTVTFKPDPEIFDTTDYDYEILHTRMREQAFLNAGLKIKTVDLREGREQSDEMHYAGGIREFVIWLNRTKDSIHSDVIYMS----------GSKDDSMAEIAMQYNDGYNDMILSFANNIHTPEGGMHEEGFKRALTNVMNAYGRKIGMLKEGD-KISGEDCREGLTCVISVKLTDAQFEGQTKAKLGNSEIRTLVNTLVSNKLEIYLEENPQVGRMILDKSLTANRAREAARKARESIRRKTALGGAAMPDKLRDCNEANPELTEIYIVEGDSAGGSATQGRDSRFQAILPLWGKMLNVEKARADKVYGNDKLQPVITALGAGIGDEFNLAKLRYHKIIIMADADVDGSHIRTLLLTFFFRFMRPLVEYGYVYAAVPPLFKLTRGKTSRVAYTEEESREMRQDNPNAKIDISRYKGLGEMNPHELWETTMDPEKRTLRRITLDDAVAADETFSILMGEKVEPRKEFIEKNAKYAVNLD. 649
18 0.000e+00METAHIT MH0012 GL0246838 [Complete] locus=scaffold16459_3:531:2486:-  ali  47  14.SIEKVKSSYDDNQIQVLEGLEGVRKRPGMYIGTTSVKGLHHLVYEIVDNSIDEALAGYCDDIRIIINADGSITVKDDGRGVPSGIHPKLHMPTLQVIFATLHAGGKFGGGGYAIAGGLHGVGASVVCALSKRLIAVNRRDGVEYTIEFEKG-KLSKPFTEVGPTT-EHGLTVTFWPDDTIFETVEFDPEIIRARLREQAFLNAGVRLTLVDDRNGNGVPEVFHYEGGIRTFVEYLNEQKEVLNKDVIYVS----------GRKDTSIAEVAMQYNDTYNETILSFANNMHTVDGGTHETGFRSALTKVFNDYGKKYNILK-ADEKLSGEDTREGLTAIVSVKLVDAQFESQTKAKLGNSEMRTLVESMVTDKLTEYLEENPTVARAIIEKQISXXXXXXXXXXXXDLTRRKGLLETTTLPSKLADCSEQNADVTELFLVEGDSAGGTAKDGRESQFQAVLPMRGKILNVEKARLERIYSSTQIIPIILALGTGIGDEFDIKKLRYGKIIIMADADVDGAHIKTLLLTFFFRHMRPLIEEGHVYAAIPPLFKVFKGKQERYAFTEEERDKYIAELGTTGVTASRYKGLGEMNADQLRETTMDPATRTLKRITIDDAVEADNIFTLLMGDKVEPRRQYIENNAKYAENVDI 651
19 0.000e+00gi|295396857|ref|ZP_06806985.1| DNA topoisomerase (ATP-hydrolyzing) ParE [Aerococcus viridans ATCC 11563]  clstr ali  47  16.TNQNNKSTYDESSIQVLEGLEAVRKRPGMYIGSTDARGLHHLVYEIVDNSIDEAFSGYADHITVTLAKDGSAIVTDNGRGMPIGKH-TSGKPTVEVILTVLHAGGKFGGSGYKTSGGLHGVGSSVVNALSSKFIATVHRDGKEYYQEFTNGGKPGKPKTKAFKS-KNTGTKIQFYPDAEIFGNIKFDPSTIREHLRESAFLLKDLRIDFIDEINET--EETFHYAEGIKAFVDYLNEDKDVLHDVVFF-----------QGVENGIEIELAFQYNDGYSETVLSFVNNVRTADGGTHESGMRTGLTKSFNEYARKVDLLKTKEKNLEGSDVREGYTAVLSLRVPEEQFEGQTKSKLGTPQARSASDKIVSENLAVYLIENGETAQMLVRKALKAREARDAARKAREASRAKGKRKEVLLSGKLTPAQGRNAKKNELFLVEGDSAGGSAKQGRDRKFQAILPLRGKVLNTEKASIQDILKNEELNTIIYTIGAGVGAEFEVEDANYDKVIIMTDADTDGAHIQVLLLTFFFRYMKPLVEAGKVYLAMPPLYKVSKGKITEYAWTDDELKAVTDKVG-KGYILQRYKGLGEMNADQLWETTMDPETRTLVRVTIDDLSLAEKRVSVLMGNKVEPRRKWIEDN......... 646
20 0.000e+00gi|323339872|ref|ZP_08080141.1| DNA topoisomerase (ATP-hydrolyzing) ParE [Lactobacillus ruminis ATCC 25644]  clstr ali  45  3......TENYSDDSIQVLKGLEAVRKRPGMYIGSTDAKGLHHLVYEIVDNAVDEALSGFGKEIDVTIHKDDSITVVDNGRGLPVGIHA-MGIPTVEVIYTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSEKLTVNTVRDGIEYEEDFVDGGHPVGTLRKIGKTKKQSGTTVTFKPDKKIFSTTHFNYDTLAERLRESAFLLKGVKIVLTDERNDD--QDVFLFENGIQEFVSYLNEEKDTL-GNVMYFE----------GKKDGIEVEVAAQYNDGYSETIMSFVNNVRTKDGGTHEVGMKSAWTKAFNEYARKVDLIKSKDKNLEGSDVREGLACVVSVRIPEEQFEGQTKGKLGTPEARTAVDGIVNEQLGYYLMENGDFAKELVRKSLXXXXXXXXXXXXXDESRKKRHKKERLLSGKLTPAQSKNAKKNELFLVEGDSAGGSAKQGRDRKFQAILPLRGKVLNTEKAKLQDIVKNEEINTMIYTIGAGVGTEFNIEDANYDKIIIMTDADTDGAHIQTLLLTFFYKYMRPMINAGRVYIALPPLYKLQKKTVVKYAWTDAELKTSEKEIG-KGFTLQRFKGLGEMNADQLWETTMNPETRTLVRVKIEDDALAEKRVSTLMGDRVEPRRKWIEKNVKF...... 633
21 0.000e+00gi|407012449|gb|EKE26792.1| hypothetical protein ACD_4C00143G0007 [uncultured bacterium (gcode 4)]  clstr ali  48  1MTAPKKEDSYDASNIQILEWLEPVRKRPWMYIWSTDERWLHHLIWEIVDNSIDEAMAGYWKTINLRIWKDWSMEVIDEWRWIPVDVHPKTWKSTLETVLTVLHAGWKFEESWYKVSGWLHWVWASVVNALSSKLEAYVHKDWKIYYQEYVRWVP-TDEIKPIWKTDR-TWTTIKFYPDPEMFSVLDFDYKTVLLRLRQQAYLTKWIEMTLIDERDWN--RFRFYFEWWVKSYVRFLNKSYDELGD-IFYLDKTV----------DSVAVEIAMQYKDDYTDKIVTFVNNINTPEWGTHLVWFRTALTRTINKYARANEILKEKDTNLTNEDVIEWMTAVISVKVPEPQFEWQTKSKLWNSEVRWIVDKLVWERLYEFFEENPKTAKLIIEKSLLASRARLAARNARDTIIRKWALEWMTLPWKLADCSSKDPAKSELYIVEWDSAGWSAKQWRDRETQAILPLKGKILNTEQARLDKIFANQEIKNLIIAIGTSIWDTFDLNKLRYHRIVIMTDADVDGAHIRTLLLTFFYRYLKDLIYNGNIFIAQPPLYKLSKWKQTWYVYSDEEKEQILKEFWVTSEWIQRYKGLWEMNPEQLWETTMDPNVRKMYRVWITDAEKADEIFKILMWEEVWPRRRFIQSRAKNVSNLDI 638
22 0.000e+00gi|384937835|ref|ZP_10029529.1| DNA gyrase subunit B [Mycoplasma canis UF31]  clstr ali  53  1MSE--KQHSYDASNITFLEGLEHVRKRPGMYIGSTSKSGLHHMVWEIVDNSVDEAMAGFANKIEITITENNEIIVEDNGRGIPVGTHAKFGISALEVVLTKLNAGGKFESDAYKVSGGLHGVGASVVNALSQSMKAWVKRDGNIYHAEFHNGGKTLKSTEIIGSTEGGSGTKIQFLPDYTIMEKMPFDKELIADHAKQIAYLNKGLFVSVRDLRDNTYSE--FKYENGIVDYVTELNKGSLPIN-NIIYASGNYSYKHDITGKDVVIGVEVAAQYNDFYRSNLITYTNNISTHEGGTHLTGFYDAIMRLVNNYAIEKSFIKNENDKFTRDDLIEGLVAVISIKHPEPQFEGQTKGKLGSKDARKAVNEVYSEIFERFLNENPEVAKKIIEKAISARRSRIASNAARDNERKKLPFESGSMPGKLAPCSSKNAEICELFIVEGQSAGGSAKMGRDKVFQAILPLKGKILNTEKAKRDKIFMNEEIMSLINAMGAGLEESFNINKLRYHKIIIMTDADVDGAHIRTLLLTFFYRYFKPLIEYGFIYIAQPPLYKIQQNKNVLYAFNEKEKDEILSNLPNTKITIQRYKGLGEMDAQQLKETTMMPEKRKMLQVQIEDAYRADRIFETLMGDNVEPRKEFISNNAKYVKNID. 647
23 0.000e+00gi|344204775|ref|YP_004789917.1| DNA gyrase subunit B [Mycoplasma putrefaciens KS1]  clstr ali  52  2......SAEYGAESIKVLKGLEAVRKRPGMYIGSTSKTGLHHLVWEILDNSVDEAMDGYANKIDITITVDGEIIIQDNGRGIPTGINAETGKSALSLVFTQLHAGGKFDSESYKISGGLHGVGASVVNALSLYVDVDVYRENTHYHQVFSKGGTEETELENLGFTQLK-GTRVRFKPDPEIFETTTFDYEVIRNKAKQLAYLNKGLKITLTDQRID--KTVDYLFVNGILDYIKEKNESKTVINPSIFYVDAKYK----------DIEVEVALQYNSDYQENLVTFVNNINTMEGGSHEDGLKQALIRDINRYAD--NVIKNNKSNYSWDDIKEGMVCIVSVRHTDPQYEGQTKTKLANPDAKEAVNEIVGQAFEEFLLKSPEDAKAILDKNANAQKARIAAQRAREETRRKSALDSFSLPGKLADCESKDVSIAELYLVEGDSAGGSAKTGRNRRFQAILPLRGKVLNVERVTEARAFANNEIKSIITAIGTGIKEELDLSKLRYGKIVIMTDADVDGAHIRILLLTFFYRYMKELIKNGNVYIAQPPLYKIESSKHVEYAYTDLELEELKNTFKDTKFSIQRYKGLGEMDPLQLWETTMDPQQRTMLQISLEDAALANEVFSDLMGEDPELRKNYIQENARFVENIDI 634
24 0.000e+00gi|429205200|ref|ZP_19196477.1| DNA topoisomerase IV subunit B [Lactobacillus saerimneri 30a]  clstr ali  47  2.....TTPNYDDNSIQVLKGLEAVRKRPGMYIGSTDSKGLHHLVYEIVDNAIDEALSGYGKEINVVIHKDDAITVVDNGRGMPVGMH-ETGIPTVEVIFTVLHAGGKFGQGDYKTSGGLHGVGASVVNALSTKLTVNTVRDGVEYEEDFVNGGQPVGTLRRIGKTKKKSGTTVTFKPDPAIFSTTHYKFSVLAERLRESAFLLKGIKITLTDERTGQA--EIFQFDEGIKEFITYLNEDKDTI-GSIMYFE----------GKKDGIEVEVAAQYNDRYTETILSFVNNVRTKDGGTHEVGMKTAWTKAFNEYARKVKLLKESDKNLEGSDVREGLSAVVSVRVPEKQFEGQTKGKLGTAEARQVVDNIVNKQLTYYLMENGEFAQDLVRKAIXXXXXXXXXXXXXDASRKKHKKKERLLSGKLTPAQSKNAKKNELFLVEGDSAGGSAKQGRDRKFQAILPLRGKVLNTEKASLEDISKNEEINTMIYTIGAGVGPDFNIADANYDKIIIMTDADNDGAHIQTLLLTFFYKYMRPMLTSGKVYIALPPLYKLTRGKQVRYAWTDGELEQTINELGT-GYQLQRFKGLGEMNADQLWETTMNPATRTLVRVTIDDAALAEKRVTTLMGDKVEPRRKWIEQNVKF...... 633
25 0.000e+00METAHIT MH0053 GL0106217 [Complete] locus=scaffold26145_24:827:2767:-  ali  50  2..DNKVNQQYDESQIQVLEGLEAVRKRPGMYIGSTSIRGLHHLVYEIVDNSIDEALAGYCTEIEVVLNKDNSVTVRDNGRGIPHGIHPKMGISTIDVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTHLEVRVKDGEHIWFQSYKRGVP-EGEVHQIGTTT-ETGSEITFWADDKIFEETVYEYDTLLKRLREQAFLNGGLKIIFTDNRGEEPTSEVLHYEGGIKNFVSFIKESLEYINEEVIYVS----------GEKNGSMAEVALQWYSAYEEITESFANNIATTEGGTHVTGFKAALTKVLIEYAKKFKLLKDNEE-LTGEDVREGLIAVISVKLEEPQFEGQTKTKLGNSEMRGLVENILREKLTDYLEENPNIARAILEKALTASRARIAARKAREATR-KTPLGTNSLPGKLTDCIVKDPTKTEIYIVEGDSAGGSAKNGRDSKYQAILPLWGKMLNVEKARADKVYGNDKLTPVIQALGTGIAGEFNLEKLRYDKIVIMADADVDGAHIQTLLLTFFFRFMRPLIEAGHVYLAKPPLYKLSRGKRSRVAFSDEERDRISEEFKNAKVDISRYKGLGEMNPEELWETTMDPKNRILLKVTLEDAERADQIFSILMGDEVEPRRAFIEENAQYVTNLDV 646
26 0.000e+00gi|237732924|ref|ZP_04563405.1| DNA topoisomerase parE [Mollicutes bacterium D7]  clstr ali  47  1MNYMAAKSNYDESNIQILEGLEAVRKRPGMYIGSTDARGLHHLVWEIVDNAIDEALSGFGDNIQVTICKDNSIKVTDHGRGMPTGMHA-SGKPTTEVILTILHAGGKFNDGGYKTSGGLHGVGASVVNALSSWLEVTIYRDGKIWQQRFEDGGSKVGKLKVIGKSN-QTGTTIHFMPDSSIFSVYEYNFSTISERLMESAFLLKGIKIDLVDERTG--KEISYQYDNGLTAFVEYLNYEKETLNEII-----------NIEGTNNEIEVDVAMQFTSGYQETTLSFVNLVRTGDGGTHETGFRSALTRTFNEYARKYGLLKEKDKNLEGNDVREGLSAIISIKVPEHQFEGQTKSKLGTPEARNVVDTVVYEKLTYFLEEHKETADNLVKKMIKAAQ-----------VRDKGPRQEKILSGKLAPAQSKDKKRKELYLVEGDSAGGSAKQGRDRKYQAILPLRGKVVNTEKAAMADILKNEEIATIINTIGAGVGADFNEKDSNYNKVIIMTDADTDGAHIQILLLTFFYRYMRDLITAGKVYIALPPLYKVSKGKKEVYAWEEDELEEAKKKIGR-GYNVQRYKGLGEMNASQLWETTMNPETRTLIQVSIEDAAIVERRVSVLMGDKVEPRREWIEQN......... 633
27 0.000e+00METAHIT MH0030 GL0077828 [Lack 5`-end] locus=scaffold66110_1:2:1849:+  ali  53  1..........................RPGMYIGTTSERGLHHLVWEIVDNSIDEALAGYCDDIEVIISKENSITVKDDGRGVPVGIHPKTGKSTVETIFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVRVYKDGNVYFQRFVNGGHPEGDLKIIDTCAKRTGTTVSFKPDPDIFETTIFNYETLQQRLRELAFLNKGLRIILMDERQDN-KRDEFLYEGGIREYVEMLNKNKSPIHDTII----------DVTGKDNDISLEVALQYNQSYTSNIYSFVNNITTPEGGTHEEGVRRALTRVLNKYATSSGMLKANDDPLSGDDVREGLTMIISCKHPNPQFEGQTKTKLGNAEVRSIADKIFSESLERFLMENPAQAKVIVEKAMTXXXXXXXXXXXXELTRRKGDLDVTNFYGKLSDCKSKDATISEIFLVEGDSAGGSALKGRDSMTQAILPLRGKILNVEKARLDKALANEEIRTIITAFGTGIGEDFDLSKLRYHKIIIMTDADVDGSHIRVLLLTLFYRFFRPIVEAGHVYAAQPPLYVIKHGKNIKYVLDEKERDEYLATLPNTKYDIMRMKGLGEMDAEELNETTMDIHKRTLRQITVEDAVRADEVFSKLMGEEVEPRREFIETNATYA-NLDI 615
28 0.000e+00gi|224534805|ref|ZP_03675377.1| DNA gyrase, B subunit [Borrelia spielmanii A14S]  clstr ali  47  7........NYVASNIQVLKGLEAVRKRPGMYIGSVSINGLHHLVYEVVDNSIDEALAGFCDRIDVIINLDNTITVIDNGRGIPTDIHEEEGISALELVLTKLHSGGKFNKGTYKVSGGLHGVGISVVNALSSFLEVYINRDGKIFRQTFSKGIP-TSKVEVVGES-VITGTKVTFLADSEIFETLDYNFDVLEKRLKELAFLNDKIYISIEDRRFGKEKSSKFYFEGGIKSFVDYLTNNSKAYQSESYYID----------GFMNDVIVNVGLKWTESYSDNILSFVNNINTREGGTHVMGFRSGLTKAMNEAFKNSKISKKDVPNLTGDDFKEGLTAVISVKVPEPQFEGQTKSKLGNSEIKKIVEVIVYEHLLKIINLNPLEIDIILGKAIXXXXXXXXXXXXXXSERKKNAFESLALPGKLADCTSKNPLEREIYIVEGDSAGGSAKMGRNRFFQAILPLWGKMLNVEKTREDKVITNDKLIPIIASLGAGVGKTFDITKLRYHKIIIMADADVDGSHIRTLLLAFFFRYMRELIENGYIYIAMPPLYKIKYDNRIYYFYDEKEKEKFLDSIETKNRNLQRYKGLGEMNPTQLWETTMDPARRKMRLMNIDDAVEAEKIFVTLMGDLVEPRKEFIEQNALNVINLDV 639
29 0.000e+00gi|256384292|gb|ACU78862.1| DNA gyrase, B subunit [Mycoplasma mycoides subsp. capri str. GM12]  clstr ali  53  2......SQEYSAESIKVLKGLEAVRTRPGMYIGSTSKTGLHHLVWEILDNSIDEAMAGYADLINVTITKENEVIVQDNGRGIPVGINSDTKKSALSLVFTQLHAGGKFDSETYKISGGLHGVGASVVNALSLYVEVEVYRNNIHYHQLFSEGGTKESELQQLGHTD-LRGTKVKFKPDPEIFETVVFDYEIIKNKVKQLAFLNKGLKITLTDERIE--KTVEYLFLNGILDYIKEKNETKNKINPNIFYVDSKY----------EDIEVEMALQYNSDYQENIITFVNNINTHEGGTHEDGLKQALIRDINRYADT--VIKNNKSKFSWDDIKEGMMCILSVRHTDPQYEGQTKTKLSNPDAKEAVNIIIGNAFEEFLLKSPEDAKAILDKNVNAQKARIAAQKAREETRRKSALDSFSLPGKLADCETKDSSIAELYLVEGDSAGGSAKTGRNRKFQAILPLRGKVLNVERVTEARAFSNNEIKSIITAVGTGIKEELDLSKLRYKKIVIMTDADVDGAHIRTLLLTFFYRYMKPLVANGHIYIAQPPLYKIEAGKKIAYAYTDSQLDELKNEFNNLKYTIQRYKGLGEMDPLQLWETTMDPQQRTMLQISLEDATLANEVFSDLMGEDPELRKIYIQDNAKFVENID. 633
30 0.000e+00gi|240047186|ref|YP_002960574.1| DNA gyrase subunit B [Mycoplasma conjunctivae HRC/581]  clstr ali  51  1MSQ----KNYSASSIQTLEGLEPVRKRPGMYIGGTGIQPLHHLIWEIVDNAVDEALAGFANQIDVVITKDGYVQVSDNGRGIPTDIHPKHGVSAAEVVLTILHAGGKFDGSSYKVSGGLHGVGASVVNALSKHLQVWIKRDGKLYFQEFRDGGQKVDNLKVIDSSENQTGTTIKFIPDFTIMDKNEFRLDIIQDRLKQTAYLTKGLKFTIDDQRTNFQK--TFLFEGGIFDYISELSKGYEHVHDEIIYVEDELSHN------ENHIKVEVALRYVNEDRSELLSYTNNIYNREGGTHEAGLFDALSRILNNYAFENKFFKNENEKFSKEDIKDGLFAVISIKHSDPIFEGQTKGKLNSKEVRQITNKVFSEVFERFLVENPEQARKIIERNLISQKARKAAESAREAVKRKSPFDVSSLPGKLADCSVKNAQMAELYIVEGNSAGGSAKMGRDRHFQAILPLRGKVINSQRTNLEKVLKNEEILSLITAFGTGIGPEFNINKVRYHKIIIMTDADSDGSHIRTLLLTFLYRYFRPLIEYGLIYIAQPPLYKISANKKVVYAYSDKQKDEIIKEFENNKVTIQRYKGLGEMNPDQLWETTMDPTTRKMYQVQIHDAFIASQVFEALMGEEVQPRKVFIEENARYVKNLDV 640
31 0.000e+00gi|462227|sp|P34031.1|GYRB_SPICI RecName: Full=DNA gyrase subunit B  clstr ali  54  3.......DNYNSESIQILEGLEAIRKRPGMYIGATNARGLHHLVWEIVDNSIDEVLANFANKIKIILNKDESITVIDNGRGIPIEIHPKTKVSTLETVFTILHAGGKFDSNTYKISGGLHGVGASVVNALSKYLKVEVRKNNKKYVMEFHNGGQILTPIKEVGSTS-ETGTTVTFLPDEKIFETTIFSFSTIQNRIKQLVFLNKGLEISLVDLREEEEKTVLYQFNNGIKDYVLELNKTGTPLND-VFYVE----------GIEDNIVVEFGLQYNDNYSENIFSFCNNINTHEGGTHEEGARLAIVREINNYFKNNKNNKGNEDKFTWDDIKEGMTIIISIRHPEPQYEGQTNQKLLNSEVKKIVSNIVGKGLSSYLLENPEDAKKIIEKISLSLKATIVAQRAKEITRRKIVMDSFSLPGKLSDCETKDAKIAELYIVEGDSAGGSAKSGRNRKFQAILPLRGKILNVEKAKQIKIFENNEINSIITALGAGIKDNFNDKKLRYQKVIIMTDADVDGAHIRILLLTFFYRYMKDLIENGNIYIAQPPLYKVENSNQIRYVYSDNELELYKEELLNKNYTIQRYKGLGEMNPEQLWETTMDPERRLLLKVSVNNAFEANLICNELMGENVEPRKKFIRENAKYVKNLDV 640
32 0.000e+00gi|381179306|ref|ZP_09888162.1| DNA gyrase subunit B [Treponema saccharophilum DSM 2985]  clstr ali  46  2......ESTYSADNIQVLKGLEPVRKRPGMYIGSTGPRGLHHLVYETVDNCIDEAMAGFCKNIVVALERDDIVRVEDDGRGIPVDMHHTEKVSALELVLTRLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTWLEATVCRDGHVYFQKYRIGVP-EAPVAKIGDTDR-HGTTIRWKADPTIFETTVYDYDVLKKRLKELAFLNNGIKITFRDERLETPKEEVLQFDGGISQYVKEINAG---ISSKFYYPE----EPIYITGEKDNVVTELSFQYNSGYSENINSYVNDINTRDGGTHLDGFKNALTFVLNKALDSNEKLRKKDERLTGDDVRSGIVAVLSMKVPEPEFEGQTKEKLGNTEVRSIVNALVQEKLTIFFEMNPPILEKILEKAVNEAAARIAARKAKENSRRKTITDSFALPDKLSDCSLKDPELCEVFLVEGDSAGGSCVKGRDPKTQAILSLWGKMLNVEKVTPDKVVSNDKLQPVIASLGAGFGEDFNIEKLRYHKIIIMADADVDGSHIRTLLLTFFYRYMPELIERGYVYLAMPPLYGIKVGKKVSYVYTDEEKNAEIAKIGGKNVTIQRFKGLGEMDGDELWETTMDPSKRRMKKVSVPDAEAADAIFSVCMGEEVEPRRRFIDENAHLA-NLD. 639
33 0.000e+00gi|406964893|gb|EKD90587.1| hypothetical protein ACD_30C00112G0028 [uncultured bacterium]  clstr ali  48  1MADSKK---YDASQIQVLEGLEPVRKRPGMYIGSTDARGLHHLIKEVVDNSIDEALAGHAKNVWVTLSEGNYVTVADDGRGIPVDIHPKTGKSALEVIMTTLHAGGKFGEGGYKVSSGLHGVGVSAVNALSDYVRAEVRRDGKTYFQEYARGVPKAKPFESSYKWIAKTGTKTSFLADATIFSTIVPEFEKVKKQLRQVAYLVAGISFHLFDERTGEELH--FYFQSGLAALIKQLNKNKGVVNPDPI----------ILNREIDEIAVEVAIQYNDSFNENVESFANVVPTTEGGTHVTGFRTALTRVINDYARKIEALKEKDENFTGDDLKEGLTAVISIKMDSDQFESQTKEKLGNAEVQSVVNQVVREGLDTFFEENPAEGKRIIEKVLLXXXXXXXXXXXKDAVIRKGALEGMTLPGKLADCQEKDPAKSEIYIVEGDSAGGSAKQGRDRKSQAILPLKGKILNTERARLDKILEFEEIKALVIALGTGIGDIIQYDKARYHRIILMTDADVDGSHIRTLLLTFIFRYLPELLTRGYVYIAQPPLFKIQKGKDVHYAYTDEERDGILKKFKGSGVMIQRYKGLGEMNPEQLWETTMNPENRVLKQVTIEDAEGADEVFSMLMGDEVPPRKRFIQTHAKQAI-LDI 673
34 0.000e+00METAHIT MH0077 GL0091212 [Complete] locus=scaffold92123_1:1543:3450:+  ali  48  3........KYDESSIKILEGLEAVRKRPGMYIGSTDKRGLHHLVWEIVDNAIDEAINGYGDYVKISLNKDGSITVSDHGRGVPIGMH-ESGKSTPEVIYTVLHAGGKFSEAGYKVSGGLHGVGASVVNALSKRMDVTIYRDGVISNIRFVNGGNVEVPLHTIGSTNK-TGTTVTFLPDDEIFKSTQFSFTTIAERMQESAFLLSGITIEVVDEIDNKDVK--YHYENGLVSFIDYMNENKTPLHKVINF-----------KGLKNGIEVEVAMQYTSSYQEEILSFVNNVKTSDGGSHEVGFKTAITKVFNDYAKQNNIFKGKDSVLDGSDVREGLTAVINLKVPEEQFEGQTKGKLGTPEARVATNDVVYENLQFFLEENKEIALTILEKAQKSKVAREAARKAREEARKKNSKQEKNLSGKLAPAQSKNPKVNELFLVEGDSAGGSAKGGRDRKFQAILPLRGKVLNTAKASMDDIYKNEEINTLIYTIGAGVGANFDATESNYDKVIIMTDADVDGAHIQILLLTFFYHYMRGLIEAGKLYIALPPLYKLDYGKNKQYAYSDDELNE-IKNNNSGKYTIQRYKGLGEMNPEQLWETTMNPETRTLIRVNINDAALAQKRVEVLMGDKVEPRKEWIDEN......... 624
35 0.000e+00gi|408789580|ref|ZP_11201235.1| Topoisomerase IV subunit B [Lactobacillus florum 2F]  clstr ali  46  1MAKTKQSQEYDSTSIQVLHGLEAVRKRPGMYIGSTDARGLHHLVYEIVDNAVDEAIAGYGDQINVTIHADDSITVTDHGRGMPVGMHA-SGKPTPEVILTVLHAGGKFGQGGYKTSGGLHGVGSSVVNALSESLTVKIVRDHQLYQEDFKNGGTPVGTLRKLGKTTQPTGTTITFKPDPTMFTTTVYNFETLATRLRESAFLLKNVQIVLTDERVGQEQTAIFKYDDGIKDFVKYLNEAKTTIGDVLYF-----------DGNKNGIEVEVAAQYNDGYTESMLSFVNNVRTKDGGTHEAGFRSGWTKAFNEYARKVDLLKEKDKNLEGADIREGLTAVIALRIPEEQFEGQTKEKLGTPAARAIVDNVVAEQLRYFLMENADLATLLVKKALRARKAREAAKKARDESRKKKHKSERLLSGKLTPAQSKDARLNELFLVEGDSAGGSAKQGRDRKHQAILPLRGKVLNTERASLTDILKNEEISTIMYTVGAGMGDDFQLQNANYDKIIIMTDADDDGAHIQILLLTFFYKYMRQMIDAGRVYVALPPLYKMQTGQKIEYAWTNEELEQLRKQFP-KGANLQRFKGLGEMNADQLWETTMDPSKRTLIRVQIDDAVQAEQQVSTLMGNKVEPRRNWIEAN......... 636
36 0.000e+00METAHIT MH0040 GL0017121 [Complete] locus=scaffold1708_1:277:2211:-  ali  47  2......AQTYDENQIQVLEGLEAVRKRPGMYIGTTSARGLHHLVYEIVDNSIDEALAGECSDIIITLHADGSASVKDNGRGIPTAVHHKMGIPTPDVVFTILHAGGKFGGGGYNISGGLHGVGASVVNALSEWFRYEIY-NGEMYKGSFRRG-KPDEPFTYVGKSE-GRGLYVRFMPDSEIFEETVFDYDTLLNRMREQAFLNPGIRIIMRDERDGKVREDILHYEGGIVSFVEYLNRNKNVINPDIIYMKAQKEFRIA----------EVAFQYTDKYDETIMSFANNIITPEGGTHETGFKSALTKVINDYARKKGYLKNDDKNLSGEDTREGLTAIVSVKLRDAQFEGQTKGKLGNSDMRTFVDNLVSDKLTEYFEENPAVAKAILDKAIVASRVREAARKAREQTR-KSALSTGTLPGKLADCQEKRTDLTELFLVEGDSAGGSAKSGRDSRFQAILPLRGKVLNVEKTRAHKAYSNLSLIPIIQALGCGIGEEFDINKLRYGKIVIMADADVDGSHIRILILTFFFRHMRKLIEDGHVFLAQPPLYRVRKGKESLYAFSDEERDVCIQKLGGDKIKADRYKGLGEMDAEELRDTTMDPRTRTLLKVTIDDAIACDAMFSLLMGDDVEPRKQFIEENARYAENLDV 644
37 0.000e+00METAHIT MH0070 GL0042800 [Complete] locus=scaffold17903_2:1904:3826:+  ali  46  1MADNR--QDYGAGSITILEGLEAVRKRPGMYIGSVSTKGLNHLIYEIADNAVDEHLAGYCDSIWVSLNKDGTATIRDNGRGIPVGIHPKAGIPAVEVVFTILHAGGKFGDGAYKISGGLHGVGASVVNALSRWLEVEIRQDGKVYKQRYERG-HVMAPLAEIGTCRKDTGTTVTFLPDDEIFEKTYFKADQVKSRLHETAYLNPGLTIYFENKRTNEEESKVFHEPDGIKAYVKALNEGLETLHDVIYFKHTS-----------EGIEVECAVQFVDAFQENILGFCNNIYTQEGGTHLTGFKTKFTVVINQYARELGILKDKDVNFTGQDVRNGMTAVVAVKHPEPRFEGQTKTKLDNQDAGKVVAEVTGNELVRYFDKNLETLKTVIACAEKSAKIRKAEEKAKTLVKQKFSCDSN---GKLANCESRNPEECEVFIVEGDSAGGSAKTARNRRTQAILPIRGKILNVEKATMDKVLGNAEIKTMITSFGCGFGNDFDITKLRYNKIIIMTDADVDGAHIATLLLTFFYRFMPELIQEGHVYLATPPLYKVVPKKGEQYLYDDKALEKYRKTH-TGNFTLQRYKGLGEMDADQLWETTLNPETRILKRVEIEDAKMASDVTSMLMGSDVGPRREFIDEHAHDAE-LD. 638
38 0.000e+00gi|310286525|ref|YP_003937783.1| gyrB1 DNA gyrase subunit B [Bifidobacterium bifidum S17]  clstr ali  47  55..DTLSPDHYDASDLKVLEGLEAVRIRPGMYIGSTGPRGLHHLVYEIVDNSVDEALAGYATHIEVTILPDNGIRVVDDGRGIPVDEVPGEGVSGVETVMTKLHAGGKFGGGGYAVSGGLHGVGISVVNALSTRVDIEVRRQGFHWTQTYVN-QHPTARLAKGAPEDESTGTSVTFWPDAAIFESTVYDFETLRSRFQQMAFLNKGLKISLTDLREPKHQSVTYQYMNGIKDYVSYLVKSRTPVEEDVIDFEAEDL--------KIGISAEVAMQWTTAYSEAVHTFANTISTTEGGTHEEGFRAALTSLVNRYARDKNILKEKDDNLSGDDVREGLTAVVSVKLTTPQFEGQTKTKLGNSEAKTFVQRVMTDKLGDWFDAHPAEAKNIIQKAIEASRARIAAKKARENTRRKSIFESAGMPDKLKDCQSSNPEECELFIVEGDSAGGSAIQGRNPETQAILPLRGKILNTERASIDRMMKSDTIESLITAVGGGYGEEFDVSKVRYHKVIIMADADVDGAHIATLNLTLFFRYMRPMITAGYVYVAMPPLYRLKWTRGDHYVYTDRERDEKLAQGKAAGRQIQRYKGLGEMTYQELWETTMDPEHRILKQIHIEDAAAADETFSMLMGDDVEPRRLFIQRNAKDVRFID. 719
39 0.000e+00gi|239628764|ref|ZP_04671795.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]  clstr ali  46  82...TAGSPDYGAAQIQILEGLEAVRKRPSMYIGNTSAQGLHHMVYEIVDNAVDEALAGYCTEIEVYLNPDNSVTVHDNGRGIPAGIQSKTGLSAIQVVFTVLHAGGKFDNSSYKVSGGLHGVGASVVNALSSRLKVKVDQDGYSYVQSYERGIP-LGPVRVQGTCSQEHGTTVTFWPDGEIFKDCHFHPETLRQHMQETAFLMSGLTITLYDHRDQDNHPDRFCYQDGLKDFVKFINGPEPTLYQDILYGQSGT----------DEVLAEFALIHNTGFDEKLRSFANNISTPEGGTHVTGFRQALTRAINDYARKQGMLKESDPSISREELSEGMTAVISVRLKEPQFEGQTKQRLGSSSARPVMDHLVYTKLTLFLEQNPLAAKAIINKAVLXXXXXXXXXXXXEMARRKTALSGLSLPGKLADCSSRNPKDCELFIVEGDSAGGSAKMARCRENQAVLPLRGKILNVEKTTLDKVCANAEIKAMISAFGTGIMDGFSLDGLRYHKIILMTDADVDGAHITTLLLTFLFRFMPRLIEAGHVYLAQPPLFRVEKGKKLWYAYSDSELSQILEDIGRDGYKIQRYKGLGEMDAKQLWETTMDPSRRTLLRVGAADSSETSRIFRILMGDDVEPRKNYILEHAQYTTMLDV 736
40 0.000e+00gi|332686601|ref|YP_004456375.1| DNA topoisomerase IV subunit B [Melissococcus plutonius ATCC 35311]  clstr ali  47  1MAK-KINNAYNDTSIQVLEGLEAVRKRPGMYIGSTDHRGLHHLVYEIVDNAVDEALSGFGNDIQVTIQKDNSIKIADLGRGMPVGIHA-SGIPTVEVIFTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSKWLEVRIVRDGIEYMERFENGGKPVGTLEKVGKTKKPNGTVVTFLPDDTIFSTIQFSYTNLAERLRESAFLLKDIKITLTDLREDEPKQEIFHYKEGIKEFVSYLNEEKDTLTPIVYF-----------NGEKEGIEVELSYQYNDGYSENVLSFVNNVRTKDGGTHEIGMKTAMTRAYNEYARRIGLLKERDKNLEGSDFREGLAAILSIRVPESQFEGQTKEKLGTPQARNSVDSVIGEQMSYYLQENSELSQTLIRKAIXXXXXXXXXXXXXXXSRKKRKKGESLLSGKLTPAQSRNPQKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTEKAKMQDILKNEEINTMIYTIGAGVGPEFNIEDCNYDKVIIMTDADTDGAHIQILLLTFFYRYMKPLIEAGKVYIALPPLYKVSKGSQIEYAWTDEELKDVIQSIG-KGYMLQRYKGLGEMNAEQLWETTMAPESRTLIRVRIDDTAQAERRVTTLMGDKVEPRRNWIETH......... 635
41 0.000e+00gi|407002831|gb|EKE19487.1| hypothetical protein ACD_8C00151G0003 [uncultured bacterium]  clstr ali  47  1MAKEKEKSEYGAKSIQVLEGLDPVRKRPGMYIGGTSTEGLHHLIWEVVNNSIDEAMAGHGKDILVQLLPDNIISVRDFGRGIPVEIHPQTKKSTLETVLTVLHAGGKFGGDGYKISGGLHGVGVSVVNALSSWTKVEVCREGKLWVQEYKKGIP-QGDVKPVGKSD-HTGTTITFKADSEIFPEIKYSWTKVLDYVRQQAYLTKGVKIVVEDKREVGENEEFFYFDGGIISFVKFLNRGKQIKNEMPVYIEKTV----------DDVNVEISLQYTDGYKEHLYSFANNIFTPEGGMHVTGFKMALTRVLNDYAKKNNLIKEKDGGMTSDDLKEGLTAVVSVKLRNPQFEGQTKSKLGNAEVRGIVSSITSEGIQEFLEKHPGNAKAMIDKCLLTVRARIAARAAKDAVLRKGALEGMTLPGKLADCTTRNAEISELYIVEGDSAGGSAKQGRNRMFQAILPLRGKLVNVEKTSLDKVVKSDTLKPIIIALGTGIGETFDASKIRYGKIIIMADADVDGSHIRVLLLTFFYRYFEDLITNGHIYIAQPPLYRIQKGKDVRWVYTDEEKDVVVEEFRLKGVTIQRYKGLGEMNPQQLWDTTMDPEHRKMMKVEIEDAEEADRVFDILMGSDVEPRRRFIQTHAKSVKNLDV 689
42 0.000e+00gi|298246161|ref|ZP_06969967.1| DNA gyrase, B subunit [Ktedonobacter racemifer DSM 44963]  clstr ali  48  31.TQNHGNNGYSGQNIQILEGLEAVRVRPGMYIGATDQRGLHHLIQEVVDNSVDEVMAGYADTIQVTIHADGSVTIEDNGRGIPVEEHHQPGMSTLEVVMTVLHAGGKFGGGGYQISSGLHGVGVSVVNALSEWCQVDVRRDGKVYRQRYEKGTPVT-KLAAVG-SFEGTGTRTSFMPDLSVMETRDYNFDMLAQRFREMAYLNRGMTICIRDERSD--REATFYFEGGLVSFVRYLNKNRNTL----------QARPASASREIDKVKVDIALQYNDSWSTTEFSFANGINTVDGGMHITGFRSALTRSLNDYARKTGLLKEKDPNLTGDDVRQGLAVVVSVKIPNPQFEAQTKSKLNNAEIRPIVENITADMLNRYLEETPSEAKAIISKCLTSAKAREAARAARDLVQRKNVLD-TTLPGKLADCSERRADRCELYLVEGDSAGGSAKQGRDRHFQAILPLRGKILNVERVTLDKILHNEEVKNIITAVGVGIGEQFNLSRLRYGRVVIMCDADVDGAHIRTLLLTFFYRYMPELIGGGHLYIAQPPLYHVKFGKQVHFVYTEEERDALINEYKGKEPEVGRYKGLGEMNPETLWETTMDPERRTILKVSVDEAVEADKVFSMLMGDEVAPRRRFIESHARNA-NLDI 668
43 0.000e+00gi|323488988|ref|ZP_08094225.1| DNA topoisomerase IV subunit B [Planococcus donghaensis MPA1U2]  clstr ali  46  1MAKIQNT-AYNEEAIQVLEGLDAVRKRPGMYIGSTDTRGLHHLVYEIVDNSVDEALAGHGDKISVTIHEDNSISVRDYGRGMPTGMH-RSGKPTPEVILTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSSFLEVTIYRDGKKYRQRFENGGKPVTTLEEIGST-KETGTMIHFLPDESIFSVSKYNYETLSERLRESAFLLKGLKIELFDQRTEA--KDVFHYETGIEAFVSYLNEEKDVLHP-VAYIE----------GQQDEMEIEFSFQFNDGYSETILSFVNNVRTRDGGTHETGAKAAMTRVFNDYARKINLLKDKDKNLEGSDIREGLAAIVSVRIPEAQFEGQTKSKLGTSEARSIVDSVVSQKLMYFLEENADLSASLVRKAIRAAQARLAARKAREDARKKRKKSDALLSGKLTPAQSRNAKKNELYLVEGDSAGGSAKQGRDRTFQAILPLRGKVVNTEKAKLEEIMKNEEISTIIHAIGGGVSSDFSIDDIAYNKIIIMTDADTDGAHIQVLLLTFFFRYMKPLIEAGKVFIALPPLYKVSKGKKEVYAWTEADLDASIKKVG-KGYTLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDSARAERGITTLMGDKVEPRRRWIESN......... 632
44 0.000e+00gi|407013260|gb|EKE27426.1| hypothetical protein ACD_3C00208G0003 [uncultured bacterium (gcode 4)]  clstr ali  49  1MAPAKKEDSYDASNIQILEWLEPVRKRPWMYIGSTDERGLHHLIWEIVDNSIDEAMAWYGKNIDLKIGTDGSMEISDEWRWIPIDVHPKTGKSTLETVLTVLHAGWKFEESWYKVSGWLHWVWASVVNALSSKLEAYVHRNGKIYYQQYVRWVPVD-EIKPIWKTDR-TGTTIKFYPDSEMFTCLDFDYKTVLSRLRQQAYLTKGIQMTLIDERSEDKYR--FYFEWWVKSYVHFLNRQFEELGD-IFYVERNV----------DNINVEIAVQYKDDYSEKIVTFVNNINTPEWGTHLVWFRTALTRTINKYARANDILKEKDINLTNEDVVEWITAVISVKVPEPQFEWQTKSKLGNSEVRWIVDKLVWEKLNEFFEENPKSAKLIIEKSLLASRARMAARNARDTIIRKWALEWMTLPGKLADCSSRDPSKSELYIVEGDSAGGSAKQWRDREFQAILPLRGKILNTEQARLDRIFGNQEIKNLIIAIGTSIGDTFDLSRLRYHRIIIMTDADVDGAHIRTLLLTFFYRYLKDLIISGNIFIAMPPLYRLAKGKQSWYVFTEEEKLKIIEEFGVTTEWIQRYKGLWEMNPEQLWETTMDPSVRKMSKVRIVDAEKADEVFKTLMWEDVPPRRRFIQSRAKHVTNLDI 638
45 0.000e+00gi|194246593|ref|YP_002004232.1| DNA gyrase subunit beta [Candidatus Phytoplasma mali]  clstr ali  51  3....KKTKIYNAESIQVLEGLEAVRIRPGMYIGSTNEKGLNHLVWEIVDNAIDESLEGYANEIILEVLPENIIRVTDNGRGIPVDIHPKTNKTVVETILTTLHAGGKFDNSSYKISGGLHGVGASVVNALSSWFLVEIHLQGKIYFQKYEKGKPVT-KLEIKGNTNKK-GTVITFLPDNEIFETTNYNFEILKIRMQQLAFLNKGIKLIIIDKRKDIEEKFEFYYKEGLKEYIKYLNQNKTSLNKE-FYQEKFF----------EKMFFEIVFQYTEVYNNNIYSFVNNIPTHDGGTHEEGFKMALNRILNKYVKDKNMLKKN-INFISEDTLEGLTVVISLKHPNPSFESQTKTKFLNSEVRQIISKFFGEELEKYLLENPQEAKKIIEKCLLSSKARIDAKKAREATRRKSPLETLGFASKLADCYNKNPQESELYIVEGDSAGGSAKQGRDSKYQAILPLKGKVLNVEKARLEKILSNKEIISLIQAVGTGFGKDFNIDKVRYHRIIIMTDADVDGAHIRTLLLTFFFRNLKPLIEKGYIYFAKSPLYKIQYGKKITYAYEEQELKKILSRI-SGKFYIQRYKGLGEMNPEQLWETTMNPETRTLLQVNSENDLESDQVFNMLMGEEVSVRKKFIQDNAIYA-DLDV 633
46 0.000e+00gi|355678307|ref|ZP_09060986.1| hypothetical protein HMPREF9469_04023 [Clostridium citroniae WAL-17108]  clstr ali  48  8...TEDNTDYGAAQIQILEGLEAVRKRPSMYIGSTTSQGLHHMVYEIVDNAVDEALAGHCTRIEVSLNEDGSVTVRDNGRGIPAGVQKKTGLSAIQVVFTVLHAGGKFDNSSYKVSGGLHGVGASVVNALSRRLEVQVDQDGYSYVQSYARGVPLDQ-VHILCPCGQEHGTTVTFWPDGEIFPDCSFDFRTLMLHLQETAFLTSGLEIILYD-RTDDAGSNVFCYQNGLRDFISFLNDGQPTLYSDILYGQWGT----------EDIQAEFALIYNTSYEEKLLSFANNISTPEGGTHVSGFRQALTRAVNEYARKQGLLKECDSSLSRDELSEGMVAIVSVRLKDPQFEGQTKQKLGSSSARPVVDRLVYEKVTLFLEQNPQAAKAILNKAVLXXXXXXXXXXXXDLARRKTALAGLALPGKLADCSGRDPRECELFIVEGDSAGGSAKMARCRENQAVLPLRGKILNVEKTSLDKVCANAEIKAMISAFGTGIMDSFSLEGLRYHKIILMTDADVDGAHITTLLLTFLFRYMPKLIEAGHVYLVQPPLYRVEKGKKLWYAYSDIELARILDDIGRDGTNIQRYKGLGEMDAKQLWETTMDPMHRTLLRVSPEEASETSRMFSILMGDDVEPRKNYILEHAQYTTMLDV 655
47 0.000e+00gi|317509459|ref|ZP_07967077.1| DNA gyrase, subunit B [Segniliparus rugosus ATCC BAA-974]  clstr ali  49  1MSEKKNSSTYGASSITILEGLEAVRKRPGMYIGSTGERGLHHLVQEVVDNSVDEAMAGYATRVDVTLLADGGIEVVDDGRGIPVAPHA-SGPPTVEVVLTVLHAGGKFDSDSYAVSGGLHGVGISVVNALSYKLEVEIDVDGHHWTQAYDNAKP--GPL-VKGAAVKRTGTTVRFWADPKIFETTRYDFDTIARRLQEMAFLNKGLIITLTDLREGQVKRREYHYPGGLHDYVAHINRTKTAIHTSIVSFE----------GKGEGHEVEIAMQWNSGYTESVYTFANTINTHEGGTHEEGFRAALTSTVNKYARDKKILKEKDKNLSGDDVREGLSAVISVKLSEPQFEGQTKTKLGNTEIRSFVQKICNEELAHWFEANPSEAKVIVSKXXXXXXXXXXXXXXXXLVRRKSATDIGGLPGKLADCRSKDPSKSEVYIVEGDSAGGSAKSGRNSEFQAILPIRGKIINVEKARIDRVLKNTEVQSIITAFGTGIHDEFDLAKLRYHKIVLMADADVDGQHISTLLLTLLFRFMRPLVEHGHVYLAAPPLYKLKWQRAEEYAYSDRERDSLLSKKINKDDGIQRYKGLGEMNAKELWETTMDPDTRTLRLVTMDDAAAADELFSILMGEDVPARRGFIARNAKDVRFLDV 678
48 0.000e+00gi|116629641|ref|YP_814813.1| DNA topoisomerase IV subunit B [Lactobacillus gasseri ATCC 33323]  clstr ali  45  14...NKTTSSYDDSSIQILHGLEAVRKRPGMYIGSTDRHGLNQLVYEIVDNSVDEAMAGYGKEINVTIHKDNSITVQDFGRGMPTGMHA-SGIPTIEVILTVLHAGGKFTEKNYQTSGGLHGVGSSVVNALSSYLKVRVVRDGQAYEEEFENGGHPIGTLKHLGKTKDKNGTTITFKPDATIFSTTTYNYETIQERIRESAFLLKGVKFTLTDER-EPEHHDKFLYEDGIKSFVSYLNEDKDTMGD-VFYFS----------GKQNGIEVEFAGQYNDGYSENFVSFVNNVRTADGGSHEAGARSGFTKAFNDYAKKQGLLKNKDKGLEGSDYREGLSAVLSVKIPEEEFEGQTKGKLGTPQARSVVDSIVYEQLSYYLMENGEFAQSLVQKAQKARDAREAAKKARDESRSKKRRKKEILSGKLTPAQSRNPKKNELFLVEGDSAGGSAKQGRDRKFQAILPLRGKVLNTQKAKLQDIFKNEEINTMIHTIGAGVGSDFQIKDANYDKIIIMTDADTDGAHIQILLLTFFYRYMRPMVEAGRVYIALPPLYKLQKGNKIKYAWTDEELSEDSKDMG-KGFALQRFKGLGEMNADQLWETTMNPETRTLIRVKIDDAQLAEKRVTTLMGDKVAPRRKWIDENVKF...... 647
49 0.000e+00gi|420152525|ref|ZP_14659569.1| DNA gyrase, B subunit [Actinomyces massiliensis F0489]  clstr ali  46  32....QGASDYGASDITVLEGLEAVRKRPGMYIGSTGERGLHHLVYEVVDNAVDEALAGYCDHIKVTIQADGGIKVVDNGRGIPVDDHPTEHRPTVEVVMTILHAGGKFGGGGYAVSGGLHGVGVSVVNALSTRVDTEVRRQGYVWRMSFGDGGKPTTPL-VRGEETSETGTTQTFYPDPAIFETVVFDYETLRRRFQQMAFLNKGLRITLTDEREGGHRSDTYCYEHGLRDYVAFLNKSKKVIHPEIIDFEAEQTLDDIH-----GISLEIAMQWTSAYSESVHTYANTINTTEGGTHEEGFRTALTTLVNKYAREKGLLKERDGNLTGDDIREGLTAVISVKLSEPQFEGQTKTKLGNTEARTFVQQTVYSQLGDWLDSHPADARSIITKXXXXXXXXXXXXXXXXXTRRKGVLESASMPGKLRDCSSRVAADCEIFIVEGDSAGGSAVGGRDPEHQAIMPIRGKILNVEKARLDRALSSDTIRSLITAFGTGIGEEFDIAKLRYGKIVIMADADVDGQHIATLLLTLLFRYMRPLIENGHTYIAMPPLYRLKWSNEHEFAYSDAERDKLLDSGRAAGHRIQRYKGLGEMNDHELWETTMDPTTRILKQVTLDEAADADETFSILMGDDVEQRRSFIQRNAADVRFLDI 701
50 0.000e+00gi|408789706|ref|ZP_11201351.1| DNA gyrase subunit B [Lactobacillus florum 2F]  clstr ali  51  8.SKAEQALEYDASQIQVLKGLQAVRKRPGMYIGATNSQGLHHLVWEIVDNGIDEALAGFATKISVVIEKDNSITVTDNGRGIPVDLQKETGKSALETVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSAELAVEVTRDGKRYYMDFVRG-HVQTPMKQIGTAPEEHGTKVHFLPDPDVFETTVFDMETLTTRVRELAFLNKGLQISIRDERSKEPVEHDFLYEGGIRHYVEFLDRGRQPVFPDPVYVE----------GVENGITVEVSLQYTNDYHSTLKTFTNNINTYEGGTHEEGFKQALTRIINSYGRTNKLIKDNEENLTGPDVREGITAVVSVKHPDPQFEGQTKTKLGNSDARTATNHVFSQEFSQFMNEHPQVAREIVQKGLLXXXXXXXXXXXXEVTRKKSGLEINNLPGKLANNTSKDPKISELFIVEGDSAGGSAKQGRSRLTQAILPIRGKILNVEKATMDRILSNEEIRSLFTAMGTGFGSEFDVNKAHYHKLIIMTDADVDGAHIQTLLLTLIYNFMRPMIDAGYVYIAQPPLYRVRQGNKQQYIDSDEELQTLLGSLAAPKPQIQRYKGLGEMDAEQLWDTTMNPENRRLLRVTSDDAEAAAAAFTMLMGEEVGPRRQFIEANAKFVENLDV 649
51 0.000e+00METAHIT V1 GL0053510 [Complete] locus=scaffold250_1:12159:14156:+  ali  47  2......SKDYTVSDIKVMEGLEAVRMRPGLYIGSPGARGLHHMLWEIVDNAVDEAANGFADTINVTLNKDNSVTVEDNGRGIPVGIHEKLGVSGVEVVYTQLHAGGKFDNDAYGFSGGLHGVGASVVNALSEYVIVEVATEGKSYIQRFHHSGIPEGPLQETGRT-RKRGTRVTFLPDRRVFETLDMNFEIISKRLRELAYLNRGVRFNLTDERTGDKKEREYCFEGGLSDFVKYLNADKTPLYPEPIHIS----------GTKDGIVVELAMQHNDGYTESMFSYVNNIPTTEGGTHETGFKSALTKIMNDYCRKSGLLKEKDASLSGEDFREGLTVVLALKMHSVQFEGQTKTRLGNTEAKPAVEFVMNEFLTPFLEKNSETASLMADKAIKAAKVRESARKAKSMAREKNKLDNAPLVGKLSSCTGRDYKINELFIVEGDSAGGSAKQGRDRRFQAILPLRGKPLNVEKKRIDQVLQNEEFRSIITAIGTGIGEDFDISGLKYDKIIILSDADQDGAHIRAILLTFFYRYMKELITEGHVYMGQPPLYKLQKGTNVQYLYDDAALNKALKAIG-KGYSLQRYKGLGEMNPEQLWDTTMNPENRTLVRVNIEDTADVEHLVTLLMGDKVGPRKEYISEYA........ 637
52 0.000e+00gi|354807457|ref|ZP_09040924.1| DNA topoisomerase IV, B subunit [Lactobacillus curvatus CRL 705]  clstr ali  46  2...PNQKQDYNDNSIQVLEGLEAVRKRPGMYIGSTDGRGLHHLVYEIVDNAVDEALAGFGSEINVVIGADNSISVRDHGRGMPTGMH-QSGIPTIEVILTVLHAGGKFTQNSYKTSGGLHGVGASVVNALSEWLTVRVVRDGVAYEERFENGGHPVGTLKKVGKAKEPNGTLITFKPDGTIFQTTTYNYNTLAERLRESAFLLKDVKITLTDLRAEPAREDVFHYPEGIQSFVDYLNEDKDTIGNKLYF-----------EGTKEDIEVEFAGQYNDGYSENIMSFVNNVRTGDGGTHEAGMKAGLTKAFNDYARKVNLLKERDKNMEGSDVREGLSAVLSVRIPEEQFEGQTKGKLGSPQARTAVDSLVYEQMSFFLLENGEFAQALVRKSLXXXXXXXXXXXXXXQSRKKKKKSDGLLSGKLTPAQSKNAAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVLNTQKAKLQEILKNEEINTMIYTIGAGVGAEFKLEDSNYDKVIIMTDADTDGAHIQILLLTFFYRYMRPLIEAGKVYIALPPLYKLQKGTKIAYAWTDDELKVVAKEMG-KGYSQQRFKGLGEMNADQLWDTTMDPTSRTLIRVRIDDAALAERRVTTLMGDKVEPRRKWIEENVKF...... 637
53 0.000e+00gi|366053156|ref|ZP_09450878.1| DNA topoisomerase IV subunit B [Lactobacillus suebicus KCTC 3549]  clstr ali  45  1MAKQK--SNYDDSSIQVLEGLEAVRKRPGMYIGSTDTRGLHHLVYEIVDNAVDEALSGFGKEINVTIEADNSITVQDHGRGMPVGMHA-SGIPTAEVIMTVLHAGGKFGQDGYKTSGGLHGVGASVVNALSERLTLTIVRDGVKYQEKFKDGGHPVGTLEKVGKTREPNGTCVCFKPDPSIFTTVVYNYSTLAERLRESAFLLKGVKITLSDRRVDQEQEEVFQYEEGIKEFVSYLNEDKDVLGDILYF-----------DGSKDAVEVEVAAQYNDGYSENLLSFVNNVRTPDGGTHEAGMRNAWTKTFNDYAHKVGLLKDKDRNLEGSDVREGLSAVISVRIPEKQFEGQTKEKLGTPEARKIVDAIVSEQLGYSLMENGEFAQMLIRKSQRARDAREAARKARDQSRKKRSKQERLLSGKLTPAQSKNAKKNELFLVEGDSAGGSAKQGRDRRFQAILPLRGKVLNTERAKLDDVLKNEELNTMIYTIGAGAGSEFNVEDSNYDKVIIMTDADDDGAHIQILLLTFFYKYMRPMIDAGKVYIALPPLYRLQKGKKIVYAWTNEELERVEKTFG--KASLQRYKGLGEMNADQLWETTMDPDTRTLIRIRIEDAALAERRVTTLMGDKVEPRRKWIEKN......... 634
54 0.000e+00METAHIT O2 GL0001902 [Lack 3`-end] locus=scaffold1488_1:380:2248:+  ali  53  1MKENK--EHYDASDIQVLEGLEAVRKRPGMYIGSTSSAGLHHLVWEIVDNAIDESLAGYCDDIEITINKDNSITVKDDGRGIPTGIHKKTGISTVETVYTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSSWVEVKVYQNSQVYYIRFENGGHTVAPLKVIDKCPDRTGTTVTFKADPEIFETTVYDYEILKQRVRELAFLNKGLRIILVDDREIEPKKETFVYEGGISEYVKFLNKGKTPIHEQIVHLE----------GEEDNISVEVAMQYNTGYTSNIYSFTNNINTHEGGTHEDGVKRALTRIINSYGKKNKFLKDNDAPLTGDDVREGLTMIISCKHPDPQFEGQTKTKLGNSEVRKIADDVFSEGFERFLLENPDEAKLIMEKAMTXXXXXXXXXXXXELTRRKGDLDVINFGGKLVDCKDKDPSVCEIFLVEGDSAGGSAIKGRNSMTQAILPLRGKILNVEKARLDRALSNEEIRTIITAFGTGIGEDFNLSKLRYDKIIIMTDADVNGSHIRVLLLTLFYRFFRPIVEAGHVYAAQPPLFCIKHGKTIKYVLNEEERDAYLASLPNTKYDMMRMKGLGEMDAEELNETTMDINTRVLRKITVEDAMAADEVFNKLMGEEVE.................. 623
55 0.000e+00gi|339448867|ref|ZP_08652423.1| DNA gyrase subunit B [Lactobacillus fructivorans KCTC 3543]  clstr ali  50  1MTDEEKAGEYDASQIQVLKGLEAVRKRPGMYIGATNEQGLHHLVWEIIDNGIDEALAGFADEINVVVEKDNSITVTDNGRGIPIGTQRDTGKSALETVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSKELDVVVTKGGKRYYMDFERG-HVKTPMKVIGDAPQDHGTKVHFVPDPDIFETTTFNMKTLTTRVRELAFLNKGLRITIRDDRPEEPVEHDFFYEGGIRHYVEFLDRGRTPIFKDPIYIE----------GQENGITVEVSIQYTNDYHSTLLTFTNNINTYEGGTHEEGFKRALTRIINNYGRNNNLIKDSEPNLSGDDVREGMTAVVSIKHPDPQFEGQTKTKLGNSDARTATDHIFGQEFSKFMMEHPQIAEQIVEKGSVXXXXXXXXXXXXEVTRKRSGLEINSLPGKLANNTSKDPNVSELFIVEGDSAGGSAKQGRSRLTQAILPIRGKILNVEKATMEKILANEEIRSLFTAMGTGFGNDFDISKVNYHKLIIMTDADVDGAHIQILLLTLIYNYMRPMIDAGYVYIAQPPLYRVRQGNKFQYVDSDEELQELLGQLASPKPQIQRYKGLGEMDASQLWDTTMNPDHRRLLRVTSDDASAAQEAFTMLMGEKVAPRRKFIEDNATFVENLDV 649
56 0.000e+00METAHIT V1 GL0082112 [Complete] locus=scaffold68014_5:192:2102:+  ali  48  1MVKNTTENHYGEENIQVLEGLEPVRKRPGMYIGSTDEKGLHHLAVEILDNSIDEALAGYCTHAYITINADGSLTIEDNGRGIPCGIHKTEGVSAVEVCLTKLHAGGKFGGGGYTISGGLHGVGLSCVNALSEWLVVEVDQDGKHHYQKYMRGVP-QAPLAVKGEAE-STGTKITFMPDKEIFDTVLWDYDRLKLRAREVAYLNKGITIVLADNREGRAKSETFCFLGGVAEFVDNLNRTKEKIFTETVYIDKSVKEG----------EVEIALQFNDGYNEIIYSYANNICTEEGGAHLDGFKNALTKVVNDYAHKLGLLKD-EEKLAGEDVREGLTAVVSVKLTEPQFEGQTKTKLGNASMRTAVARVVNDELGTYFEENPKEARELIIKCISAQRAREAARSARELTRRKGVFETTTLPGKLADCTEKNAAYSEIYIVEGDSAGGTAKMGRDRRFQAILPLRGKILNVEKARLGRVLENEEIKSMITAFGCGIGDEFNESKLRYKRIICMTDADVDGSHIRILLLTFFFRYMRPLIENGHVFIAQPPLYKITKNKQDHYAYSDKELNEKLALVGRGGV-VQRYKGLGEMSADQLWHTTMNPESRIMLQVTMDDAYEADEIFTVLMGEKPELRRQFIVDNATLVKELDI 636
57 0.000e+00Oral.Meta HOMD lori_c_2_417 Lactobacillus oris PB013-T2-3 [50090 - 48042] DNA topoisomerase IV, B subunit  ali  46  27...TTKKVKYDESSIQVLKGLEAVRKRPGMYIGSTDSRGLHHLVYEIVDNAVDEALSGYGDEINVTIEADNSITVQDHGRGMPVGMHA-SGKPTPEVIMTVLHAGGKFGQDGYKTSGGLHGVGASVVNALSTNLTLTIVRDHVRYQEKFKNGGQPVGTLKKLGKTRADSGTTVTFKPDPAIFTTTTYDYNTLANRLRESAFLLKGIKIVLTDKRPGQEQENVFQFNDGIQEFVSYLNEGKDTLGKTLYF-----------DGKDQGVEVEVAAQYNDGYSENLLSFVNNVRTPDGGTHEAGFRSAWTKTFNEYAKRVGLLKANDKNLEGSDVREGLTAVISVRIPELQFEGQTKDKLGTPEARKIVDTIVSEQLNYALMENGDFAQMLIRKALXXXQARGG--------KRKSRKE-RNLSGKLTPAQSKNANKNELFLVEGDSAGGSAKQGRDRKYQAILPLRGKVLNTEKAKLDDVLKNEELNTIIYTVGAGAGSEFDVEDSNYDKIIIMTDADDDGAHIQILLLTFFYKYMRPMIEAGKVYIALPPLYRLQQGKKITYAWTNDELTKLTKRMG-KTAQLQRFKGLGEMNADQLWETTMNPETRTLIRVRIEDAELAERRVTTLMGNKVEPRREWIEEN......... 660
58 0.000e+00gi|227510437|ref|ZP_03940486.1| DNA topoisomerase IV subunit B [Lactobacillus brevis subsp. gravesensis ATCC 27305]  clstr ali  45  34....KQKQKYDDSSIQILEGLEAVRKRPGMYIGSTDYRGLHHLVYEIVDNGVDEVLAGYGDMIRVTIHKDNSITVVDHGRGMPVGMHA-SGKPTPEVILTQLHAGGKFGQGGYKTSGGLHGVGASVVNALSTWLKVTIVRDGYKYEEDFKDGGHPVGTLRKLGKTKEHTGTTVSFKPDSSIFTNTVYNFSTLSERLRESAFLLKGTKIILIDERPGQEQEETFHYEDGIKEFVQYLNEDKHTLGDVMYF-----------DGTKDGVEVEVAAQYNDGYSETMMSFVNNVRTKDGGTHEAGLRNAWTKAFNDYARKVGLLKDKDKNLEGSDVREGLSVVLSLRIPEEQFEGQTKEKLGTPEARSIVDNVVSEKLGYYLMENGEFAQMLVHKXXXXXXXXXXXXXXXDETRKRHKKQERLLSGKLTPAQSKDYSRNELFLVEGDSAGGSAKQGRDRRYQAILPLRGKVLNTERAKLPEIMKNEEINTMIYTIGAGVGADFNIEDANYDKIIIMTDADDDGAHIQILLLTFFYKYMRPMIDKGRVFIALPPLYKLQKGAKIQYAWTNEELDSVSKTFG-KGYSLQRFKGLGEMNADQLWETTMDPATRTLIKVRIDDAALAERRVTTLMGDKVEPRRKWIEQNVKF--NL.. 670
59 0.000e+00gi|227890873|ref|ZP_04008678.1| DNA topoisomerase IV subunit B [Lactobacillus salivarius ATCC 11741]  clstr ali  45  15.EKSMPKNNYNDDSIQVLKGLEAVRKRPGMYIGSTDSRGLHHLVYEIFDNAVDEALSGYGKEINVIIHKDDSITVVDNGRGMPVGMHS-MGIPTVEVIFTVLHAGGKFGQGDYKTSGGLHGVGASVVNALSSKLTVNTVRDGIEYEEDFVNGGQPVGTLRKIGKAKRKSGTKVTFKPDANIFSTTKYNFNTLAERLRESAFLLKGVKITLTDERTDPYTEEEFLYAEGIKEFVEYLNEDKDVLGP-VMYFE----------GKKDGIEVEVAGQYNDGYSETIMSFVNNVRTKDGGTHEAGMKAAWTKAFNEYARKINLLKDKDKNLEGSDVREGLSAVVSVRIPEEQFEGQTKGKLGTPEARQIVDSVVNEQLGYFLMENGDFAQELVRKSIXXXXXXXXXXXXXDESRKKRRKSERLLSGKLTPAQSKNAKRNELFLVEGDSAGGSAKQGRDRKFQAILPLRGKVLNTQKAKLQDIMKNEEINTMIYTIGAGVGAEFNIDDANYDKVIIMTDADTDGAHIQTLLLTFFYKYMRPMINAGRVYIALPPLYKVKKKRVIKYAWTDAELESATKELK-KGYTLQRYKGLGEMNADQLWETTMNPETRTLVRVRIDDDTIAEKRVTTLMGDKVEPRRKWIEKNVKF...... 652
60 0.000e+00gi|453419|emb|CAA54665.1| gyrB [Mycoplasma hominis ATCC 23114]  clstr ali  51  1MDKIEEIHKYNADNIQILEGLEAVRKRPGMYIGSIGFKGLHHLLWEIVDNSVDEAMAGFATEIKIKLYPNNVIEVEDNGRGMPTGIHSGTKKSAVETILTVLHAGGKFDGSNYKVSGGLHGVGASVVNALSSEFEVWVKRDGKLHYQQFRNGGIPVKPLEVIGNSEVETGTTIKFHPDYTIMEKENFFFDTIIDHSKQIAYLNKGLKITV--ENVEKNIIKVFCFEGGLIDYVKELNKGKKLIVPEVIYAEGVFNDKNFTNGQ--DVIVEVAMQYNEAYTNSIVSYANNIQTIDGGTHEQGFYDALVRIYNNYAETNKLFKTSSEKITREDVKEGLVAIISIKHTDPIFEGQTKGKLENKDARIATNKILSDSLERYLNENPEIARAIIEKCLLSQHTRLLEIKAREASRKGNGLDLGNLPGKLADCSSKNAEIRELFIVEGNSAGGSAKMGRDRSIQAILPLRGKVINAEKNSFASVLSNKEIATMIHALGTGINTEFDINKLKYHKIIIMTDADVDGAHITTLLLTFFYRYMKPLIEYGFVYLAQPPLYKITSGKNVEYAYNDLQKEQIMAKLEDKNVAIQRYKGLGEMDPEQLWETTMDPETRKMLQVQIDDAAICDTVFATLMGEEIEPRHDFIQENAKYANNIDI 648
61 0.000e+00gi|374992266|ref|YP_004967761.1| DNA gyrase subunit B [Streptomyces bingchenggensis BCW-1]  clstr ali  47  23......AASYDANAITVLDGLDAVRKRPGMYIGSTGERGLHHLVQELVDNSVDEALAGVADRIDVTVLADGGVRVVDNGRGIPVGMHPVEKRPAVEVVLTVLHAGGKFGGGGYAVSGGLHGVGLSVVNALSTRLSAEIWTDGYRWTQDYRDGAP-TAPLARH-EATPRTGTSLTFWADGDIFETTEYSFETLARRFQEMAFLNRGLTLTLTDERPSAHKTVSYRYDGGITDFVAYLNARKEPVHPSVITIAAEDTERLL--------SVEVALQWNGQYTDSVYSYANAIHTHEGGTHEEGFRTALTTVVNRYAREKKLLREKDANLSGEDIREGLTAIISVKLGEPQFEGQTKTKLGNTEARTFVQKVVHEHLTGWFDRNPNEAADVVRKAIQAATARVAARKARDLTRRKGLLETAALPGKLSDCQSNDPAMSEIFIVEGDSAGGSAKSGRNPQYQAILPIRGKILNVEKARIDKILHNQEIQAIISAFGTGVHEDFDIARLRYHKIILMADADVDGQHINTLLLTFLFRFMRPLIEEGHVYLSRPPLYKIKWSRDHEYAYSDRERNMLLERGRQDGRRIQRFKGLGEMNAEELRVTTMDPDHRVLGQVTLDDAAVADDLFSVLMGEDVEARRHFIQRNAKDVRFLDI 677
62 0.000e+00gi|167751440|ref|ZP_02423567.1| hypothetical protein EUBSIR_02436 [Eubacterium siraeum DSM 15702]  clstr ali  49  36..NTQVEHAYGADDIQILEGLEAVRKRPGMYIGSTGESGLHHLVYEIVDNAIDEALAGYCTEINVKILPGDVIEVTDNGRGIPTGIHPKEKISAATVVYTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLELTVY-DGKIHFQRFENGGHYKEQMKVIGTTDK-TGTQVRFKPDSTIFHSTEFKYDILLDRLREQAFLNAGLKIVLSDLRDEKPKQEVLQYEGGIISYVEWLQKKREALHPDVVYIE----------GLLDNISVEIAFQYNTDFNETFRSFANNIHTVDGGTHEIAFKNALNKVINDFVKQYKEVKEF-VPLSGEAIREAINAVISVKLPECEFEGQTKGKLGNPEVRPVVYKITVEKLTYYFEEHPDTIATIAQKCINAQAARDAAKKAME-AKRKSVTDGASLPGKLADCSDTDPEKTEVYIVEGDSAGGSAKQGRDRRFQAILPLWGKMLNVEKARADKVYNNDKLQPVVKALGTGIGEDFDITKLRYGRVVVMADADVDGSHIRTLLLTFFFRFMRPLIEEGHVYLAQPPLFKVFRGKKVRYAFSDEERDAYIAELAGEKVDVQRYKGLGEMDPEQLWETTMDPAARTMIKVNLEDAAKADEIFSILMGDKVEPRREFIEQNARYAKDLDI 692
63 0.000e+00gi|160935172|ref|ZP_02082555.1| hypothetical protein CLOBOL_00067 [Clostridium bolteae ATCC BAA-613]  clstr ali  48  8...SPVTEDYGAAQIQILEGLEAVRKRPSMYIGSTSSQGLHHMVYEIVDNAVDEALAGHCTLIQVYLNKDGSVTVRDNGRGIPAGIQTKTGLSAIQVVFTVLHAGGKFDDSNYKVSGGLHGVGASVVNALSSHLHVQVDQDGFSYAQSYERGIPA-APVKQLGPCSQGTGTTVTFMPDQDIFPSIAWDRNILEERLRETAFLTQGLEISLYDLRRDPAGERTFCFQNGLKDFVSWLEQDGEPLYTGII----------SGRHETDKVQAEFALVHNSSYSEQLLSFANNISTPEGGTHVTGFRQALSRAVNDYARNAKLLKDTDSSLSRDELSEGLTAVLSVRLQDAQFEGQTKQKLGSSHVRPVVEQMVYTRLTLFLEQNPAAAKAICDKAMLXXXXXXXXXXXXEMARRKTALSGLSLPGKLADCSSKNPGECELFIVEGDSAGGSAKLARSRENQAVLPLRGKILNVEKASLDRISANAEIKAMISAFGTGILDTFSLENLRYNKIILMTDADVDGAHITTLLLTFLFRFMPKLIEEGHVFLAQPPLYRVEKGKKLWYAYSDSELEQTINAIGRDGYKIQRYKGLGEMDAGQLWETTMDPSRRTLLRITINDMEETCQTFSILMGDEVEPRKNFILEHAQYISMLDI 657
64 0.000e+00gi|385326607|ref|YP_005881044.1| DNA gyrase subunit B [Mycoplasma gallisepticum str. F]  clstr ali  64  2..NNTKKDQYSSQSIKVLEGLSAVRKRPGMYIGSTDQKGLHHMIWEIIDNSVDEMMAGYGTTVKLTL-KDNYVEVEDDGRGIPVDIHEKTNKSTVETVLTILHAGGKFDSDTYSMSGGLHGVGASVVNALSSSFKVWVNRDYKIHYIEFKDGGVPLKPLEIIGTDNKKQGTRIQFVPDFSIMEQFEYDETIISDRIEQLAFLNKGIKFIFNDERTDKKTKQEWLYEGGIKQYVENLNASKEPIIPQIIYGEKKTKVTLPKRNLEVTMLLEVAFQYTNGYYNSTYSFCNNIHTNQGGTHEEGFKNALYKIINRYALEKKFIKETDGKISKEDLSEGLTAIISIKHSEPQYQGQTKDRLGNTEVREFTNSVVSELLERFFLENPEEAAKITAKAVSAMFSRKRSEAALESAR-KSPFESASLPGKLADCTTKDMEISELYIVEGDSAGGSAKSGRDRFYQAILPLRGKVLNVEKANHEKIFKNEEIRTLITAIGAGVNPEFSLDKIRYNKIIIMTDADVDGAHIRILLLTFFFRHMFPLIEKGHVYIAQPPLYRVSYNKQNKYIYSDAQLEEWKNQNPNVRYELQRYKGLGEMDDVQLWETTMDPEKRTLLKVSINDAANADKTFSLLMGDEVSPRRDFIEKNAKSVKNID. 647
65 0.000e+00gi|258650278|ref|YP_003199434.1| DNA gyrasesubunit B [Nakamurella multipartita DSM 44233]  clstr ali  52  2...TTKKNEYGASSITVLEGLEAVRKRPGMYIGSTGERGLHHLVQEVVDNSVDEAMAGYADRVEVILRADGGVTVIDNGRGIPVEMHPKEKKPTVEVVLTVLHAGGKFDSDSYAVSGGLHGVGVSVVNALSTRLDVEIHRDGHAYRQSYRYAKP--GPLETIGPSSR-TGSSVTFWPDGEIFETVEFKLETISRRLQEMAFLNKGLTITLRDERAWKPLERTFHYPGGLVDYIKHLNHTKDPIHPSIVGFESKG----------ETMEVEVAMQWNSSYNESVHSFANTINTHEGGTHEEGFRSSLTSVVNKYATDKKLLKEKDDKLSGEDVREGLAAIISIRLREPQFEGQTKGKLGNTEAKSFVQKACNEWIADWFERNPSEAKTIISKAVSSAQARAAARKARDLVRRKGALEIGGLPGKLADCRSTDPSKSELYIVEGDSAGGSAKSGRDSMFQAILPIRGKIINVEKARIDRVLRNTEVQSLITALGTGIHDDFDLAKLRYHKIVLMADADVDGQHIRTLLLTLLFRFMRPLVEAGHVYLAQPPLYKIKWSKAHEFAYSDRERDGLIAEGERAGRRVQRYKGLGEMNAKELWETTMDPANRLLLQVTLEDAATADELFSVLMGEDVEARRAFITRNAKDVRFLD. 669
66 0.000e+00gi|183602673|ref|ZP_02964037.1| DNA gyrase subunit B [Bifidobacterium animalis subsp. lactis HN019]  clstr ali  47  39..DTLSPEHYDASDLRVLEGLEAVRIRPGMYIGSTGPRGLHHLVYEIVDNSVDEALAGYATHIEVTILPDNGIRVVDDGRGIPVDEVPGEGKSGVETVMTKLHAGGKFGGGGYAVSGGLHGVGISVVNALSTRVDVEVRRQGYYWTQTYID-QHPTGPLER-GRADESTGTSVTFWADPKIFETTIYDFETLRSRFQQMAFLNKGLKITLTDMREELHQTVTYQYKNGIKDYVAFLVKSRAPIEPDVIDIESEDLTI--------GVSAEIAMQWTSAYSESVHTFANTIATTEGGTHEEGFRAALTSMINRYARDKNILKDKDDNLSGDDVREGLTAVISVKLTNPQFEGQTKTKLGNSEAKTFVQRVMNEKLGDWLDAHPNEAKNIIQKALEASRARLAAKKARENTRRKSIFESAGMPDKLKDCQSNDPSECELFIVEGDSAGGSAIQGRNPLTQAILPLRGKILNTERASLDRMLKSDTIESLITAIGGGYGEDFDLDKVRYHKVIIMADADVDGAHIATLNLTLFFRYMRPMITAGYVYVAMPPLYRLKWTKGPHFVYTDAERDRVLAEGKANGRQIQRYKGLGEMSYQELWETTMDPDHRILKQVHIEDALQADETFSMLMGDEVEPRRLFIQRNAHNARWID. 704
67 0.000e+00gi|365906118|ref|ZP_09443877.1| DNA gyrase subunit B [Lactobacillus versmoldensis KCTC 3814]  clstr ali  52  13..KEKLAEEYDASQIQVLEGLEAVRKRPGMYIGSTSGQGLHHLVWEIIDNGIDEALAGFATKIEVTVEPDNSITVTDDGRGIPIDIQKKTGKPALETVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSSELDAVVTRGGKEYGIDFEKG-KVKHAMHVVGEAGEDHGTRVHFVPDPDIFETTVYDDKTLTTRIRELAFLNKGLKLTFTDKRKDTAEKLVFHYEGGIKSYVEFLNKGKEALFEEPIYLE----------GVQDGITVEVALQYVDEYHTNLMTFANNIHTYEGGTHEVGFKTALTRVINDYGHKNKLLKDTE-KLSGEDVREGMTAVVSIKHPDPQFEGQTKTKLGNSDARTITDRLFSEHFMKFLMENPNVAKKIIEKGTLATKARLAAKRAREVTRKQNGLEISNLPGKLADNASKDPEISELFIVEGDSAGGSAKTGRSRLTQAILPIRGKILNVEKASMDKILANQEIRTLFTAMGTGFGDDFDISKARYHKIIIMTDADVDGAHIRTLLLTLLYRYMRPVVEAGYVYIAKPPLYQVRQGKIMKYLDTDQEKDDFISQLPAKEPKIQRYKGLGEMDADQLWDTTMDPEKRRLDRVKLDDAVEANQIFSMLMGDKVAPRREFIEDNARYAE.... 647
68 0.000e+00gi|406947325|gb|EKD78269.1| hypothetical protein ACD_41C00379G0002 [uncultured bacterium]  clstr ali  47  1MTKKTATSTYGAQQITVLEGLDPVRKRPGMYIGNTAHAGLHHLIWEVVDNSIDEAMAGFCNEISMALLPDGYVAVEDNGRGIPVEKHPVTKVSTLETVLTKLHAGGKFGNGGYKVSGGLHGVGVSVVNALAADLIAQVKRDGKLYEQKYKLG-KPQGGVKVVGKSS-ENGTIITYKADGSIFTVSEYDWKFVLDHLRQQAYLTKGLTLKLFDKRDANIQTYTYYFEGGVASYCRHLNHLKEVKQEKVFYVEKDV----------DNVKVEVALQYNGDYNELVYGFANNIHTVEGGMHVQGFRTALTRCLNSYARKAGFLKEKDANLQGEDVREGLTAVISVKLSDPQFEGQTKAKLGNAEIKPIVETVFGDYFAAFLEENPHDAREIISKCLIXXXXXXXXXXXXDTVLRKGALEGITLPGKLADCSSRKPEECEIYIVEGDSAGGSAKQGRDRRFQAVLPLRGKILNVEKSRLDKMLANNEIKNLIIAMGTNIGEQFDLARLRYHRIIIMTDADVDGAHIRTLLLTLFFRHFLEVIRNSHLFIAQPPLYRVSKGREVHYAFSDAERDKVVAEFTKQGVNIQRYKGLGEMNPEQLWETTMNPASRVMQVVTIDDAEKADEIFDILMGSEVPPRKRFIQAKAKSVRNLDI 663
69 0.000e+00JCVI_PEP_1096700300839 /source_dna_id=JCVI_ORF_1096700300838 /offset=0 /translation_table=11 /length=662 /full_length=662  ali  45  5....EMADDYGADSIQVLEGLEAVRKRPGMYLGDPDGSALHHCIWEVVDNAVDEHLAGHNPTIEVDLNPDGSISVTDHGRGIPVDMHPEEGVSAAEVIMTKLHAGGKFDNEAYKVAGGLHGVGVSAVNAVSEWLHLEIHRDGKVWEQRYNQGVP-KAKLKSTGKTE-VTGTKVSFKPDLTIFSDIEFDFEQINTRLQRTAFLNGGLQIIFRDLRGEDPVEIDHTYDGGLREYVAQMNSKKNTIHDEVIHIFGEK------EGDKGEVHVEIALQWTDSYSESIDCFTNIIHNADGGTHMSGLRSSLTRTVNSYAQSRNLLKNL-SSLSGDDVREGLGAVVSIKHPDPSFNAQTKAKLVTSEVAGIVEQIVNDKLGEHFEENPSIARAIVDKAVLASKAREAARKARDLTRRKGVLEGGGLPGQLADCQSRDPNECEIYIVEGESAGGSAKTARDRRTQAVLPLRGKILNVERQRDAKVFTNEQIQRMIRAFGAGVGNDFDPEKLRYGKIIIMCDADIDGAHIRTLIMTFLWRYMRRAITNGNVYIAMPPLFSVGRGNNVEWVHSEEELDRLKKEAPSAKISVQRYKGLGEMNPEQLWETTMDPEVRRMMRVTIKDIEAGDELFTILMGEDVPDRRAFIEQNASEVTSLDV 661
70 0.000e+00gi|260437351|ref|ZP_05791167.1| DNA gyrase, B subunit [Butyrivibrio crossotus DSM 2876]  clstr ali  47  1MA-TKVNNVYDASSISILEGLEAVRKRPGMYIGSVSTKGLNHLIYEIADNSVDEHLAGYCDTIYVTLNNDGTATITDNGRGIPTGIHPKAGIPAVEVVFTVLHAGGKFGDGGYKISGGLHGVGASVVNALSEWLEVRIKQGGIVYEQRYERG-KAVYKLRECGTCRKDTGTSVTFLPDNTIFEKTEFKAESIENRLHETAYLNPGLTIVFENARKGEEKKVTFHEEEGITAYVKALNENKEAVHDVAYY-----------KGSRDGIEVECAFQYVDEFQEQILGFCNNIYTAEGGTHLTGFKTQFTTVINKYARELGILKEKDVNFTGSDVRNGMTAIVAVKHPEPRFEGQTKTKLDNQDAGKVVADITAAELVRFFDRNLETLKSVIACAEKAAKIRKQEEKAKTLTKQKFSCDTN---GKLANCESRNPEECEIFIVEGDSAGGSAKTARNRKTQAILPIRGKILNVEKASMDKVLANAEIKTMITAFGCGFGNDFDISKLRYNKIIFMTDADVDGAHIDTLLLTFFYRFMPDLIREGHIYLATPPLYKVPKKGQGRYLYDDKALEKYRKEHEGSSFTLQRYKGLGEMDADQLWETTLNPETRILKQIEIEDAKMASDITSMLMGTDVPPRREFIHTHAHDAE-LDI 641
71 0.000e+00gi|328954619|ref|YP_004371952.1| DNA gyrase subunit B [Coriobacterium glomerans PW2]  clstr ali  47  3.....KKNDYNGGEIKILEGLEAVRKRPGMYIGSTSASGLHHLVYEVVDNSVDEAMAGYCTRIGVTIHADNSVTVIDNGRGIPVDKHPVKRIPTLEVVMTILHAGGKFDNKAYKVSGGLHGVGISVVNALSHRVRVQVKRDGNIYEMVFSRG-KTVEKMHIVG-SSRSTGTTITFWPDDEIFETTIFDYDTLRNRLQETAFLNRNLRITITDERELAPRTEEFVYAGGIVDFVKYLNHGKDIL-KKPIYVSGASEEDAP---VERTGEVEVALQWSSSYTENVMCYANDIFTPEGGMHLEGFRTALTRVINDYARRQNMIKEKDANLTGDDVREGLAAVISVKLADPQFEGQTKAKLGSSFMRGLVLKVLSDGLSDYLEEHPRAGREIVRKAQQASRARNAARKAREATRRKSLLETAALPGKLADCSVRDAEMTELFIVEGDSAGGSAKDGRRRDIQAILPLRGKILNVERVGDHRAFSSETIQSLITAIGSGVGEGFDVSKARYHKIIIMTDADVDGAHIRTLLLTFFYKYMRPLIDEGFVYVACPPIFGVKVGKKIHYVYPDDELEADRPKKKHRGYAVQRYKGLGEMDPAQLASTTMDPKTRILQRVTIEDASLAERAVRELMGPDVAPRRDYIEKHAHDARFLD. 673
72 0.000e+00gi|338731010|ref|YP_004660402.1| DNA gyrase subunit B [Thermotoga thermarum DSM 5069]  clstr ali  48  2.......TEYTAESIQILKGLEPVRARPGMYIGSTGKSGLHHLVYEIIDNSVDEALAGFCDTIKVSLHEDGSVEVEDNGRGIPVDPHPETGKSALEVVMTTLHAGGKFSKDAYKVSGGLHGVGASVVNALSEKMEVWVHRDGLIYYQAYSRG-KPLCEVTVVGKTNK-RGTIVRFKPDPEIFSTVEFDPDIIQTKLRELAYLNVGLKIIFEDKING--YTEVYQYKGGISEYVRYLAGNRKMLHEVI-----------RISGEWEDVKVDVAMVYTDS-QEQIYSYANTIRTVDHGTHVTAFKNAITKLFNEYAKSLGILK-KDESFQGEDVREGLIAVVSVLLKNPEFEGQTKAKLGSEIAGVAVSKVVREKLTEYFEINKATLKIILERIAQAMRAREAAKKARDLVRRKNALENSALPGKLADCVSTDLEKSELFIVEGDSAGGSAKQARDREFQAVLPIRGKILNVEKSSIHKLLNNEQIKDIIVAIGTGIGDKFDRSRLRYGKIIIMTDADIDGAHIRTLLLTFFFRYMRPLIEEGRVFIAVPPLYKVSVNGKIYYLYSEEEYEKFKSQLKGTKIEVQRYKGLGEMNPEQLWETTMNPQTRKMIKVTIEDAEEADTLFNILMGENTAERRSFIERHALKVTYLDV 630
73 0.000e+00gi|224543251|ref|ZP_03683790.1| hypothetical protein CATMIT_02451 [Catenibacterium mitsuokai DSM 15897]  clstr ali  47  4.....SNAHYDESDIQILKGLEAVRKRPGMYIGSTDSRGLHHLVWEIVDNSIDEAIAGYGKKITVTLHKDNSVTVEDEGRGMPTGINKETGKPTTEVILTVLHAGGKFEDGGYKTSGGLHGVGSSVVNALSEFLEVTVHRDGVIHTQRFEKGATKIGKLKKVGKTNK-TGTIIHFKPDASIFSTTTFSFQTISERLREDAFLLKGMTIELIDERTD--KDETYQYEKGLEEFIDWINNDKEAVSPIISF-----------DDTNNEIEVEIAMQFTQSYQENIISFVNLVRTGDGGTHEVGFRSGLTKVFNEYARKYALLKAKDKNLEGSDVREGLNAIISVKIPEKQFEGQTKSKLGSPIARNILENVTFERITYFLEENKDIAEKLIEKMIKAANARQAARKAKEQARKKNNREAKFLSGKLAPAQSKNKRKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTEKATQADILKNEEISTMINTINAGVGADFNADDSAYDKIIIMTDADTDGAHIQILLLTFFYRYMRDLIKAGKVYIAMPPLYKVSKGKKDIYCWDEKDLEAARKKMGR-GYDVQRYKGLGEMNAEQLWETTMNPETRTLIQVTIDDAAIVERSVSVLMGDKVQPRREWIENN......... 632
74 0.000e+00JCVI_PEP_1096683288657 /source_dna_id=JCVI_ORF_1096683288656 /offset=0 /translation_table=11 /length=656 /full_length=656  ali  45  15MPKKKSEDKYDSSNIQVLKGLEAVKKRPGMYIGDTDDSGLHHMIFEVVDNCIDEAMAGHCSKIDIIINKDESITVKDNGRGIPVDTHKGEGVPAAELIMTTLHSGGKFDDNSYKVSGGLHGVGVSVVNALSKELTLTICRDGGMYQQKYSEGL-AKTKLKKI-KGSKETGTEITFTASDKIFTSINFEADRVNKRVQELSFLNAGVSIEVTDARTGKSKK--FKNEGGVSSYVDYLRGRKPALCQTI-----------ECEGGQEGVTVEIAMQWNDSYNENVLCYTNNIPQKDGGTHLSGFRSSLTRVLKAFVKKEELNKNSPIELLGEDVREGLIAVISVKVPDPKFSSQTKEKLVSSEVEGIVSAVLNKSLNEFLLENPKEAMAILSKVSEAALAREAARKAREMTRRKGVLELAGLPGKLSDCQEKDPALSEIYLVEGDSAGGSAKQGRNRKYQAILPLKGKILNVQKARIDKVLSSAEIGTMVKAFGCGIGEDFDIDKLRYHRIIIMTDADVDGSHIRTLLLTFFYQQYYDILERGHVYIAMPPLYKISKGKSFVYASDEDEKENAVKEFGSKGVDVQRYKGLGEMNPDQLWETTMDPENRRMMRVDIKDAQDATDMFETLMGDDVEPRREFIETNALSVSNLDI 655
75 0.000e+00gi|406991560|gb|EKE11050.1| hypothetical protein ACD_15C00149G0003 [uncultured bacterium]  clstr ali  49  1MTTEKEKSEYTAKSIQVLEGLEPVRKRPGMYIGGTSTEGLHHLIWEVVNNSVDEAMAGYGKEIIMRLMPDNIVEISDHGRGIPVEIHPQTKKSTLETVLTVLHAGGKFGGNGYKISGGLHGVGVSVVNALSVWTKAEICRDKKIYVMEFERGVPKTNEPKVIGKSEK-TGTKISFQADPQIFPEIKYNWEKILAYVRHQAFLVKGIHIKVYDEREGKEKAYGFLFDGGLTSFIKFLNRGKEIKNEFPFYVEKE--------DEKTESVVEIAMQYTDSYKEHIFSFANNIFTPEGGMHEVGFRTALTRVINSYARKNNILKEKDENFTAEDLQEGLTAVISVKLRNPQFEGQTKAKLGNGEMRGIVSAITAEALNDYLESHPNNAKAIIGKCLLTNKARIAARAAKDAVIRKGALEGMTLPGKLADCSSKNPAESELYIVEGDSAGGSAKQGRDRKFQAILPLRGKLVNVEKTTLDKVVKSDTLKPIIIALGAGIGDSFNIEKLRYQRIIIMADADVDGSHIRTLLLTFFYRYYEELINRGYIYIAQPPLYRIQKGKDVQYVYTEEEKNIAVDKIKIAGINIQRYKGLGEMNPEQLWETTMDPGNRLMLQVSIEDAEAADKMFDVLMGSEVEPRRRFIQTHAKSVKNLDV 687
76 0.000e+00METAHIT MH0031 GL0056118 [Lack 3`-end] locus=scaffold75795_1:2:1981:-  ali  49  1MTENK--ENYSASNIQVLEGLEAVRKRPAMYIGDTGPKGLHHLVYEVVDNSIDEALAGYATHIEVIIGEDNSITVVDNGRGIPVDKHEKLHKSALEVVLTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSSYLRAEVRRNGHVYMQEYAYG-HPKAPVAIVGDTE-ETGTKVLFKPDPSIFETTVYNYDTLANRLRDLAFLNQGIHLTLTDMREGNPKSEVFYSTEGLKEFVRYIDQSKEHLIDDIIYINT----------ERQGIPVEVAFTYNTAFNENIYSFVNNIDTIEGGTHLTGFRRGLTSTLKKYADDSKILEKEKVTVDPADFREGLTAVISVKVLEPQFEGQTKTKLGNNEVIGAVQTAVSEALGIYLEEHPKQARTIVEKVALAARARQAAYKARVSIQRKSPLGGGGLPGKLADCESNTAEDCELFIVEGDSAGGSAKMGRDRVHQAILPLRGKILNVEKAMEHKIFDNQEITNIFRALGVTIGTEEDISKLRYHKIIIMTDADVDGAHIATLLMTLFFRRMRPIIENGYLYLATPPLYKCTKGKTERYCWTDDQLRSFIQEFGRKSVNVQRYKGLGEMMAEQLWETTMDPENRWLKQVNISDAAACDRIFSMLMGEDVAPRREFIEK.......... 639
77 0.000e+00gi|374584202|ref|ZP_09657294.1| DNA gyrase subunit B [Leptonema illini DSM 21528]  clstr ali  47  13MS--KKIGEYTGEKIQVLEGLEAVRKRPGMYIGTQDATGLHKMVYEVVDNSVDEFMAGFASEITISILEGNIIEVQDNGRGIPVDIHPKAKKPTLEVVMTVLHAGGKFGDDAYDVTGGLHGVGVSVVNALSEYLEAEVHIGGQIHFQRYERGVP-TAPVKIKGKT-KHHGTIVRFKPDASIFTTVEFKYMALRQRLEEMAFLNKGLTIHLKDERKGHVKTETFRYDGGILQFVEKLISKKDRLHKKLIYFE----------GKNETVRGEFCLAYTDGQAETIYSFTNGINNMLGGTHLEGFRTALTRTLNEYLKKDEALKKKGATLSGDDVREGLVAVISVKIPEPQFNSQTKEKLVNAEVKGLVQQLVADKLALFFEENPAEVKPILEKCILSSKAREAARKAREMTKRKGILEGGGLPGKLADCAEKDASVSELFLVEGDSAGGSAKQGRNRNFQAILPLKGKILNVFRVKDHKILENEEIKTLVTAIGAGFGNDIDLDRMRYHKIIIMTDADVDGSHIRTLILTFFYTKMRPIVDAGYLYIAQPPLYLIRSGKEAVYAYTDAEKDKVVKQFNSDKTVVQRYKGLGEMNPEQLWETTMDPERRVMLRVKPLDESNVEETFSVLMGDEVAPRRKFIEDNARQVVHLD. 655
78 0.000e+00METAHIT MH0014 GL0054865 [Complete] locus=scaffold18974_1:1064:3049:-  ali  46  1MA--NQANHYDAGNIQVLEGLEAVRMRPGMYIGTTSTRGLHHLLWEIVDNAIDEASNGFADEVRVTLHTDGSASVYDNGRGMPVDEHPTMHVSGAEVIFTVLHAGGKFNNENYSYSGGRHGVGASVVNALSKWLTVDIYRDFSHYAMRFKKGGKPDAPLAKVGNTRKK-GTLVRFLPDDAIFEDVRFNYDTVFRRLQELAYLNRGLKIVFLDERVSDPRETTFHYEGGIIDYVRYLNDGKTVLHDQPIYLE----------GQKDSVICRVAIQYTDGYTESLFSYVNNIPTGEGGTHETGFKAAFTKMFNDYARRNGFLKEKDSNLTGEDFREGLSCVLTTMVKNPQFEGQTKGRLGNSEVRPAVEGIITQQLTDWLEKNQEIAQQIVQKAIRAAQVREAARKTRDNARKANQLDAAPLVGKLSACRGKKAEDNELFIVEGDSAGGSAKQGRDSRYQAILPLRGKPLNAEKKRLDQVLSNEEFRSLITALGTSIDENFNLANLKYNKVIILSDADQDGAHIRAILLTFFFRYMKEIVTGGHVYIGMPPLYKVQKGSKVLYAYDDKELAKCIKE-AGKGYTLQRYKGLGEMNPEQLWATTMDPSQRKLMQVTIEDAALADRRITILMGDKVEPRRDYIIENA........ 642
79 0.000e+00gi|373253338|ref|ZP_09541456.1| DNA gyrase subunit B [Nesterenkonia sp. F]  clstr ali  50  23.....QAGEYGASDITVLEGLEAVRKRPGMYIGSTGERGLHHLVYEVVDNSVDEALAGHCSHIEITLQDDGGVRVSDDGRGIPVAMHPTEGRPTVEVVMTILHAGGKFGGGGYAVSGGLHGVGISVVNALSTRVETIVRRDGKTWSVHFADGGKVVQPLTEGGPAD-ETGTTQIFYPDPDIFESTEFDFETLRARFQQMAFLNKGLRITLADEREQTGRVVVYQYDAGLLDYVEHLNKAKENVHEDIIAFEAD--------DDERGITAELAMQWTMTYSESVHTYANTINTHEGGTHEEGFRAAMTSLMNRYARENKLLREKDDNLAGEDIREGLTAVISVKLSEPQFEGQTKTKLGNTEARGFVQRVVTDHLGAWLERNPAAARDIVRKAQSAAQARVAARKARENARRKSPLETLGMPGKLSDCSSKDPSRCEVYLVEGDSAGGSAKRGRNPETQAILPLRGKILNVERARLDKALGNQEVQSMITAFGTGVGEDFDLAKLRYHKIVLMADADVDGQHITTLLLTLLFRYMRPLIEGGHVFLAQPPLYRLKWSNAPHYVFTDAERDQALQEGLAAGRKIQRYKGLGEMDYSELWDTTMDPDHRTLLQVSMEDAAAADEVFSVLMGEDVESRRGFIQQNAKDVRFLDI 691
80 0.000e+00gi|288932528|ref|YP_003436588.1| DNA gyrase subunit beta [Ferroglobus placidus DSM 10642]  clstr ali  49  2.......EEYTAEQIEVLSDLEAVRKRPGMYIGGVGIRGLHHLLWEVIDNSVDEHLAGYCSRIRVVLHRDGSASVEDDGRGIPTEMHP-LGKPALEIVMTKLHAGGKFSKKAYKVSGGLHGVGLSVVNALSEWVEVIVKRNGKIYRQRYERGVPVT-PLEIIGETN-ETGTYVRFKPDEEIFETTEFRYDIVAHRLRELAYLNKGLKLELYDERSG--KKEEFYSERGIVEFVEHLNANREKI-SDVIYIS----------GERNGISVEVALQYTNTDFETILAYANNIHNVEGGTHVVGFRAALTRAINEYGKKN--VKNFKP-ITGVDVREGLTAVISVKVPEPQFEGQTKTKLSNSEVKTAVETIVYSELMRWFEEHPEQANKIIEKCILXXXXXXXXXXXXDVIKRRE--EVATLPGKLADCSSKNPEERELFIVEGESAGGSAKQARDRRFQAILPIRGKIINVEKAGMVRVLKNDEIKAIIAAIGAGFGKDFDIKKARYRRIIIMTDADIDGAHIRTLLLTFFYRYMRPLIENGYLYIAQPPLYRVKKGKKVYYLYSDKELENLLKRIG--DAEVQRYKGLGEMNPEQLWETTMDPKRRILIQVTLEDAAMAEEIVSILMGENTEDRKRFIMEHATEVRNLD. 620
81 0.000e+00gi|386845077|ref|YP_006263090.1| DNA gyrase subunit B [Actinoplanes sp. SE50/110]  clstr ali  49  1MAENN--QEYGAESITVLEGLEAVRKRPGMYIGSTGERGLHHLIWEVVDNAVDEALAGYCDTIDVILLADGGVSVTDNGRGFPVDLHPKLKKPGVEVALTVLHAGGKFDNQAYKVSGGLHGVGVSVVNALSTRMAVKIHKNGFVWRQKYNASVP--EEL-IKGEATETTGSTVQFWPDPAIFETVEFDFQTIYRRLQEMAFLNRALTINFTDERNGEPRKVTFMYAGGISDFVRHLNATKSAIHKTVIEFGAEDNEA--------GMGVEIAMQWNESYGESVYTFANRINTHEGGTHEEGFRAALTTIVNKYGIEKKFLK-GDQKLSGEDIREGLAAIISVTLREPQFEGQTKTKLGNTDMKSFVQKVANEQLADWFDRNPADARLIITKADXXXXXXXXXXXXXKLARRKSLLESGSMPGKLADCQSTDPRETELFIVEGDSAGGSAKQGRSSKYQAILPIRGKILNVEKARIDRVLKNNEVQALITALGTGIHDEFDIGKLRYHKIILMADADVDGQHIQTLLLTLLFRFMRPLVEQGHVYLASPPLYKLKWNKRAQYAYSDRERDGLIALRQQKKPNIQRFKGLGEMNFHELWDTTMDPDTRTLRQVTLDDAAVADELFSVLMGEDVEARRSFIQRNAKDVRFLDI 650
82 0.000e+00gi|410457957|ref|ZP_11311723.1| DNA topoisomerase IV subunit B [Bacillus azotoformans LMG 9581]  clstr ali  48  2...TNKSFDYNDDAIQVLEGLEAVRKRPGMYIGSTDIRGLHHLVYEIVDNAVDEALSGFGNYIKVTIHKDDSISVEDKGRGMPTGMH-KMGKPTPEVILTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSEWLVVTIKRDGNIYRQRFENGGHAVTTLEKIG-TTKESGTTIHFKPDTSIFSTTVFNYDTLSERLRESAFLLKGMKITIVDERHD--VQDVFCYDSGIKAFVDFLNEEKDVLHEVV-----------SIEGEQQGMEVEYAFQFNDGYSENILSFVNNVRTKDGGTHEVGAKSAMTRAFNDFARKVNILKEKDKNLDGSDIREGLTAIISVRIPEEQFEGQTKGKLGTSEARSVVDSIVSEKLAYFLEENPDISSLLIKKAIDAM-----------------------LSGKLTPAQSRNPEKNELYLVEGDSAGGSAKQGRDRRFQAILPLRGKVINTEKAKLGDIFKNEEINTMIYAIGGGVGADFTIGDINYDKVIIMTDADTDGAHIQVLLLTFFYRYMKPLIEEGKIFIALPPLYKVSKGKKEEYAWDENELKAAIKKVG-KGYIIQRYKGLGEMNADQLWDTTMNPETRTLIRVTIEDIARAERRVTTLMGDKVEPRRRWIESN......... 631
83 0.000e+00gi|297558991|ref|YP_003677965.1| DNA gyrase subunit beta [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]  clstr ali  50  3.........YDAGSITVLEGLEAVRKRPGMYIGSTGERGLHHLVYEVVDNSVDEALAGHADAIEVTLLADGGVCVADNGRGIPTDLHPVEKRPAVEVVLTTLHAGGKFDGKSYAVSGGLHGVGVSVVNALSTALEVEIRLHGHVWRQRYEMTAP-TGEL-VKGESTDETGTQITFWPDGDIFETTTFSFETLARRMQEMAFLNKGLSITIRDERDGGPTVNTFHYDEGLSDYVRHINAKKEPAHASIISFE----------EEGEGISVEIAMQWNQSYTSSVHTFANTINTAEGGTHEEGFRSALTTLVNRYARDQKLLREKDDNLTGDDIREGLTAIISVKLADPQFEGQTKTKLGNTEAKSFVQKVTNEHLRDWFERNPGEAKDIVSKASXXXXXXXXXXXXXDLTRRKTLLETTSLPGKLSDCQSTNPEECEVYIVEGDSAGGSAKGGRNPHNQAILPIRGKILNVEKSRIDRILKNAEVQAIITALGTGIHEEFDAEKLRYHKVILMADADVDGQHIRTLLLTLLFRFMKPLVEAGNVYLAAPPLYKIKKGSDASYAFSDAERDRVIEAGIAQGKRVQRFKGLGEMNANELWDTTMDPDRRVLLQVSLEDAAQADELFSVLMGEDVESRRAFIQRNAKDVRFLDI 645
84 0.000e+00gi|50364821|ref|YP_053246.1| DNA gyrase subunit B [Mesoplasma florum L1]  clstr ali  53  1MAE----QNYGAESIKVLKGLEAVRKRPGMYIGSTSKAGLHHLVWEIMDNSVDEAMAGFANKIILTITKEGEIIVQDNGRGIPVGIQADSGKSALELVFTQLHAGGKFDSDSYKISGGLHGVGASVVNALSLYVDVQVKREGKIHHQVFSGGGTQQTEIEIIGETN-ETGTIVRFKPDPEIFEGTEFDYETIRNKVKQLSYLNKGLVIELNDLRID--KHVEYHFPNGILDYVKEKNETKVKINPSIFYVD----------DKHDDIEVEVALQYNAEYQENLITFVNNINTHEGGTHEDGLRQSLVRVINRYAEKVATGNKPAAKYSWDDIKEGMVCIVSIRHTDPQYEGQTKTKLANPDAKKAVDAVVGDAFEEFLLKSPEDAKAIIDKNANAQKARIAAQRAREETRRKSALDTFSLPGKLADCESKDPEIAELYLVEGDSAGGSAKTGRNRRFQAILPLRGKVLNVERVAEVRAFANNEIKSIVTAIGTGIKEDIDLSKLRYGKIVIMTDADVDGAHIRTLLLTFFYRYMKQLVVDGHVYIAQPPLYKIEAGKKVAYAYSDVELEELKADFKDSRFTIQRYKGLGEMDPIQLWETTMDPEKRTMLQIKLEDAAIANEVFSDLMGEDPELRRNYIQENAEFVENID. 634
85 0.000e+00gi|384110046|ref|ZP_10010888.1| DNA gyrase, B subunit [Treponema sp. JC4]  clstr ali  49  2......ANSYDAGNIQVLKGLEAVRKRPGMYIGSTGPRGLHHLVYEVVDNSIDEAMAGFCTQITVALEQNDIVRVEDNGRGIPVDMHPTEHVSALELVLTRLHAGGKFDKGSYKVSGGLHGVGVSCVNALSDWMEATVKRDGHIYRQRFEIGVPKT-KVETIGESD-EHGTTIRWKADKTIFETTQYDFDVLKTRLRELAFLNSGIVIIFRDERLENPKEEILKFEGGINEFVKELNKGKGVVPEDPIYI----------NEETNDVITEVSIQYNNSFAENIHTFVNDINTRDGGTHLEGFKSAIRFVLNKFFESNEKLKKKDEKLTYEDLSSGLTAVISMKVPEPEFEGQTKEKLGNTEVRTIVDQILKEKLTVYFEQNPNALEAILKKGIDEAKARIAARKAKDNMRKKTMSDGFGLPEKLSDCSLKNPELCEVYIVEGDSAGGSAKKGRDPKTQAILPLWGKMLNVEKVRPEKVMNNDKLEPVIASLGAGFGKDFNIDKLRYHKIIIMADADVDGSHIRTLLLTFFFRYMPQLIENGYVYLAMPPLFRVQLGKKEVYCYSDAERDAALDALGRNKAEVQRYKGLGEMDGKQLWETTMDPAHRKMRVVTIPDAVEADRIFSVCMGEEVEPRREFIESNSSYA-NLDI 639
86 0.000e+00gi|427390865|ref|ZP_18885271.1| DNA gyrase, B subunit [Actinobaculum massiliae ACS-171-V-Col2]  clstr ali  46  26....DKNQSYDASNITVLEGLEAVRKRPGMYIGSTGERGLHHLVYEVVDNSVDEALAGYCDHIEVTLRKDGGVQVQDNGRGIPVDIHPTEGKPAVEVVMTVLHAGGKFGQGGYAVSGGLHGVGVSVVNALSTRMETVVKRDGYVWRINYENGRPV-APLERXXXXXXXX-XXXXFWANPEIFETTDFDFETLRKRFHQMAFLNKDLRITLTDEREGEKRQVSYCYSGGLHDYVKFLNTTKKVVNEEVVYFEGEDAEKQ--------IELEVAMQWTSAYTESVHTFANTINTTEGGTHEEGFRSALTSVINKYAREKNLLKDKDPNLSGEDVREGLTAVISVKIADPQFEGQTKTKLGNTEARTFVQQQVYKNLTDWLDSHPSEGKEIIRKXXXXXXXXXXXXXXXXXXXXKSVLESASMPGKLKDCTSNKPEECEIFIVEGDSAGGSAVNGRDPEHQAIMPIRGKILNVEKARLDRALSSDTIQGLITAFGTGIGDEFDINKLRYHKIVFMADADVDGSHIATLLLTLVYRYMRPLIEAGHVYLAMPPLYRIKWTNHPHYVFTDRERDVELAKGKENGWRIQRYKGLGEMNAEELWDTTMNPENRTLKQVEIGEAAATDETFSVLMGEDVESRRGFIQRNAHDVRFLDI 691
87 0.000e+00gi|269124013|ref|YP_003306590.1| DNA gyrase subunit B [Streptobacillus moniliformis DSM 12112]  clstr ali  47  1MSE----KNYGGESITVLEGLDAVRVRPGMYIGTTSSRGLHHLVWEIVDNSIDEALAGVCDTITVKMLPDSEIEIIDNGRGIPTDMH-KSGKSTLEVVMTVLHAGGKFDNSNYQFSGGLHGVGISVVNALSEKLEATVTRDGRVVRQIFSKGNAITEALE-IGKAPKAHGTTIKFKPDADIFETIQFDYDILQRRLKELAYLNQGIKIILIDARPEKVKEEVFYFEGGIVDFVTELV-GEDKIIEDVIYMKDRVMLTEGEVDDEGNSEVEIAMIYKNSQSTIEYSFVNNINTSDGGTHVSGLRTALTRTINDLAREA----SSKNEFKGEDVREGLVYVLSLKFPEPQFESQTKAKLGSSEATSIVSGVFGSKLKMYLEDHPKDCKTIIDKIAISKQAREAAKRARDLVTKKNEFSLGGLPGKLADCQSKNPEESEIFIVEGDSAGGSAKQGRFKEYQAILPLRGKILNVEKANEHKILENSEIKAMITAFGAGFGDRFDIEKLRYHKIIIMTDADVDGAHIRTLMLTFFYRYLRELINNGHIYIAQPPLYKVKSGKKEQYAYSDEQLKSIVDNSGKNKYNVQRYKGLGEMNPDQLKETTMDPDVRTLLKVTLEDAQYADKMFSILMGDKVEPRREFIEEHANYVRNLDI 660
88 0.000e+00gi|238810228|dbj|BAH70018.1| hypothetical protein [Mycoplasma fermentans PG18]  clstr ali  55  4....NMSKEYDASNIKVLEGLEAVRVRPGMYIGTTGIRGLHHLIWEIVDNSVDEAMAGFANKVEITITKDGYIDVIDNGRGIPTAVHPKTGLSTVETVLTVLHAGGKFDSDSYKVSGGLHGVGASVVNGLSDDFEVWVKRDGKLHYAHFNNGGKILQHLTILNEVDQDTGTRIKFHPDFSIMDKNEWDKGVIVDHAKQIAYLNKGLRIIVNDERDKS--REEYHFEGGIVDYVKELNTGQKLIHPDVIYAEGEYSFQDSPA-----VQVEVAVQYNERITGNVVSYANNIITVEGGTHESGFYDALVRLVNNYGTECGLIKTEEDKVTREDVREGIVAIISVKHTNPIFEGQTKGKLGNKDARMAVNKVFSDSFERFLNENPAEAKTIVQKTIFAKKSRLAGLAARDAARRKTVFDTGSLPGKLADCSSKNAEISELYIVEGNSAGGSAKMGRNRMTQAILPLRGKVINAEKNQPKKVFANAEILSLITALGTGVGEEFNINKLRYHKIIIMTDADVDGAHIRTLLLTFFYRYFRPLIEYGFIYIAQPPLYKIAQNKFIGYAYNDAQKEEIMQGLNNQKVTVQRYKGLGEMDPEQLWETTMDPVNRKMLQVQIEDAARADWAFTTLMGDEVLPRREFIEQNAKYVKNIDI 644
89 0.000e+00gi|408500258|ref|YP_006864177.1| DNA gyrase, B subunit [Bifidobacterium asteroides PRL2011]  clstr ali  47  44..DSLSPEHYDASDLKVLEGLEAVRVRPGMYIGSTGPRGLHHLVYEIVDNSVDEALAGYADHIEVTILPDNGIRVDDNGRGIPVDEVPGEGKSGVEVVMTKLHAGGKFGGGGYAVSGGLHGVGISVVNALSTRIDVQVRRQGYHWHQSFRN-QKPTAPLSKMGP-DESTGTSVTFWADPKIFETTVYDFETLRSRFQQMAFLNKGLRITLTDLRPNDQQSVSYQYANGIKDYVDYLVRKATPVEAEVIDFEAEDL--------KLGISAEVAMQWTTAYSESVHTFANTIATTEGGTHEEGFRAALTSMINRYARDKNILKDKDDNLSGDDVREGLTAVVSVKLTNPQFEGQTKTKLGNSEAKTFVQRVMTERLSDWFDAHPGEAKTIIQKAMEASRARIAAKKARENTRRKSIFETAGMPDKLKDCQSNDPEECELFIVEGDSAGGSAIQGRNPMTQAILPLRGKILNTERASLDRMMKSDTIESLITAVGGGYGEDFNIDKVRYHKVIIMADADVDGAHIATLNLTLFFRYMRPMIEAGYVYVAMPPLYRLKWTKGPHFVYTDAERDRVLAEGKAKGEGIQRYKGLGEMSYQELWETTMDPEHRILKKIRIDDAEQADETFTMLMGDEVEPRRLFIQRNAHDARFID. 708
90 0.000e+00gi|295111747|emb|CBL28497.1| DNA gyrase subunit B [Synergistetes bacterium SGP1]  clstr ali  49  13.......NDYNANKIKVLEGLEAVRKRPGMYIGDTGPRGLHHLVNEVVDNSIDEAMAGFCTRIDVTIHKDESVTVQDDGRGIPTDPHPSNGRPTCEVVLTRLHAGGKFEQGAYSVSGGLHGVGVSAVNALSEWFEVTIARNGMERTQRFERGVPVT-DLSE-GVPVDWQGTRIHYLPDKEIFEDVHHSLETLKSRFMELAFLNAGVRIFVTDERSSESRE--YHFEGGVSAFVQYLNRDRTTLFAPPVVIS----------GERNDIKVDMALQYNDEYQERILTYANLIHTVEGGTHLMGLRQALTRALNEAARSGKLLNDKEDNLTGDDLKEGLTCVLSVKLVEPQFEGQTKTKLGNSDVRGAVDSVVYEGLLSVIEERPDIVRPIVDKALXXXXXXXXXXXXXXLVR-KGAMTGMNLPGKLADCSSKTPENSEIYIVEGDSAGGSAKQARDRTFQAILPLRGKILNVEKAQEHKMLQNREIQTIITALGCGIGTEFNATRLRYHKIIIMTDADVDGAHISTLLLTFFYRHMPELLTEGYIYLAQPPLYRVQRGKQVHYCYTEKELRQHVDGAPDDKVGVQRYKGLGEMNPEQLWMTTMDPANRILKKVELDDDLLADEYFDILMGERVEPRREFITTNANSAKNVD. 640
91 0.000e+00gi|326803543|ref|YP_004321361.1| DNA topoisomerase IV subunit B [Aerococcus urinae ACS-120-V-Col10a]  clstr ali  46  1MAKNSKA-TYDESSIQILEGLEAVRKRPGMYIGSTDNRGLHHLVYEIVDNSIDEALAGYCDEISVTIHEDNSVTVTDNGRGMPIGKHS-SGKPTVEVILTVLHAGGKFSESAYKTSGGLHGVGSSVVNALSDSLEVTVYRDNKKYYQSFSQGGKPHKP-KLTSHKSKQTGTSIHFHPDPKIFGATEFNSDTIKEQLREKAFLTKGLAIHFTDEKTDS--QESFHYEDGLVEFIHYLNENKEVLQG-VTYIEDKDKSS--------NIEMELAFQYNDGYSETILSFVNNVRTPDGGTHETALKTGMTKAFNEYARKVNLIKPKEKNLEGSDVREGFTAVISVRIPEEQFEGQTKGKLGTPQARLAVENMVNTHLSIYLLENGEIAQMLVRKAIKARQTREAARKAREESRKKGKSKETLLSGKLTPAQSKNTKKNELFLVEGDSAGGSAKLGRDRKFQAILPLRGKVLNTEKASLTDILKNEELNTIIHTVGAGVGPEFDIHDSNYDKVIIMTDADTDGAHIQVLLLTFFYRYMRPLIEAGKVYIAMPPLYKLSRGKKIAYAWTDEELAQETKKFG-KGYTLQRYKGLGEMNADQLWDTTMNPETRTLIRVTLDDLSQAEKRVSVLMGNKVEPRRDWIEDN......... 634
92 0.000e+00METAHIT MH0012 GL0140545 [Complete] locus=scaffold2753_10:254:2179:-  ali  51  1MSE--KIERYDESQIQVLEGLEAVRKRPGMYIGSTSVRGLNHLVYEIVDNAIDEALAGYCKNITVTIKKGNIVEVTDDGRGIPTGKHPKMGISTLEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLTVDVYRSHKHVFQEYKRG-KADAPAKVLEDTDK-TGTKVTFFPDAKIFETLEFEYDTLLKRLREQAFLNAGVRIVFTDERGEEPVVNDMCYEGGIKSFVEYINDNKKAIHD-VIYVANDNGTYSA----------EIAMQYTTNYDENILSFANDIHTAEGGTHEQGFKAALTKVVNEYARKYKYLKEKDSDLSGDDVREGLTAVISVKLTEAQFEGQTKTKLGNSEMRGFVNKLVSEKLADFFEENPTVVRVIMEKAINAQRAREAARKAREQTRRKSGLDSGQMPDKLRDCNERDASLTELYIVEGDSAGGSATQGRDSRFQAILPLWGKMLNVEKARADKIYGNDKLSPVITALGAGIGTEFNIEKLRYHKIVIMADADVDGAHIRTLLLTFFFRFMRPLIEQGYVYSAVPPLYKLSRGKTVRVAYSDEERDRISAEMPNAKIDISRYKGLGEMNPEELWETTMDPEKRTLRRIELEDAVAADKIFSILMGEDVEPRKEYIELNARYAVNLD. 640
93 0.000e+00METAHIT O2 GL0033187 [Complete] locus=scaffold11534_1:176:2176:-  ali  48  21..NTAVTEDYDASQIQVLEGLEAVRKRPGMYIGSTSASGLHHLVYEIVDNSIDEALAGYCTHIEVAIEPGNVISVTDNGRGIPVDIQEQTGKSALEVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVYVHKNGKIHRMKFSRGY-ITEPMTIVGDTDR-TGTCVRFKPDPEMFTTTVYDYETLHKRLREEAFLNAGLKITIEDKREEKDRKDVLCYEGGIREFVTFLNTNKTPVHEDVIYMS----------GKKDDAMAEIAMQYTDTYNEVIVSFANNVHTPEGGMHEDGFKRALTAALNKYGKKMNILK-GDDKVSGEDCREGISCVISVKLTNAQFEGQTKAKLGNSEIRTLVNSIVSEALEQYLEENPATGKAILDKALTANRAREAARKARESVRRKTGLESGQMPDKLQDCNERDPSLCEIYIVEGDSAAGSAIQGRDSRFQAILAMWGKMLNVEKARSDKIYGNDKLYPMIVALGAGIGEEFNIEKLRYHKIIIMADANVDGAHIRTLLLTFFFGYMRPLIEHGYVYSAVPPLYKLSRGKTQRVAYSDEERDRISAEMRGDKVEINRFKGLGEMDAHELWETTMDPETRSLRRITLEDAVAADQIFNVLMGEEVEPRREWIESNAKYVVNLDI 666
94 0.000e+00gi|148271184|ref|YP_001220745.1| DNA gyrase subunit B [Clavibacter michiganensis subsp. michiganensis NCPPB 382]  clstr ali  50  31.TRQQVSNDYGANEIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVSEIVDNSVDEALAGFASDIQITMRKDGGIRVVDDGRGIPVDIHPVEGISTVELVLTKLHAGGKFGGGGYAVSGGLHGVGSSVVNALSERLDVEVRRQGAVWRQSFTIGVP-DEPLQK-GEGSTETGTTITFWPSREIFETVEFDYDTLRARFQQMAFLNKGLALTLHDEREAEHRTEKFLYERGLVDYVEHLVKAKEVVNADVIAFESEDTVKK--------ISLEVAMQWTTSYTESVHTYANTINTHEGGTHEEGFRAALTTLVNRYARENKLLREKDENLTGDDVREGLTAVISVKLGEPQFEGQTKTKLGNTEAKAYVQRIVGQQLGDWLEKNPSQAKDIIRKGMQASQARLAARKAREQTRRKGLLESGGMPGKLKDCQSKDPALSEVFLVEGDSAGGSAVQGRNPTTQAILPLRGKILNVEKARLDRALQNNEVQSMITAFGAGIGEDFNAEKVRYHKIVLMADADVDGQHITTLLLTLLFRYMRPLIELGYVYLAQPPLYRLKWSNEHQYVYTDAERDALLVHGQAKGKKIQRYKGLGEMDYKELWETTMDPATRTLMQVTLDDAAGADEVFSTLMGEDVESRRSFIQRNAKDVRFLDI 681
95 0.000e+00gi|399574434|ref|ZP_10768193.1| DNA gyrase, B subunit [Halogranum salarium B-1]  clstr ali  50  1.............................MYIGSTDARGLHHLVYEVVDNSIDEALAGYCDNIDVTIHEDDSVSVEDDGRGIPVDTHEQYGRPAVEVIMTVLHAGGKFDNKSYQVSGGLHGVGVSVVNALSTTLEVEVKRDGSVWTHRFERGEPQVDAFEEVREPDEETGTKIRFWPDDDIFEETEYNYSTLANRLRELAFLNSGVEITLTDERDGEPVSEIFRYDGGIKEFVEYLNETKTPLHADVVYFE----------DEQDNIQVEVAMQATDELQGSIHSFANNINTREGGTHLTGFKTALTRVVNDYASSNDMLTDLDNNLKGEDVREGLTAVISVKHPDPQFEGQTKTKLGNSEVRGIVESAVHNGLKTYFEENPATAQSVIMKAVEAAKARQAAKKAEELTRRKSALESSSLPGKLADCQTRKPEEAELFIVEGDSAGGSAKQGRDRKNQAILPLKGKILNVEKNRLDRVLENNEVRALITAIGAGIGEEFDIEKTRYQKIIMMTDADVDGAHIRTLLLTLLYRHMKPLIEAGYVYAAQPPLYRVRYRGETYDAMTEAERERIIEEKCNGNPTVQRFKGLGEMNPEQLWETTMDPENRILKQITIEDAAAADRMFNVLMGDAVEPRKQFIKDHAKDAEWVDI 618
96 0.000e+00gi|406998592|gb|EKE16510.1| hypothetical protein ACD_11C00004G0008 [uncultured bacterium]  clstr ali  47  5..KNKTQSDYGAKSIQVLQGLEPVRKRPGMYIGGTSTEGLHHLIWELVNNSIDEALAGYCTDINIKLLPDNVVEITDNGRGIPVDTHPQTKKSTLETVMTVLHAGGKFGGDGYKVSGGLHGVGASVVNALSEWTKVEVRRQGKIWTQEYKRG-KPSFNVKPIG-SAKDTGTKTIFKADHEIFPEIKYSWTKILDYVRQQAYLTKGVKIIIEDLREVIGKDDEFYFDGGIISFVKFLNRGKEVKNIVPLYYEK----------EVDDVAVEISLQYTDGYKEHLFSFANNIYTVEGGMHVTGFKMALTRVLNDYAKKNNFIKEKEGSFTSDDLKEGLTAVVSVKLREPQFEGQTKSKLGNNEVRGIVSAVTAEGLAEYLERNPQDARAMIDKCLLTVRARIAARAAKDAVLRKGALEGMTLPGKLADCTTRDASKSELYIVEGDSAGGSAKQGRNRMFQAILPLRGKLVNVEKTSLDKVVKSDTLKPIIIALGAGIGESMDISKLRYNKIIIMADADVDGSHIRTLLLTFFYRYYEELINNGHIYIAQPPLYQLKRGKDIRYVYTEEEKNKVVSEMIDKGVAIQRYKGLGEMNPQQLWDTTMNPEHRTMFQVKIEDAEEADRIFDILMGSDVEPRRRFIQTHAKSVKNLDV 675
97 0.000e+00gi|424780297|ref|ZP_18207177.1| Topoisomerase IV subunit B [Catellicoccus marimammalium M35/04/3]  clstr ali  48  1MSK-KIQNEYNDSSIQVLEGLEAVRKRPGMYIGSTDSRGLHHLVYEIVDNAVDEILAGYGNEIQVQLHPDHSVTVRDFGRGMPTGMHP-SGKSTIEVIFTVLHAGGKFDTGAYKSSGGLHGVGASVVNALSSFLEVTVVREGEKYYQAFKDGGKPIQELTCQGKCEEPNGTTVHFLPDDKIFSTTHFSFDTLAQRLREAAFLLKGVTIQIEDQTPGKEQIERFCYEEGIKQFVEYLNEEKQTISP-----------ILDFSVAEEGIEVDCALQYNDGYNEQVLSFVNNVRTKDGGTHEAGMKGALTKTINEYAKRSGLLKEKDKKLEGTDVREGLTAIISVRIPEAQFEGQTKGKLGTPIARTIVDRLLSTELMYYFQENSSIAQTIIQKAIRARDARESARKAREESRKKKKGKETSLSGKLTPAQGKDTTKNELYLVEGDSAGGSAKLGRDRKFQAILPLRGKVINTEKAKLADILKNEEINTMIYTIGAGVGNDFNVEESNYDKVIIMTDADTDGAHIQILLLTFFYRYMRPLLEAGKVYIALPPLYKVKKEKKIAYAWTEEELKEVI--GIKKNYHLQRYKGLGEMNAEQLWETTMDPETRTLIRVKIEDAVLAEKQVVTLMGDKVEKRREWIEKN......... 635
98 0.000e+00gi|340354519|ref|ZP_08677223.1| DNA topoisomerase (ATP-hydrolyzing) ParE [Sporosarcina newyorkensis 2681]  clstr ali  46  16.TKQKIQNTYDDSSIQILEGLEAVRKRPGMYIGSTDTRGLHHLVYEIVDNSVDEALAGFGAEIDVTIHSDGSVSVRDYGRGMPTGLH-QSGKPTAEVILTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSEWLEVTIFREGKKFRQRFENGGHPATTLEQIG-TTKETGTIIHFKPDKKIFSTIKYQYDTLAERLRESAFLLKGLKIVLQEE--GTDKKDVFHYESGIEAFIEYLNEEKDVLHD-VAYLEGEVEGIEVE----------FAFQFSDGYAETILSFVNNVRTKDGGTHETGAKAAMTRVVNEYARKTGLLKEKDKNLDGADIREGIAAIVSVRIPEEQFEGQTKGKLGTSEARTATDAVVSQKLLYFLEENAELSANLVRKAIRAHQAREAARKAREDARKKRRKSDTLLSGKLTPAQSRNAAKNELYLVEGDSAGGSAKQGRDRTFQAILPLRGKVINTEKAKLEDIMKNEEINTIIHAIGAGVGADFQIENAAYDKIIIMTDADTDGAHIQVLLLTFFYRYMKPLIEAGKVYIALPPLFKVFKGEKLEYAWTEDDLDEAMKKIG-KGYMLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDGAKSERRVTTLMGDKVEPRRKWIEEN......... 647
99 0.000e+00gi|15829210|ref|NP_326570.1| DNA gyrase subunit B [Mycoplasma pulmonis UAB CTIP]  clstr ali  56  3MSKNNQ---YNASNIQVLKGLEPVRKRPGMYIGTTGKKGLHHLIWEIVDNSVDETMAGFASQITITLDNDNLITIEDDGRGIPVDRHPETGISTVETVLTVLHAGGKFDSESYKVSGGLHGVGASVVNALSTNLKAWIKRHNKLHYVEFHDGGKILKPLEVISELEDQTGTKISFQPDFSIMEKNDFDLEVVKDRAKQLAYLNKQLVINVVDNRVGYTKQ--FYFEGGIVDYIKELNKSKKVLHDQTIYSEGANVLEDNP-----EVIVEVAIQYTDSYQSNIVSYANNILTIEGGTHEQGFFDGLVRILNKFATNLGLVKLEEEKLIRDDVKEGISAIISIKHVDPIFEGQTKGKLGNKDARIAVNKIFSKNFERFLNENPVEAKNIILKVINARKARMAGLLAREAVRRKSAFDISSLPGKLADCSSKNAEISELYIVEGNSAGGSAKMGRDREFQAILPLRGKVINAEKNNIEKVFNNEEIQSLIIALGTGIAEEFNINKLRYHKIIIMTDADVDGAHIRTLLLTFFYRYFKPLIEYGFVYIAQPPLYKISISGKSRYAYNDEQKEEILANIKDSKVAIQRYKGLGEMDPDQLWDTTMDPGIRTMLQVQIEDAAKADWTFTTLMGGEVAPRREFIEQNAKYVKNID. 643
100 0.000e+00gi|222151258|ref|YP_002560414.1| DNA topoisomerase IV subunit B [Macrococcus caseolyticus JCSC5402]  clstr ali  45  2.....ANNQYNDESIQVLEGLEAVRKRPGMYIGSTDSRGLHHLVYEILDNSIDEALNGHGNEINVVLNADDSVTVTDNGRGMPTGLH-KTGKPTPEVIFTVLHAGGKFGQGGYKTTGGLHGVGASVVNALSSWLEVTIHNNGKIFKQRFQDGGVPVTTLEEIGKS-KKTGTTVTFKPDPSIFKTVKFNFDTLSERLRESAFLLNNLKITISDLRNNEERHEVFYYEDGLKDFVNFVNEGKETLHEV-----------AKFSGKSHDIEVEVAFQFNDQYSETILSFVNNVRTKDGGTHEVGMKTAITRVFNEYARKIGELKAKDKNLDGNDIREGMTAIISVKIPENQFEGQTKSKLGTSEARSAVDGVLSEQLPFYFEENGVLSQKLVKKAVKAAQARDAARKAREEARKKNKRKETLLSGKLTPAQSKDTSRNELYLVEGDSAGGSAKLGRDRKFQAILPLRGKVINTEKAKLEDILKNEEISTIIHTIGAGVGNDFEVKDANYDKIIIMTDADTDGAHIQVLLLTFFFKYMKPLIDAGKVYIALPPLYKVSKGKVIEYAWTDDELKGVQKKVG-KGFILQRYKGLGEMNADQLWDTTMNPETRTLIRVEIDDELRSAKRVSTLMGDKVEPRRDWIERH......... 632
101 0.000e+00gi|405982287|ref|ZP_11040609.1| DNA gyrase, B subunit [Actinomyces neuii BVS029A5]  clstr ali  48  1MSEPQHNQEYGASDITVLEGLEAVRKRPGMYIGSTGERGLHHLVYEVVDNAVDEALAGYCDHIEVTIQKDGGIRVDDNGRGIPVDMHPTEKRPTVEVVMTILHAGGKFGGGGYAVSGGLHGVGISVVNALSKRVDTEVRRQGFVWRQKFANGGHPVGSLEK-GEPTDQTGTSQTFYPDPDIFETVRFDFETLRMRFQQMAFLNKGLRITLTDLREGKVKRVSYCYQNGLRDYVEFLNTRKDVINSQIIDFEAEDAQA--------GMSVEIALQWTTAYNVSIHTFANTINTTEGGTHEEGFRTSLTTILNKYARDKGLLKEKDSNLTGDDVREGLTAVISIKLTEPQFEGQTKTKLGNTAARTFVYSNMYQRLGDWLDEHPSEAKAIVHKAQSAANARVAARKAREATRRKGVLEGASMPGKLRDCSSRDASISEIFIVEGDSAGGSAVMGRNPETQAILPLRGKILNVEKARVDRAMSSETIQSLITALGTGVSEDFDIEKLRYHTIVLMADADVDGQHITTLLLTFLYRYMRPLIEQGHVYLATPPLYRIKWSNAAHFVYSDKERDEKVRAGLAGGHRIQRYKGLGEMSDQELWETTMDPAGRILKKVEMQEAARADEVFSMLMGEDVESRRAFIQRNASDVRFLDI 675
102 0.000e+00Oral.Meta HOMD pot786_c_34_60 Paenibacillus sp oral taxon 786 D14 [25060 - 27045] DNA topoisomerase IV, B subunit  ali  46  21......SSGYDADDIQVLEGLVAVRKRPGMYIGSTSSSGLHHLVWEIVDNAVDEHLAKYCTKIDITLNKDGSVTVLDNGRGIPTGMH-KTGIPTPQVVYTILHAGGKFGGAGYKKSGGLHGVGASVTNALSEWLEVEIYRDGKIHRMRFEYGEPVTG-LEIIGNTNK-TGTKVTFKPDIRVFSGIGLNYDTLAERLQEIAFLNSGLKVTLKDERAG--RSDEFFYEGGASQFVEFLNDGKDVLHDVIHFY-----------AERDDIEVEVALQYNAGYTETLVSFVNSIPTRGGGTHETGFKTAYTRVMNEYARKNGMLKEKDKNLEGNDLREGMMAVISVKMSEVEFVGQTKDQLGSASARSAVESVVGEKMAVFLEENPQVAQTLIKKAIQASKAREAARKARDEMRSKKRSESSNLGGKLTPAQSKDYTRTELFIVEGDSAGGSAKQGRDSKLQAILPLKGKPMNPEKAKLADILKNDEYRAIISAIGAGIGPEFALEDSNFSKIIIMTDADTDGAHIQVLLLTFFYRYMKPLIDAGRVYIAQPPLYKITRGKTVRYAWTDEQLQNYLKEFG-KNFELQRYKGLGEMNPEQLWETTMNPETRTMLQVQIEDAAKAERRVSTLMGDKVDPRKRWIVEN......... 654
103 0.000e+00gi|335040509|ref|ZP_08533636.1| DNA topoisomerase IV, B subunit [Caldalkalibacillus thermarum TA2.A1]  clstr ali  46  1MAKN-ITHDYNDDAIQVLEGLDAVRKRPGMYIGSTDTRGLHHLVYEILDNAVDEALAGFGNHIKVTLHSDGSVSVKDKGRGIPTGIH-KIGKPTPEVIFTVLHAGGKFGQGGYATSGGLHGVGASVVNALSEWLEVTIQRDGKIFRQRFEDGGKPVTGLEVIG-TSKQTGTCVRFKPDTSIFSTVKFQYDILAERCREAAFLLRGLTIEVTDERDGQPRHDIFRFEKGIEAFVEYINEDKTTFHPVVYF-----------QGEQNGIEMEIAFQYNDGVSENVLSFVNHVRTKDGGTHEAGFKTAMTRQFNEYARKVGLLKEKDKNLEGSDVREGLTAVVSVRVPEEQFEGQTKGKLGTPEARSAVDTFVAEQLLIYLQENPDVANTLI---------------------KKXXXXEALLSGKLTPAQSKDPSRNELFLVEGDSAGGSAKQGRDRRFQAILPLRGKVINAEKAKLEDILKNEEIRTIIHTIGAGVGADFTLEEANYSKVIIMTDADTDGAHIQVLLLTFFYRYMRPLIEAGRVYIAMPPLYKVSKGEVVAYAWDEDELAAAIKKVG-KGYTIQRYKGLGEMNADQLWETTMNPETRSLIRVTLDDAARAERRVSILMGDKVEPRRKWIENN......... 634
104 0.000e+00Oral.Meta HOMD lrha_c_1_2817 Lactobacillus rhamnosus GG [1420688 - 1422784] DNA topoisomerase IV subunit B  ali  46  31...DKATQAYNDSSIQVLHGLEAVRKRPGMYIGSTDSRGLHHLVYEIVDNSVDEALAGFGDEINVTIHADNSVTVQDHGRGMPTGMHP-SGKPTIEVILTVLHAGGKFNQNSYKTSGGLHGVGSSVVNALSESLTVRVVRDKHAFEEHFINGGHPDGGLQKLGKVNEPNGTTITFKPDPTVFQTTVFNYDTLAERLRESAFLLKAITINLTDERTG--KHDQYHYPDGLVSFVKYLNEGKDALSQVINF-----------EGKKDGIVVDFAGQYNDGYSENIISFVNNVRTGDGGTHEIGLRSGMTRAFNEFARKVGLLKDRDKNLEGSDVREGFAGILSVRIPEEQFEGQTKGKLGTPQARTVVDGIVYDHLATFLMENGEESQELVRKAIKARDAREAARKARDDSRRKRKKDQGLLSGKLTPAQTKNPKRNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVLNTQKAKLQDIVKNEEINTMIYTIGAGVGADFDIQQANYNKIIIMTDADTDGAHIQILLLTFFYRYMRPLIDAGRVYIALPPLYRLQKGTKISYAWTDEELAKETKAMG-KGYTLTRFKGLGEMNADQLWETTMNPETRTLIRVRIDDAQLAERRVTTLMGDRVEPRREWIEHHVKF--DLD. 667
105 0.000e+00METAHIT V1 GL0095978 [Complete] locus=scaffold22029_4:10283:12238:-  ali  50  9....KVENEYGADEIQVLEGLEAVRKRPGMYIGSTGEQGLHHLVYEIVDNSIDEALAGYCTKIEVSILPGNIIKVKDNGRGIPVGINQKMGLPAVTVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEYLEVKVC-DGKIYFQRYERG-KIMNDLEVIGHGTEK-GTEVTFKPDPVMFTTTVYKYEILEKRLREQAFLNAGVRIELRDERDENIISNEYCYEGGVKSFVNFIREKKNPLHDEIIYFEAEN--------EDQTMSVEIAMQYTDAITSDVRSFANNIHTIDGGTHEEGFRRSLTKVMNDYGRRFNKLKEKDSDLKYSDYEEGLFAIISVKLTEAEFEGQTKAKLGNTEVRSMVYKLVKEKLSQYLEENPAIGKIIFDKAMMSFTARIAAQRARENVRRKSALDGARLPGKLADCQSKDSSETEIYIVEGDSAGGSAKEGRDRKIQAILPLWGKMLNVEKVREDKVYGNDKLTPVILALGTGIKDDFDISKLRYDKVIIMADADVDGSHIRTLLLTFFFRFMRPLIEEGHVYIAQPPLYRITKGKKHKYAFSDQERDAMLAEIEG-KTEIQRYKGLGEMDPEQLWETTMNPKTRTMLRVELHDAEQADETFSMLMGEKVEPRRDFIEQNARFVENLDI 651
106 0.000e+00gi|259046724|ref|ZP_05737125.1| DNA topoisomerase IV, B subunit [Granulicatella adiacens ATCC 49175]  clstr ali  46  1MS--KVTNQYNDDAIQVLEGLEAVRKRPGMYIGSTDHRGLHHLAYEIVDNAVDEALSGYATKIEVTIHKDQSLSVKDNGRGMPTGKHA-SGIPTIQVIFTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSDWLTVEVLRDGTLYKQSFKNGGEPVGTVKKEKTSRRGSGTTVTFLPSDKTFSTTNWSYETLAERLRESAFLLKGLTIVLTDERTGE--SETFHYEEGIRDFIQYLNEEKDTLSPVVDFDSTV-----------DGVETEFAFQYNDGYSETILSFVNNVRTKDGGTHEVGMKSALTKAFNEYARKVGLLKEKDKNLEGSDVREGLTAIISLRIPEEQFEGQTKDKLGTPAARGIVDNTISEQLGFFLTENGEIAQELIRKAIKAREAREASRKAREESRKKGKKKETLLSGKLTPAQSKNPKKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTEKASISDILKNEEINTIIYTIGAGVGSDFKIEDCNYDKIVIMTDADTDGAHIQVLLLTFFYRYMKPLIEAGKVYLALPPLYKISKGKKIEYAWTEKELEE-KTKLVGKGYLLQRYKGLGEMNADQLWDTTMNPDTRTLIRVVIDDKAQAERRVSTLMGNKVEPRRKWIERH......... 632
107 0.000e+00gi|421766873|ref|ZP_16203641.1| Topoisomerase IV subunit B [Lactococcus garvieae DCC43]  clstr ali  49  5.......NNYDDSAIQVLEGLDAVRKRPGMYIGSTDSTGLHHLIWEIVDNAVDEALSGFGTKIAVTLNKDGSVTVEDEGRGMPVGMH-VTGKPTVEVIFTVLHAGGKFGQGGYKTSGGLHGVGSSVVNALSSWLEVEITRDGAVYRQRFEHGGHPVTTLEKVGKAAKKTGTKVTFMPDTTIFSTIEFKYQTIFERLNESAFLLKDVTLSLTDNRGEEEVRDEFHYENGVQDFVNYLNEDKDTLTPILYF-----------AGEQDAFQVEVALQYNDGYSENILSFVNNVRTKDGGTHEAGLKTALTKAMNDYARKTGLLKDKDKNLEGSDYREGLTAVLSLLVPEEQFEGQTKDKLGSPLARPAVDALISEKLTFYLLENGELAQNLIRKAIXXXXXXXXXXXXXXXSRKKNKKDKGLLSGKLTPAQTKNPNKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTEKAKMQDILKNEEINTMIYTIGAGVGADFTLADRNYDKVIIMTDADTDGAHIQTLLLTFFYRYMKPLLENGHIYIALPPLYKMSQGKKIAYAWTDGELEELRQSFG-KGATLQRYKGLGEMNADQLWETTMNPETRTLIQVTIDDAAQAEKRVSVLMGDKVEPRRKWIENNVKF...... 637
108 0.000e+00Oral.Meta HOMD rmuc_c_7_430 Rothia mucilaginosa ATCC 25296 [102030 - 99889] type IIA topoisomerase, B subunit  ali  49  44...SEQQHEYGASDITVLEGLEAVRKRPGMYIGSTTERGLHHLVYEVVDNSVDEALAGYASKIDVTIQADGAVRVEDDGRGIPVDEHPTEHKSTVEVVMTVLHAGGKFGGGGYSVSGGLHGVGISVVNALSTRVITEVHRQGYAWHISFSNGGVPDGPLRK-GEPSDKTGTIQTFYPDPEIFETVEFDFETLRARFQQMAFLNKGLTITLTDEREESEKKETYRYDNGLFDYVHFLNAGKTIVNEEIVSFEAE--------DTERNMSLEVAMQWTGAYKESVYSYANTINTHEGGTHEEGFRAALTSLVNRYARENKLLRDKDDNLTGEDVREGLTAVISIKISEPQFEGQTKTKLGNSEAKSFTQREVNDHLGDWFGRNPAVAKDIVRRAITAAQARIAARKARETTRRKGLLETSSMPGKLKDCSSKDPSISEIYLVEGDSAGGSAVQGRNPNTQAILPLRGKILNVERARLDRALSNAEIQAMITAFGTGIGDDFDIEKARYHKIVLMADADVDGQHITTLLLTLLFRFMRPLIEAGYVYLAQPPLYRIKWSNAPHYVYSDAERDEALARGAAKNLRIQRYKGLGEMDYTELWDTTMDPARRTLLQVKMEDAAAADQIFSVLMGEDVEARREFIQQNAKDIRFLDI 714
109 0.000e+00gi|193216997|ref|YP_002000239.1| DNA gyrase subunit B [Mycoplasma arthritidis 158L3-1]  clstr ali  51  1MSKQEEISKYGAKNIQVLEGLEAVRKRPGMYIGSIGFRGLHHLIWEIVDNSVDEAMAGFATNIEVKLHPNNEIEVIDNGRGMPVDIHPTTKKSAVETILTVLHAGGKFDSTNYKVSGGLHGVGASVVNALSDSFEVWVKRGGKLYYQKYINGGHPVKPLEVIGEVNKETGTRIKFHPDYQIMDKVAFDFGTIIDHAKQIAYLNKGLSISCEDITKNTIR--NFCFEGGIIDYVSELNRGKKVIIPDIIYAEGTFRDKTPNA---QDVIVNVAIQYNETYTSNIVSYANNIQTGEGGTHEQGFYDALTRIYNKYAEDNKLFKNNNEKISREDTKDGLVAIISIKHTDPIFEGQTKGKLENKDARIATNKIISEQLERYMAENPSHAKAIIEKCLLTQRSRLAANAAREASRKKEGSEFGNLPGKLADCSSKNAEVRELFIVEGNSAGGSAKMGRDRATQAILPLRGKIINAEKQDFTSVMSNKEVSSMIHALGTGITDEFNINKLKYHKIVIMTDADVDGAHIATLLLTFFYRYMRPLIEYGFVYIAQPPLYKISTAKVTEYAYNDAQKEEILSKLESKNISIQRYKGLGEMDPEQLWETTMNPATRKMLQVQIDDIASCDTIFSTLMGEEIEPRHDFIQENAKYATNID. 646
110 0.000e+00gi|406874351|gb|EKD24326.1| hypothetical protein ACD_81C00053G0002 [uncultured bacterium]  clstr ali  50  38..DNRGNASYSAKDIQVLEGLEPVRKRPGMYIGSTGSQGLHHLIWEVFDNSLDEAMAGYAKHITVELGKDGSVTVSDDGRGIPVDIHPKTKKSALETAATTLHAGGKFDGDSYKVSGGLHGVGLSVVNALSTWMKIEVCKDGSKYMQEYRIG-KPLADVKKIGKAERGNGTKVTFKPDDTIFSTLEFERKEIVGHLRQQAFLTKGIRIEIIDSREDVPFYYSFYFEGGLVSFVQYVNSSHTPVHKEVFYVHRSY----------EDIDVETAFIYNDDPDARELSFANNIYTPDGGMHVTGFRTALTRVLNDFARSNNAIKGSDENLTGDDVREGITAIISVKLRDPQFEGQTKARLGTPAARGAVESVVSEGLKEYFEKYSNDAKAIIEKCMLXXXXXXXXXXXXETVLRKGMLEGMTLPGKLSDCSSRKAADSELYIVEGDSAGGSAKQGRDRRFQAILPLKGKILNVERARLDKMLVNNEIKSLVIALGTAISDSFDIEKLRYHKVILMTDADVDGAHIRTLLLTLFYRYFRQIIEGGFLYIAQPPLFRLQIGKDVRYVYTPEQKDTAIAEMGEANVNVQRYKGLGEMNPDQLWETTMNPEFRTLLQVAIDDAQEADRLFEILMSDEVAPRKQFIQSKATLVKNLDI 679
111 0.000e+00gi|52549974|gb|AAU83823.1| DNA gyrase subunit B [uncultured archaeon GZfos34A6]  clstr ali  49  2......EESYSAKDIQVLKDLTAVRKRPAMYIGDTGTRGLHHLANEVIDNSVDEALIGFCTSIVVIIHPDNSVTVTDNGRGIPVDMHSEYNLSALEVVMTKLHAGGKFDNKVYKVAGGLHGVGISVVNALSEWQEVEVVRDGKRYFQRYEYGKPVVKELSYTDENNGECGTRVTFKPDSTIFGVYEFDAHILATRLRELAFLNRGLLLSLKDERSGEDR--AFKYDGGITSFLEYINRNKKVLHSPITF-----------EGEKDDVKVAIGLQYNDSYAENIFSFVNNVKTVEGGKHLSGFKAALTRVLNEYGKSNNMLK--KVNLDGDDVREGLAAIISLKLREPQFEGQTKTKLGNSEVKGIVESFVREHLWDFLDENPKDADAIIRKALEASRAREAARHAREIVRKKDSF-ADSLPGKLADCSERDPAKKEIYIVEGDSAGGSAKQARDKNFQAILPIRGKILNVEKARLDKILKSNEIRTLITALGAGIGDDFDMQKARYNKIIIMSDADVDGAHIRTLLLTFFYRYMQELVTANHIYVALPPLYMVKKGKEIRYAFSDDELDDLNVKEGDAGVKIQHYKGLGEMNPEQLWETTMNPATRGIKLVTLEDAAEVDWLFTVLMGEEVEPRRNFIHAHAKEVMNLDI 635
112 0.000e+00gi|297584211|ref|YP_003699991.1| DNA topoisomerase IV subunit B [Bacillus selenitireducens MLS10]  clstr ali  47  2...NKNDFAYNDDAIQVLEGLDAVRKRPGMYIGSTDHRGLHHLVFEIVDNSVDEILAGFGNEITVTIHKDQSVSIQDSGRGFPTGMH-RSGKPTPEVILTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSEWLEVTIYRDGVISQQRFENGGKPATTLEKVGKT-KRTGTTVHFKPDEAIFGSITFHYDTLAERLREAAFLIKGVKIELIDERGDEPERDTFQFDTGLVAFVDYLNEEKDILHPVIQF-----------EGVHDEIEVDIAFQYNDGFTENMLSFVNNVRTKDGGTHELGAKAAITRIINEHARKLALLKEKDKNLDGSDIREGFTGIISVRVPEEQFEGQTKAKLGTAEARSAVDQVISGKLAFFLEENPEFSHMLIKKAVKASQAREAARKAREDARKKNKRKDAMLSGKLTPAQSRNPNKNELYLVEGDSAGGSAKQGRDRKFQAVLPLRGKVINTEKAKLADIMKNEEIRTIIYAIGGDVGPDFDLENINYDKIVIMTDADTDGAHIQVLLLTFFYRYMRPLVEAGRIYIALPPLYKVSRGKKEEYAWDENGLQGAIDQVG-KGYILQRYKGLGEMDATQLWETTMNPESRTLVRVTIEDVARAERHVSTLMGDKVEPRRKWIERN......... 633
113 0.000e+00gi|253731987|ref|ZP_04866152.1| DNA topoisomerase IV subunit B [Staphylococcus aureus subsp. aureus USA300_TCH959]  clstr ali  46  33....NKQNNYSDDSIQVLEGLEAVRKRPGMYIGSTDKRGLHHLVYEIVDNSVDEVLNGYGNEIDVTINKDGSISIEDNGRGMPTGIH-KSGKPTVEVIFTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSEWLEVEIHRDGNIYHQSFKNGGSPSSGLXXXXXXXXXX-XXXXFKPDDTIFKSTSFNFDVLSERLQESAFLLKNLKITLNDLRSGKERQEHYHYEEGIKEFVSYVNEGKEVLHDVATF-----------SGEANGIEVDVAFQYNDQYSESILSFVNNVRTKDGGTHEVGFKTAMTRVFNDYARRINELKTKDKNLDGNDIREGLTAVVSVRIPEEQFEGQTKSKLGTSEARSAVDSVVADKLPFYLEEKGQLSKSLVKKAIKAQQAREAARKAREDARKKNKRKDTLLSGKLTPAQSKNTEKNELYLVEGDSAGGSAKLGRDRKFQAILPLRGKVINTEKARLEDIFKNEEINTIIHTIGAGVGTDFKIEDSNYNRVIIMTDADTDGAHIQVLLLTFFFKYMKPLVQAGRVFIALPPLYKLEKGKRVEYAWTDEELNKLQKELG-KGFTLQRYKGLGEMNPEQLWETTMNPETRTLIRVQVEDEVRSSKRVTTLMGDKVQPRREWIEKH......... 664
114 0.000e+00gi|404329392|ref|ZP_10969840.1| DNA topoisomerase IV subunit B [Sporolactobacillus vineae DSM 21990 = SL153]  clstr ali  47  1MAKN--ASAYTDDTIQILEGLEAVRKRPGMYIGSTDARGLHHLVYEIVDNGIDEALAGFGNEIRVTIHKDGSISVRDYGRGMPTGIH-KTGKPTVEVIFTVLHAGGKFGQGGYKTSGGLHGVGSSVVNALSEWLEVTIWRDGAVYRQRFEHGGHPVTTLEKIG-TTRETGSLVSFKPDKTIFSTTSFQFEVLSERLRESAFLQKGMKIVLTDERSD--RQEVYHYEDGIKAFVAYLNEDKDVLHPVVAF-----------EGKANEMEVDVAFQYNDGYSENLISFVNNVRTKDGGTHESGFRTALTRVFNDYARKSGLLKEKDKNLDGSDIREGFMGIVSVRIPEHQFEGQTKEKLGTSEARSAVDTVVSEQLAYFLEENPQISEMLIRKSMRARTARLAARKAREEARKKGKRKETILSGKLTPASSKNADRNELYLVEGDSAGGSAKQGRDRKFQAVLPLRGKVINTQKARLEDILKNEEISTLIYAIGAGVGSDFSIKDSNYNKIVIMTDADNDGAHIQVLLLTFFYRYMRPLIEAGKVYIALPPLYKVSKGKHEEYAWDDSGLKTAIQHIG-KGYTIQRYKGLGEMNADQLWETTMNPQSRTLIRVRIDDQAFAERRVTTLMGDKVEPRRKWIESH......... 632
115 0.000e+00gi|94992112|ref|YP_600211.1| DNA gyrase subunit B [Streptococcus pyogenes MGAS2096]  clstr ali  53  9...EKKMQEYDASQIQVLEGLEAVRMRPGMYIGSTAKAGFASIVWEIVDNSIDEALAGFASHIKVFIEADNSITVVDDGRGIPVDIQAKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVRVYKNGQIHYQEFKRGA-VVADLEVIGTTDVTG-TTVHFTPDPEIFETTQFDYSVLAKRIQELAFLNHGLKISITDKRSGMEQEEHFHYEGGIGSYVEFLNDKKDVIFETPIYTD----------GELEGIAVEVAMQYTTSYQETVMSFANNIHTHEGGTHEQGFRAALTRVINDYAKKNKILKENEDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFQRFLLENPQVARKIVEKGILASKARIAAKRAREVTRKKSGLEISNLPGKLADCSSNDANQNELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKATMDKILANEEIRSLFTAMGTGFGADFDVSKARYQKLVIMTDADVDGAHIRTLLLTLIYRFMRPVLEAGYVYIAQPPIYGVKVGSEIEYIQPEDQLKTALEKIGRSKPTVQRYKGLGEMDDHQLWETTMDPENRLMARVTVDDAAEADKVFDMLMGDRVEPRRDFIEENAVY-STLDI 651
116 0.000e+00gi|365825754|ref|ZP_09367705.1| DNA gyrase, B subunit [Actinomyces graevenitzii C83]  clstr ali  48  1MAEQDTNDSYGASNITVLEGLEAVRKRPGMYIGSTGERGLHHCVYEVVDNSVDEALAGYCDHIEVTILPDGGVRVVDNGRGIPVDEHPTEHKPAVEVVLTVLHAGGKFGGGGYSVSGGLHGVGVSVVNALSSRLSVEVRRDGYVWNIDFADGVP-TAPLRR-GEPTDQTGTTVTFWPNPEIFETTVFDFETLRRRFQQMAFLNKGLRISLTDERDHKHRSVSYMYSDGLRDYVHFLNKTKKAIHPEIIDFSAEQ------SGEHGGMSVEIAMQWTAAYSESVHTYANTINTTEGGTHEEGFRTALTTLVNKYAREKGLLKDKEDNLSGEDVREGLTAVISIKLSEPQFEGQTKTKLGNTEARSFVQQTVYAQLTDWFDAHPADAKAVISKAKQASAARIAARKAREATRRKGVLESASMPGKLRDCSSRDASNSEIFIVEGDSAGGSAVGGRDPEHQAILPIRGKILNVEKARLDRALSSDTIRSLITAFGTGIGEDFELEKLRYHKIVIMADADVDGSHIATLLLTLLFRYMRPLIENGHVYIAMPPLYRLKWSNEHEFAYSDEQRDRLREAGAAKGWRIQRYKGLGEMNDHELWDTTMDPAHRILKQVTPDEAADADETFAVLMGDDVESRRSFIQRNANDVRFLDI 671
117 0.000e+00gi|116628688|ref|YP_813860.1| DNA gyrase, B subunit [Lactobacillus gasseri ATCC 33323]  clstr ali  52  17...EKRADTYNASQIQVLGGLEAVRKRPGMYIGSTSSQGLHHLVWEIIDNSIDERLAGFATKIEITVNEDGSVTVQDDGRGIPVDIQAKTGRPALETVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTKLDVTVMRDGKKYAISFDHGR-VVGEMKQIGTVPEEHGTIVHFYPDPDIFETTTFDDKILKNRIRELAFLNKGLKLTFTDKRKESAETDVYHFEGGIKEYVAFLNKGQEVLFDEPIYVE----------GNYEGIDVEVALQYTNGYKTTLMTFANNIHTYEGGMHEAGFKTALTRVVNDYAHKAKILKDKDDNLSGEDIREGITAVVSVKHPNPQFEGQTKTKLGNSDARTAVDRAFSETFSRFLMENPSVGRKIVEKGQLAERARTAAKRAREVTRKKSGLEIANLPGKLADNTSNDPSISELFIVEGNSAGGSAKQGRSRLTQAILPIRGKILNVEKASMDRILANQEIRSLFTALGTGFGADFDVSKARYHKLIIMTDADVDGAHIRTLLLTLFYNYMRPMIEKGYVYIARPPLYQVRQGKIEKYLDTDEELHDYLGTLPSPKPVVQRYKGLGEMDPEQLWETTMNPENRRLDRVSPEYAEDADKVFDLLMGNEVGPRREFIEKNAKYVENLD. 654
118 0.000e+00gi|425738357|ref|ZP_18856621.1| DNA topoisomerase IV subunit B [Staphylococcus massiliensis S46]  clstr ali  46  1MARNNQMN-YSDDSIQVLEGLEAVRKRPGMYIGSTDKRGLHHLVYEIVDNSVDEVLNGFGNEIKISINKDESISIEDNGRGMPTGIHA-SGKPTAEVIFTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSAWLEVEIHRDGTIFRQRFENGGHPATGLKKEGKT-RKTGTKVSFLPDPNIFKSAQFNFETLSERLQESAFLLKDLKITLTDHREGKEREEVYHYEEGIKAFVEYVNEGKEILHDVTMF-----------QGTANQIEVDVAFQYNDQYSESILSFVNNVRTKDGGTHEVGFKTAMTRMFNDYARRIGELKAKDKNLEGNDIREGLTAIISVRIPEHQFEGQTKSKLGTNEARGAVDQIVAEKLPYYLEEKGQLSKALVKKAIKAQQAREAARKAREDARKKNKRKDTLLSGKLTPAQSKNTDKNELYLVEGDSAGGSAKLGRDRKFQAILPLRGKVINTEKAKLEEIFKNEEINTIIHTIGAGVGNEFKLEDSNYNRVIIMTDADTDGAHIQVLLLTFFFKYMRPLVKAGRVFIALPPLFKLEKGKKVEYAWTEDELAQLQKKLG-KGVILQRYKGLGEMNPDQLWETTMNPETRTLIRVQIEDEVRSSKRVSTLMGDKVAPRREWIESH......... 635
119 0.000e+00METAHIT V1 GL0065345 [Complete] locus=scaffold11364_8:2002:3945:-  ali  47  1MSAEKKKSDYTGQQIQVLHGLEAVRVRPGMYIGSTGSQGLHHLVYEIVDNSVDEALAGFCKHIELSINEDNSITVCDDGRGMPVDMHPTEHKPTVEVIHTQLHAGGKFGGGGYKVSGGLHGVGASVVNALSTHMIVEVKRGGKLYEQEYFQG-KRTTELKVLGEAE-GSGSKTTFWPDPEIFDETVYDYDILQNRMREMAFLNKGLRITIEDKREGRKKKESFCYEGGIREFVTFMNRNKKVINEDVFYFENHKKDEATGK----EYEVEVALQYTGNYNETVMSYANNINTIEGGFHLQGLKAAITRTLNDYARRTKQLKEKDDSLTGDDCREGVTAIVSVKLTDPQFEGQTKAKLGNSEVRGFVESSMNEYFNFYLEEHPAQAKKIVTKCINAANAREAARKARETSRKTNVLESTSLPGKLKDCSEKDPEICEIFLVEGDSAGGSAQEGRDRARQAVLPLRGKILNVEKATRARALDSQEIRNMITAFGCGIDDNFDISKLRYHKIIIMTDADVDGAHIRTLLLTFFYRFMRPLIEEGYVYAAQPPLFRVKRGKETWYTYSDKEQEDLLAELREKKVEIQRYKGLGEMDYTQLWETTMDYNHRTLIRISLDDAEKADEMITTLMGDKDPPRKKFIEENARYAT-LD. 646
120 0.000e+00gi|154496136|ref|ZP_02034832.1| hypothetical protein BACCAP_00420 [Bacteroides capillosus ATCC 29799]  clstr ali  47  10.SATQVDHEYGGSEIQVLEGLEAVRKRPGMYIGSTSSSGLHHLVYEIVDNSIDEALAGYCDRIDVAILEGDIISVTDNGRGIPVDIQPQTGLPALEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVRVYKDGKIHEMKFSRG-KVTQSMTIVGETDR-HGTEVVFKPDPEMFEDTVYDYEILHTRMREEAFLNAGLKIVIQDRRPGMEQEDTMYYEGGIREFVSFINKNKTPIHDGVIYMS----------GMKDDSIAEIAMQYTDTYNEILVSFANNVHTPEGGMHETGFKQALTNVLNAYGKKMKILKD-EEKVSGEDCREGLTAVISVKLTEAQFEGQTKAKLGNAHIRTLVSTLVSEKLEEFLEENPAVGKAILDKALTASRAREAARKARESVRRKTALGGAAMPDKLRDCNEVNPELTELYIVEGDSAGGSATQGRDSRFQAILPLWGKMLNVEKARADKVYGNDKLQPVITALGAGIGDEFDVSKLRYHKVIIMADADVDGAHIRTLLLTFFFRFMRPLIENGYVYSAVPPLYKLTRGKTTRVAFSDEERDQVSAELPNAKVDISRFKGLGEMNPHELWETTMDPEKRTLRRIELDDAVAADATFTILMGEKVEPRKEFIEKNAKYAVNLD. 648
121 0.000e+00gi|319937326|ref|ZP_08011733.1| DNA topoisomerase parE [Coprobacillus sp. 29_1]  clstr ali  47  2.....KSNHYDESNIQILEGLEAVRKRPGMYIGSTDYRGLHHLVWEIVDNAIDESLAGFGNKITVTIGSDNTIKVEDEGRGMPTGLHA-SGKPTTEVILTILHAGGKFEDGGYKTSGGLHGVGSSVVNALSEWLEVTVYRDGKIHQQKFEDGAKIISPLKVIGKTNR-TGTTIHFKPNKEIFSTIDFNYSTICERLRESAFLLKGIEMIVIDERTG--KHETFQYENGLEAFIDYLNYEKKVLHKTVSF-----------DDESNPIEVEIAFQFTEGYQENLISFVNLVRTGDGGTHETGFRSGFTKVFNEYARKYGLLKTKDKNLEGADVREGLTGIISVKIPESQFEGQTKSKLGSPEARNIVENVVYEQINYFLEENKDVANQLVNKMIKAAQARNAARKAREEARKKGNKVEKILSGKLAPAQSKDKKKKELYLVEGDSAGGSAKQGRDRKYQAILPLRGKVVNTEKAAMADILKNEEISTIINTVGAGVGADFNADDSNYAKVIIMTDADTDGAHIQVLLLTFFYRYMRGLIQSGRVYIAMPPLYKVSKGKHELYAWDDDELEDAKKKIGR-GYGVQRYKGLGEMNADQLWETTMNPETRTLIQVSIEDAALVERRVSVLMGDKVEPRREWIEDN......... 629
122 0.000e+00METAHIT MH0006 GL0179491 [Complete] locus=scaffold31818_3:251:2176:-  ali  54  1MEENK--QHYDASDIQVLEGLEAVRKRPGMYIGTTDVKGLHHLVWEIVDNSIDEALAGYCNNIEIVINKDNSITVKDNGRGIPVGIHAKTGISTVETVYTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSKWVTVTVYKDGKIYECKFANGGKTTQKLTVIGECEKETGTTVTFKPDPEIFDTDIYDYETLKVRTRELAFLNKGLRLTLRDDRDDEDTTEVFHYEGGISEYVRYLNKNKTPIHEQIIHLE----------GEEDGVMFEVALQYNDGYSDSIYSFVNNINTHDGGTHEEGVRRALTRIINSYARKSKILKDKDENLTGDDVKEGLTMIVSCKHPNPQFEGQTKGRLGNSEVRKLADSVFSEGFERFLMENPDTAKIIIEKATVASRARMAAKRAREATRRKTALDGFNTIGKLADCTSKDASISEIFLVEGDSAGGSAKDARIPATQAILPLRGKILNVEKARLDRALSNEEIRTIITAFGTGIGEEFDLSKLRYHKIVIMTDADVDGSHIRILLLTLFYRFFRPIVEGGYVYAAQPPLYKVINGKNIKYVLTDEELEEYRKTLPNAKPIVQRFKGLGEMDAIDLRETTMHINNRVLKRVTVEDAIAADKVFTDLMGDDVNPRKSFIEEFAKFAEMLDV 641
123 0.000e+00gi|284928768|ref|YP_003421290.1| DNA gyrase subunit B [cyanobacterium UCYN-A]  clstr ali  47  4......KSDYGAEQIQVLEGLEPVRKRPGMYIGTTGPKGLHHLVYEVVDNSIDEALAGHCTHIEVDINIDGSVTVTDNGRGIPTDIHPATGKSALETVMTVLHAGGKFGGGGYKVSGGLHGVGISVVNALSEWLIIKVWRDNSVYTQRYECGV-AVSELKKEPDTEHPKGTSVSFLPDKQIFTDTNFDYATLSARLRELAYLNSQITIKFTDYRKQEPYSETYFYEGGLREYVTYMCRNKEALHKDIIYI----------CGEKKGVQVEAALLWCDAYSDNLLGFANNIRTIDGGTHLEGLKTVLTRTMNNVARKRNKIKENEPNLSGENVREGLTGIVSVKVPEPEFEGQTKTKLGNTEVRGIVDLLVGEVLGEYLEFNPHVGDIIIEKAVQAFKAAEAARRARDLVRRKSVLESSPLPGKLADCSTRDPAEAEIFLVEGDSAGGSAKQGRDRRFQAILPLRGKIINIEKTDDAKIYKNNEIQSLITALGLGIGEEFDVSQLRYHRIVIMTDADVDGAHIRTLILTFFYRYQRLLIEQGFIYIACPPLYKIERGRNHSYCYNEQQLQDNIKALANAKYTIQRFKGLGEMMPVQLWNTTMNPETRSMKRVEIDDAVEADRIFTILMGDKVAPRRQFIENYGLNLNDLDI 642
124 0.000e+00gi|117927216|ref|YP_871767.1| DNA gyrase subunit B [Acidothermus cellulolyticus 11B]  clstr ali  47  1MTDQADASSYDASSITVLEGLEAVRKRPGMYIGSTGERGLHHLVYEVVDNAVDEALAGACDRIDVTLLADGGVRVVDNGRGIPVDEHPGEKRPAVEVVLTVLHAGAKFGGRGYKVSGGLHGVGVSVVNALSERLDVEVHRDGYVWRQSYRRGTP-TGPLQR-GEPTDRTGTTVTFWPDPEIFETTRFSFETLANRLREIAFLNKGLTITLRDERPDDPTEVYYRYDGGLVDYVAHLNATKEPAHRSIISFEAHDPVS--------DMSLEAALQWNTGYTESVHTFANTINTHEGGTHEEGFRAALTYLVNKFGEEWNLIKKKEDRLTGEDIREGLTAILSIKLKEPQFEGQTKTKLGNTEVKSFVQTVCNDRLGEWFEKNPAEGKDIVRKAIQAATARIAARKARDLARRXXXXXXXXXXXXXVDCQSTNPEECELFIVEGDSAGGSARQGRDPRTQAVLPIRGKILNVERARIDKVLQNNEVQAVISALGTGVHDDFDLARLRYHKVVLMADADVDGQHIRTLLLTLLFRFMKPLVEAGHVYLAQPPLYRIKWSNAHEFAYSDRERDGLVEAGLAAGKKIQRYKGLGEMNPEELWTTTMDPAQRVLLQVSLDDAARADEIFSILMGDDVEQRRAFIQRNAKDVRFLDI 666
125 0.000e+00gi|261368839|ref|ZP_05981722.1| DNA gyrase, B subunit [Subdoligranulum variabile DSM 15176]  clstr ali  47  12..ETATDHAYGGAQIQVLEGLEAVRKRPGMYIGSTGPSGLHHLVYEIVDNSIDEALAGYCTHIEVTIKPGNIIQVSDNGRGIPVDIQPKLGIPAVTVVYTVLHAGGKFGGSGYKVAGGLHGVGASVVNALSEWLTVRVRRDGAEYEQSFQRG-KPDGDLKKIGSAA-STGTLVIFKPDPEMFETTQYRYETLLKRLREEAFLNAGVRITLTDERPEDGRSETMCYEGGIRSFVSYLCERRTPLTPQVMYM----------KGEGQGAVAEVALQYYDSYNELILSFANNVHTPEGGTHEEGFKLALTRVLNEYGRAKGILKDKDENLSGPDAREGIIAVVSVKLQEAQFEGQTKAKLGNTFIKGLVNGVVYKALTEYFEENPAVAKAILEXXXXXXXXXXXXXXXXDLVRRKSALESNRMPGKLADCHEKDPSKTELFIVEGDSAGGSAKMGRDSNIQAILPLWGKMLNVEKARADRIYGNDKLMPVVTALGTGIGDEFDISKVRYHKIFIMADADVDGSHICTLMLTFFFRYMRPLIEHGYVYVAQPPLFKLQKGQTVKYAYNDDEMKVLSAEMPGAKVN--RYKGLGEMNPDQLWETTMNPDNRVIVQIKIEDAERADEAFSILMGEQVEPRRQFIVKNAKFA-NLDV 662
126 0.000e+00METAHIT MH0031 GL0010648 [Complete] locus=scaffold8807_1:33801:35810:-  ali  45  1MEENEKEEQYSAGSIQVLEGLEAVRKRPSMYIGDVGVRGLHHLVYEVVDNSIDEAMAGYCDHIEVTINEDNSIRVQDNGRGIPTGMHPKEHRSALEVVLTVLHAGGKFSKDSYKVSGGLHGVGVSCVNALSDLLIAEVHREGKIFQQKYSKGKPIT-PVEVIGEC-QDTGTTITFHPDSEIFTTTIYDYDTLAKRMRELAFLNKGIKITLTDNRTQVHKHDVFYSQEGLKEFIKYLDASQEELIPEPICVTSDKI-----------IPIDIALQYNTGYKETILSYVNNIHTIEGGTHLQGFKMGLSRSLRNYADKNKMLEKLKVELSQEDFREGLTAIVSVKVAEPQFEGQTKTKLGNSEVTSVVSQATAAAMDQYLEENPKFAKIIIEKVILXXXXXXXXXXXXEMVQRKTVMSGAGMPGKLADCSERNPEECELFLVEGDSAGGTAKQGRQRRIPATLPLRGKILNVEKAAEDRAFDSEEIRNIYTALGVTVAQEMDLSKLRYHKVIIMTDADVDGSHIATLILTFFFRYMFDLIRNGYVYLATPPLYLVKKGKDEIYCWTDAQRAEATQKLGKKGVTVQRYKGLGEMSEHQLWDTTMDPSKRRLRKITIDNAAEAERTFSMLMGDDVPPRRQFIEENAHYA-NID. 668
127 0.000e+00Oral.Meta HOMD eita_c_3_38 Enterococcus italicus DSM 15952 [30461 - 32470] DNA topoisomerase (ATP-hydrolyzing) ParE  ali  46  5....KKSNEYNDASIQVLEGLEAVRKRPGMYIGSTDARGLHHLVYEVVDNAVDEALSGYGDEIKVIIHKDGSISVQDFGRGMPVGMH-TSGIPTVEVIFTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSEWLEVRIVRDGIEYRQRFVNGGHPEGTLEKIGKTKEKNGTTVRFLPDKGIFSTTKFSYDTLAERLRESAFLLRGVKISFTDLREDD-KEDVFHYEEGIKEFVEYLNEEKDVLTP-IIYFS----------GEKEMIEVEVALQYNDGFSETILSFVNNVRTKDGGTHEAGMKAALTKALNEYARKVGLLKEKDRNLEGSDFREGLSSVLSIRVPEHQFEGQTKEKLGTPAARTAVDNAISEQLGFYLQENNEISQLLVRKAIXXXXXXXXXXXXXXXSRKKKKKGESLLSGKLTPAQSKNPKKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTEKAKMQDILKNEEINTMIYTIGAGVGPEFSIEDCNYDKIIIMTDADTDGAHIQVLLLTFFYRYMKPLIEAGKVYIALPPLYKVSKGKKEEYAWTDEELQTVTEKVGR-GYMLQRYKGLGEMNADQLWETTMDPETRTLVQVRIDDPAQAERRVTTLMGDKVEPRRKWIESH......... 635
128 0.000e+00gi|365121734|ref|ZP_09338649.1| DNA gyrase, B subunit [Tannerella sp. 6_1_58FAA_CT1]  clstr ali  49  1MSEELNVDSYSADSIQVLEGLEAVRKRPAMYIGDIGIKGLHHLVYEVVDNSIDEALAGYANHIDVIINEDNSITVIDNGRGIPVDMHEKEHKSALEVVLTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTYLRAEVKRNGKIYMQEFSCG-KPLHDVEVIGTTEETG-TIITFRPDADIFTDVVYKFDILASRLRDLGYLNAGIYLSLTDKREGDFRKEEFFSVEGLKEFVRYIDSTKEHLFEDIIHIST----------ERQGVPVEVAMTYNTSYNENLFSYVNNINTIEGGTHVAGFRRGLTRTLKKYAEDSKMLEKVKVEISSDDFREGLTAVISVKVMEPQFEGQTKTKLGNNEVIGAVDVAVSEALRNFLEENPKQAKAIVEKVILXXXXXXXXXXXXEMVQRKSPLSGGGLPGKLADCSQRNPEVCEIFLVEGDSAGGTAKQGRDRAFQAILPLRGKILNVEKAMHHKVLESQEIRNIYTALGVTIGKEANISKLRYHKIIIMTDADVDGSHIATLIMTFFFRHMRPLIENGYLYIATPPLYLCRKGKIEEYCWTEQQRTQFALKYANGDVNTQRYKGLGEMNSHQLWETTMDPAHRTLRQVTIDNAAEADRVFSMLMGEEVGPRREFIEAHATYA-NID. 650
129 0.000e+00gi|384067352|emb|CCH00562.1| DNA gyrase, B subunit [Fibrella aestuarina BUZ 2]  clstr ali  48  15...DPSRANYGADNIQVLEGLEAVRKRPAMYIGDVGVKGLHHLIWEVVDNSIDEAMAGYCDTIQVTINEDNSITVRDNGRGIPVGMNRQTGRNSLEVVMTVLHAGGKFDKDTYKVSGGLHGVGVSCVNALSTRLRVEVHRDGKAYEQEYHIG-HPQYDVREIGTAD-DTGTTVHFKPDETIFESTVYRFDTVAGRLRELAYLNKGIRIVLTDMRELDEQQQEFHSEGGLIEFVKYLDETRAALDGEPIYMESD----------KGSTPVQVSMVYNMEAGENVQSYVNNINTHEGGTHVQGFRSAITRVFGKYLERNGLVPKNKVKFEGGDFRKGLTAVVSVKVQEPQFEGQTKGKLGNQDVVSAVSQVVGEMLEQWLEENPKKAQAIVRKVLISAQARIAADLARIMTERKDFMGGAGLPGKLADCSDTDPEKCELYLVEGDSAGGSAKQGRNRAFQAILPLRGKILNVEKAMEHKIYENEEIKNIWTALGVRLGDEMNLDKLRYHKIIIMTDADVDGSHIRTLLLTLFFRNMRLLIESGYVYIAQPPLYLVKKGKDQRYCWTEAQRETAVRELAGSGVHIQRYKGLGEMNAEQLWETTMDPTSRSLKLVTIESAADADHVFSMLMGDEVAPRRDFIERNAKYAK-IDI 669
130 0.000e+00gi|385651564|ref|ZP_10046117.1| DNA gyrase subunit B [Leucobacter chromiiresistens JG 31]  clstr ali  49  1MSSEQAAENYGAGAIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNSVDEALAGYCDFIDVTILADGGVRVVDNGRGIPVDEHPTEGRSTVEVVLTVLHAGGKFGGGGYAVSGGLHGVGSSVVNALSRRFEVSVQRQGFTWNMSFTDSVP-DAPLAQ-GDLSSETGTSITFWPSADIFESIDFDYQTLRTRFQQMAFLNKGLRIALTDLREQEPVEDEFLYENGIQDYVQHLNAAKELVNEEIISFEAEDPD--------RKIAAEVAMQWTTSYTESVHTYANTINTHEGGTHEEGFRAALTTLVNRYAREKNILREKDDNLSGDDVREGLTAVISVKLGEPQFEGQTKTKLGNTEAKAFVQKVVGDQLGDWFERNPGPAKDIIRKSIQAASARLAARKARETARRKGLLESGGMPGKLSDCTSKDPTISEIFIVEGDSAGGSAKTGRNPHTQAILPLRGKILNVEKARLDRALNNAEVQAMITAFGAGIGEDFTPEKARYHKIVLMADADVDGQHITTLLLTLLFRYMRPLIDLGYVYLAQPPLYRIKWSNEDEYVYSDSERDARLAAGAEQGRRVQRYKGLGEMNHEELWETTMNPETRTLLQVTMEDAAIADEIFATLMGEDVEARRTFIQQNAKDVRFLDI 664
131 0.000e+00gi|118470463|ref|YP_885621.1| DNA gyrase subunit B [Mycobacterium smegmatis str. MC2 155]  clstr ali  51  2.....STTNYDAGSITILEGLDVVRKRPGMYIGSTSERGLHHMVWEVVDNGVDEAMAGHATRVDVTLLADGGVQVCDDGRGIPVAMH-ETGIPTVDVVMTQLHAGGKFDSESYQVSGGLHGVGVSVVNALSTRLEVDIHRDGYEWHQHYDHSVPAT--LTR-GNPSGGTGTTVRFWADPDVFETTTYSAETIARRLQEMAFLNKGLILTLTDQRDPEPQTRTFHHPGGLIDYVKHINRVKDPIQPSIIAFEGEGPGH----------EVEIAMQWNAGYSESVHTFANTINTHEGGTHEEGFRAALTSVVNRYAKDKKLLKDKDPNLTGDDIREGLAAVISVKVAEPQFEGQTKTKLGNAAIRSFVQKVCHEQLTHWLEANPVEAKVIITKVASSAQARIAARKARELVRRKSATDIGGLPGKLADCRSTDPSKSELYVVEGDSAGGSAKSGRDSMFQAILPLRGKIINVEKARIDRVLKNTEVQSIITALGTGIHDEFDISKLRYHKIVLMADADVDGQHISTLLLTLLFRFMKPLVENGHIFLAQPPLYKLKWQRSEEFAYSDRERDGLLERAAGKKINIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGDDVEARRGFITRNAKDIRFLDI 639
132 0.000e+00gi|406968684|gb|EKD93488.1| hypothetical protein ACD_28C00141G0005 [uncultured bacterium]  clstr ali  50  3.SKEPAANSYGAEHIQVLEGLEAVRKRPGMYIGTTDVAGLHHLIWEVVDNAIDEAIAGHCNNIDVTLHADGSASILDDGRGIPVDVHPKTGKSTLETVLTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSSKLVAEVYRDGKRYVQEYQYGAP-QYEIKVDGKST-STGTLIRFWPDKGIFEITEFNPQTILNRLRQQAYLTKGITIRFRDERVESPSRYQFYFEGGIKSYVLHLNKSKEVI-GEVVYLDKEVPEGM----------IEIAFQYNQSFQECIFTFANTIHTPEGGMHLTGFRSALTRVINAYARKNNLLKEKEDNLMAEDVREGLTVVISVKLPDPQFEGQTKSKLGNPEIRTAVETVFGEFLQEYLEENPNHGKEIIAKCSXXXXXXXXXXXXXDTVIRKGALEGMTLPGKLADCSSKDPSNSELYIVEGDSAGGSAKQGRNRENQAILPLRGKILNVEHARMDRILGNNEIKALIIALGVGIGEFFDLGRLRYDRIVIMTDADVDGAHIRTLLLTLFYRYFKTLIEEGHLYIAQPPLYKLSQGKRLEYCYTDEQKEVQMKTFSDTKINIQRYKGLGEMNPEQLWETTMNPETRMMLRVSIDDAERADKVFDTLMGSEVLPRKKFIQAHAKQVRNLDI 639
133 0.000e+00METAHIT MH0063 GL0045142 [Complete] locus=scaffold9279_2:8539:10488:-  ali  48  1MTEEPAGQVYDESQIQVLEGLEPVRKRPGMYIGSTSQRGLHHLVYEIVDNSIDEAMAGICTHIDVTFQKDGSVSVRDNGRGIPAGINAQTGTPTLEVVFTVLHAGGKFGGEGYKFSGGLHGVGASVVNALSDWTEVENRHEGKVYSERFEKGN-IARPFACIGTCDREHGLYVRFMPDGDIFETTVFDYDVILNRMREQAFLNAGITITVTDEREEEPRKEVLFYEGGIKSFVEHLNSLKNVLHD-VIYM----------RAEADDKTAEIAIQYNDKYEETMISFANNIHTIEGGTHEDGFKAALTRVMNKYATDKKLIKDSDSAFKGEDIREGICAVISVKLKEAQFEGQTKAKLGNSDMRSFVDKLMSVKLSEYLEEHPAVGKLIVEKALAASXXXXXXXXXXXXTRRKTGLDSGQMPDKLRDCNERDASLTEIYIVEGDSAGGSATQGRDSRFQAILPLWGKMLNVEKARADKVYGNDKLNPVIVALGAGIGNEFDIEKLRYHKIIIMADADVDGSHIRTLLLTFFFRFMRPLIEQGYVYSAVPPLYKLTRGKTQRVAYSDEERDAISAEMRGGKIDISRYKGLGEMNPHELWETTMNPETRTLRRIQLEDAQLADETFSILMGEDVEPRKEFIEVNARYAVNLD. 648
134 0.000e+00gi|383806737|ref|ZP_09962298.1| DNA gyrase subunit B [Candidatus Aquiluna sp. IMCC13023]  clstr ali  49  2...PEPTRNYDAGDIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNSVDEALAGHCDNIDVVITKAGNIKVSDNGRGIPVDMHPVEKRPAVEVVLTVLHAGGKFGGGGYAVSGGLHGVGASVVNALSSTLSVEVHRDGHIWRQGYSIGVP-DAPLAK-GEKTDRTGTTIEFSPSADIFETVDYDYETLRQRFQQMCFLNKGLKINLLDERDG--RKDNYYYERGLADYVEYLNSAKETIHDEIISIETET--------KEKTISVEIAMQWTTGYNEGVHTYANTINTHEGGTHEEGFRTALTSLLNKYARDKSLLKEKDDNLTGDDVREGLTAVVSLKLTEPQFEGQTKTKLGNTEAKAFVQKVVNDQLGDWLARNPVQAKEIVRKAIQAASARMAARKAREATRRKGLLESGGMPGKLRDCSSRDPVVSEIYIVEGDSAGGSAVRGRDPETQAILPLRGKILNVEKARLDRALANTEVQALITAFGTGIGEEFDVSKIRYHKCILMADADVDGQHIRTLLLTLLFRYMRPLIEHGYVYMAQPPLFKLKWSNAHEYVYSDEERDRRLQEGQAAGRRIQRYKGLGEMDYDELWETTMNPATRTLLQVTLDDGALADEVFSTLMGEDVESRRNFIQRNAKDVRFLDI 645
135 0.000e+00gi|304384956|ref|ZP_07367302.1| DNA topoisomerase (ATP-hydrolyzing) ParE [Pediococcus acidilactici DSM 20284]  clstr ali  46  1MAKIGKT-TYDDSSIQVLEGLEAVRKRPGMYIGSTDGRGLHHLVYEIVDNAVDEALAGYGKEINVTIRSDNSITVVDHGRGMPVGMH-KSGKPTAEVIFTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSEKLTVEIVRDKMKYEENFVNGGHPVGTLKKVGKTKESNGTTVTFKPDPTIFTTTVFNFNTLAVRLRESAFLLKGVKITLTDERAGHEQAEEYLYEEGIKEFVEYLNEDKDTL-GNIMYFD----------GSKHGIEVEIAGQYNDGYSETVLSFVNNVRTKDGGTHEVGMRSGWTKAFNEFARKVGLLKEKDKNLEGSDVREGLSAVISIRVPEEEFEGQTKEKLGTPEARPIVEAVVSEQLGFFLMENGEFAQQLVRKAINARDARVAARKARDESRKRRKKQDRILSGKLTPAQSKNAKKNELFLVEGDSAGGSAKQGRNRKFQAILPLRGKVLNTEKAKLQDIVKNEEINTIIYTIGAGVGPEFKVEDSNYDKVIIMTDADTDGAHIQTLLLTFFYKYMRPMIDAGKIYIALPPLYKLQKGTKIEYAWTDEELEEVSKKMGR-GFSLQRFKGLGEMNADQLWETTMNPDTRTLVRVRIDDDTLAERRVTTLMGDKVEPRRKWIESN......... 635
136 0.000e+00gi|381399863|ref|ZP_09924880.1| DNA gyrase, B subunit [Microbacterium laevaniformans OR221]  clstr ali  48  19...QKVENEYGADAIQVLEGLEAVRKRPGMYIGSTGERGLHHLVYEIVDNSVDEALAGYCDTITVTILEDGAIRVVDNGRGIPVDIHKAEGKSTVEVVLTVLHAGGKFGGGGYAVSGGLHGVGSSVVNALSTRLDVEVRRQGHVWRQSFRDGGVPQAPLSQ-DEATEETGTTITFWPDDGIFETIDFDYDTLRTRFQQTAFLNKGLRITLSDLRDGQAVEDDFHYERGLVDYVEYLNRKAEVVNDEIIEVESE--------DTERHISLELAMQWTTSYTENVFTFANTINTHEGGTHEEGFRAAMTTYINKYAREKGLLKEKDDNLTGEDIREGLTAVISVKLSEPQFEGQTKTKLGNTEAKAFVQKVVGDQLTDWLDRNPAQAKRVIMKAIDAATARLAARKARETARRKSVFESASMPDKLKDCTSKDPSISEIFLVEGDSAGGSAVRGRDPETQAILSLRGKVLNVEKARLDRALGNNEIQAIISAFGCGIGEDFDVAKARYHKIVLMADADVDGQHITTLLLTLLFRYMRGLIEAGFVYLAMPPLFRLKWSNEHEYVFSDRERDALLADGLANGKRIQRYKGLGEMNPKELWETTMDHSTRTLRQVTIDDAAAADEIFSVLMGEDVESRRSFIQRNAKDVRFLDI 679
137 0.000e+00gi|298345811|ref|YP_003718498.1| DNA topoisomerase [Mobiluncus curtisii ATCC 43063]  clstr ali  49  17...EKPEEHYDASDIRVLEGLEAVRVRPGMYIGSTGERGLHHLVYEVVDNSVDESLAGYCDHIEVTLQADGGVRVADNGRGIPVAEHPSEHRPTVEVVMTILHAGGKFGGSSYAVSGGLHGVGISVVNALSTKILTTVKRDGYEWHIEFGNGGKVIQPLRR-GEPTEETGTVQVFYPDPEIFETVEFDYETLRTRFQQMAFLNKGLRITLTDERPNGRRSVSYCYENGLHDYVHFINDTKEVVHEEIIDFEAS------LEDVENAMALEIALQWTSAYSESIYTYANTINTTEGGTHEEGFRAALTSLMNKVGREKGFIKDKDENLSGDDCREGLTAVISVKIRNPQFEGQTKTKLGNTEARTFVQQTVYSQLGDWFDAHPAECKAIIAKAQSAQQARNAARKARDATRRKTALDSFSMPGKLRDCSSRDASNCEIFLVEGDSAGGSAVAGRDPAHQAILPLRGKILNVEKARLDRALDNKEIQSLITAFGTGIGEDFDLSKLRYYKIVLMADADVDGQHITTLLLTLLFRYMRPLIENGHVFLATPPLYRLKWNKPHQFVYSDKEKDKMVSLGLDSGARIQRYKGLGEMSAQELWETTMDPSARLLKQVTMDEAASADEVFSLLMGEDVSSRRAFIQRNAQDVRFLDI 686
138 0.000e+00gi|402298115|ref|ZP_10817834.1| DNA topoisomerase IV subunit B [Bacillus alcalophilus ATCC 27647]  clstr ali  47  3...NKNHLEYNDDSIQVLEGLEAVRKRPGMYIGSTDARGLHHLVYEIVDNAVDEALAGFGEYINVTIHPDNSISVSDEGRGMPTGMH-KLGKPTPEVIFTILHAGGKFGQGGYATSGGLHGVGASVVNALSEWLVVEIMRDGKRYRQRFENGGKPAKTLEMIGNT-RRTGTVVHFKPDPIIFSTTTYNLETLTERLREAAFLLKGIKIELVDLR-GETSSEQFVYDTGIQAFVEYLNEDKETLIPVVYF-----------TGENNEIEMELAFQFNDGYTENVLSFVNNVRTKDGGTHELGAKAAMTRIVNEYARKVKLLKDKDKNLDGSDIREGFTAIISIRVPEAQFEGQTKGKLGTPEARSAVDSLVSEKLSYFLEENPDIASLLIKKAVKASQAREAARKAREDARKKNKRKDVLLSGKLTPAQSKNPKRNELYLVEGDSAGGSAKQGRDRKFQAVLPLRGKVINTEKAKIDDIMKNEEIRTIIHTIGAGVGADFTIDDVNYDKVVIMTDADTDGAHIQVLLLTFFYRYMRPLVEAGKVYIALPPLYKVSRGKKEEYAWDEKGLQEAIKKIGR-GYTIQRYKGLGEMNATQLWETTMDPETRTLIRVKIDDAARAEKRVTTLMGDKVEPRRKWIESH......... 633
139 0.000e+00JCVI_PEP_1096683527345 /source_dna_id=JCVI_ORF_1096683527344 /offset=0 /translation_table=11 /length=673 /full_length=673  ali  47  25MSTNNKKNQYSADSIQALEGMEHVRKRPSMYIGDVGSRGLHHLVYEVVDNSIDEAMAGYCSAILIEINKDSSLTVEDNGRGIPVGIHKKEGVSALEVVMTKIGAGGKFDKDSYKVSGGLHGVGVSCVNALSQLLVAKVFRDGKEYEQSYSKG-KPSEPVKEVGKSDK-TGTRVTFTPDKEIFEVTEFDYEILSNRMRELSFLNKGLTISIKDNRDDNPISETFHSKEGLSEFIKYLDKGRVPIISSIIKME----------GEKNGIPVEVAMVYNSSFSENLHSYVNNIDTHEGGTHLTGFRRGLTNTLKKYADSSGLTDKLKFDISSDDFREGLTAVISVKVAEPQFEGQTKTKLGNREVSSAVSQSVSQMLEDYLEENPDDSKIIVQKIILAAQARTAASKAREMIQRKTVMSGGGLPGKLSDCSETDPSKCEVFLVEGDSAGGTAKQGRDRVFQAILPLRGKILNVEKAQQHRVFENEEIRNIYTALGVSVGTELNLEKLRYHKIIVMCDADVDGSHISTLILTFFFNYMRELVERGNIYIATPPLYLVKKGSKKVYAWNDEERDNIAKDLGS-GVSIQRYKGLGEMNADQLWDTTMNPESRTLRQITLDNSKEAQEWFATLMGDEVPPRRKFIEDNAVYAK-IDV 672
140 0.000e+00gi|406025417|ref|YP_006705718.1| DNA gyrase subunit B [Cardinium endosymbiont cEper1 of Encarsia pergandiella]  clstr ali  47  2...TPTINDYSADNIQVLEGLEAVRKRPAMYIGDVGVKGLHHLVWEVVDNSIDESLAGHCTKIGIIIHENNAITVWDNGRGIPTGMHLKEQKSALEVVMTILHAGGKFDKGTYKISGGLHGVGVSCVNALSAHLAVTVYRNGKIYKQEYAQGVPC-YSVKEIGTTA-LRGTTVHFRPDSSIFTTTVYNLHTIINRLQELAYLNVGLKMQLEDRREGNPFQQTFYSEGGLLEFVSHLERTKTSIMPTPILIE----------GEKNNIGVQVAMTYNTGYSETVVSYVNNIHTIEGGMHVTGFKRALTRTLKNYADKSGLLEKAKIEIIGDDFREGLTAVISVKVAEPQFEGQTKTKLGNAEVQSAVESCVAEVLHYYLEEHPKEAKLIVNKVIVXXXXXXXXXXXXEMVQRKNVLMSNSLPGKLADCSERDPTLCELFLVEGDSAGGTAKMGRNRRFQAILPLKGKILNVEKAQAYKIYDNEQVRNMITALGVAIGTDINLDKLRYHKIVIMTDADVDGSHIRTLILTFFFRYMRDIIEKGHLYIASPPLYLVKRDKEEHYCWTESEKEEWVTQFSLKDVFVQRYKGLGEMNEIQLWDTTMDPTRRNLRQVTIASALAAEHLFSMLMGDEVPPRREFIEHYAKYAK-LDI 649
141 0.000e+00gi|150020566|ref|YP_001305920.1| DNA gyrase subunit B [Thermosipho melanesiensis BI429]  clstr ali  50  2........DYNAQNIKVLKGLEPVRQRPGMYIGSTGKAGLHHLVYEIVDNSVDEALQGYCDKIYVTIFKDGSVEIKDNGRGIPVDIHPETGKSALEVVMTTLHAGGKFSKDSYKVSGGLHGVGASVVNALSEWLEVEVHRDGKIYYQKYQRGTPLT-EVRIIGETD-YRGTIVRFKPDTEIFSTVEFDSDTILIRLRELAFLNPNITVVFKDERENIEK--TFHFTGGLKEFVVHLSKGTRSLHEPI-----------LVSGEYNSIKVDVCFQYTASDFEKIYSFVNNIRTVDGGTHVTGFKTAFTRVVNELGKKTGQLK--KDTLRGEDIREGIVAIVSVLMSKPEFEGQTKSKLGNEEVQEAVAKVVREKLLEYFESNENTLKIIIQKALEAKKAREAAKHAREMIKRKSVFGSSSLPGKLADCITKKMEESELFIVEGDSAGGSAKQARDRNFQAILPLRGKILNVEKSSWLKLLKNEQIRDIITALGTGIGDDFDISKLRYGKIIIMTDADVDGAHIRTLLLTLFYRYMKELIDEGRIYIAQPPLYKVNVNKKIYYFYSDEELEEFKENLKDKKFEIQRYKGLGEMNPQQLWETTMDPEKRKLLKVEIEDAEEADELFEMLMGSDTESRKEFIFRHALQVKEIDI 627
142 0.000e+00gi|347534415|ref|YP_004841085.1| DNA topoisomerase 4 subunit B [Lactobacillus sanfranciscensis TMW 1.1304]  clstr ali  46  15MTKLNNSEKYDASSIQVLHGLEAVRKRPGMYIGSTDSKGLHHLVYEIVDNAVDEAIAGYGKEINVTIHKDDSITVVDHGRGMPVGMHA-SGKPTPEVILTVLHAGGKFGQGGYKTSGGLHGVGSSVVNALSSHLTVEIVRDHQKYQEDFENGGHPVGTLRNLGKTKAGNGTTITFKPDSEMFTTITYNFDTLATRLRESAFLLKGVKITLTDEREGKEREEVYQYDDGIKEFVAYLNEGKNVLGDVMYF-----------DGSKQGIEVEVAAEYNDGYTETMLSFVNNVRTKDGGTHEAGFKSGWTKAFNEYARKVGILKEKDKNLDGSDIREGLTAVIALRVPEEQFEGQTKEKLGTPEARSIVDGVVDEQLLYFLMENGDLANTLVQKALRARKAREAAKKAREESRKKKKKQEKLLSGKLTPAQSKDAAKNELFLVEGDSAGGSAKQGRDRKHQAILPLRGKVLNTEKANVADIMKNEEISTIIYTVGAGMGNDFKLKDANYDKIIIMTDADDDGAHIQILLLTFFYKFMRPMIEAGHVYVALPPLYKLQEGKKIEYAWTNEELNSLRKDFP-KGMTLQRFKGLGEMNADQLWETTMDPEHRTLIRVQIDDAAVAERQVSTLMGSKVEPRRDWIENN......... 650
143 0.000e+00gi|78707345|gb|ABB46478.1| DNA gyrase subunit B [Acholeplasma equifetale]  clstr ali  54  1.......................VRKRPGMYIGSTGERGLHHLVWEIVDNSIDEALAGYADHIEIEVLKDNVIRVSDNGRGIPVDIHPKTGRPAVETILTTLHAGGKFDKGSYKVSGGLHGVGASVVNGLSVWYVVEIHKDGKIYEQKYERGIPA-YDLKELGETNR-TGTITTFKADPLIFETTVYDIETLRTRIQQLAFLNRGITISLSDSRDENHYQETFKYDGGIIEYVKFLNQNKKTIHPDIIYFEK----------EQDGVTVEVAMQYVDTYTPNIHSFTNNISTTEGGMHEDGYKMALTRVISRYADDMKA--KKDDAIIGEDTREGLTAIISVKHPEPQFEGQTKTKLGNPEVRAITSQVTQEALERFLLENPQQAKSIVEKVIEATRARVASRKAKELARRKSPLDQLDFASKLADCRSKDPEKSELFIVEGDSAGGSAKQGRDSEFQAILPLRGKVLNVEKARIDTMLKNKEIINIIQAIGTGISEEFDISKLRYHKIVIMTDADVDGAHIRTLLLTFFFRHMRPLIENGHIYAAQPPLYKVSYGRNVKYAYSDEELNEITSKLET-KPTLQRYKGLGEMNYEQLWDTTMNPETRTLLQIQLDDAIEADQIFT.......................... 588
144 0.000e+00gi|365904033|ref|ZP_09441792.1| DNA topoisomerase IV subunit B [Lactobacillus versmoldensis KCTC 3814]  clstr ali  46  3......KSSYDDSSIQILEGLEAVRKRPGMYIGSTDTRGLHHLVYEIVDNAVDEALSGFGKEINVTLNHDGSVTVVDHGRGMPTGMHS-SGKPTIEVILTVLHAGGKFSENSYKTSGGLHGVGSSVVNALSEWMTVRVVRDHKVYQEKFEKGGHPVGTLKMTGKTREDSGTTISFMPDASIFQTIKFNFDTLAERLRESAFLLKGVKFTITDKRGEEDNQEIFHYEDGIQSFVKYLNEGKDTL-GNIFYIE----------GENSDIEIEFSGQYNDGYSENIISFVNNVRTADGGTHEAGMKSGLTKAFNDYARKVGLLKESSKNLEGSDVREGLSAIISVRIPEEQFEGQTKGKLGTPQARGAVDQLVYEQMSFYLMENGEQAQTLVKKALKAREARNAARKARETTRRKSKKNDGLLSGKLTPAQSKNAAKNELFLVEGDSAGGSAKQGRDRKFQAILPLRGKVLNTQKAKLEEIYKNAEINTMIYTIGAGVGADFKLEDRNYDKVIIMTDADDDGSHIQILLLTFFYRYMRPLVESGHVYIALPPLYKLQKGRKIEYAWTPDELAETIKTMG-KGYELQRFKGLGEMNADQLWQTTMDPESRILIRVNIDDAALAERRVTTLMGDKVKPRRDWIEKN......... 632
145 0.000e+00gi|383761128|ref|YP_005440110.1| DNA gyrase subunit B [Caldilinea aerophila DSM 14535 = NBRC 104270]  clstr ali  47  1MSENTKKAQYTADQIQVLEGLEAVRRRPGMYIGGTDQKALHHMVYEVVDNSIDEAMQGRCNRIRIVIHKDESVTVEDNGAGIPVDIQKQTGLPAVTVVMTKLHAGGKFGGGGYKVSGGLHGVGVSAVNALSTWMETKVKRDGKIYRQRYERGVPVT-EVEVIGTCDDDTGTIQTFLRDDTIFQALEYNYHTLATRFREMAFLTRGVDITFIDERTDPPRETNFYFEGGVKSFVRYLNRNREVIN-EPIYIDT----------EVEGTQIEAAIQYTDSFAESVFAFANTINTPDGGTHLTGLRTAVTRIINDYARKQGMIKDKEENFTGEDTRQGMTAIISVKVMEPQFEGQNKLKLLNNEVRYHVETAVAEVMGRWMEENPRDARAIVEKCRTAYRAREAAKKARDLVIRKSALESLTLPGKLADCSSRNPEECELYIVEGDSAGGTAKQGRDRRFQAILPLRGKILNIEKTSLDKALANKEIQALITALGTNIGENFDLSGLRYHRIILMTDADVDGAHIRTLLLTFFYRYMEPLVANGHLYIAQPPLYRVKVKRTSEYVYDDKALEALRKELGEANVKVQRYKGLGEMNEEQLWETTMNPANRTILRVSVEDAAEADRTFDMLMGSSVPPRRRFIQTHANQAR-LDV 649
146 0.000e+00gi|399206102|emb|CCK20005.1| Topoisomerase IV subunit B [Lactococcus raffinolactis 4877]  clstr ali  47  6.......NNYNDDAIQVLEGLDAVRKRPGMYIGSTDGIGLHHLVWEIVDNAVDEALSGFGDQINVTIHKDGSLTISDSGRGMPVGTHA-TGIPTVEVIFTVLHAGGKFGQGGYKTSGGLHGVGSSVVNALSSYLEVEITRDGVVYRQRFENGGKPVTTLEKIGKAPKKTGTKVHFMPDATIFSTTDFKYSTIFDRLNESAFLLPNVTLTLTDERDGQPESASFHYENGVQDFVAYLNEDKDTLTPVMYF-----------AGEAENFQVEVAIQYNDGYSDNILSFVNNVKTKDGGTHEAGLKQAITKSMNEYARKTGLLKEKDKNLEGSDYREGLTAILSVLVPEEQFEGQTKDKLGSPKARPIVDNIVSDKLAFFLMENAELSQNLIRKAIKARDAREAARKARDDARTGKKGKKDKLSGKLTPAQGKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTEKAKMADILKNEEINTMIYTIGAGVGADFDISDINYDKVIIMTDADTDGAHIQTLLLTFFYRYMKPLVENGHVYIALPPLYKMSQGKKIEYAWTDGELNEVRKNFG-KGAILQRYKGLGEMNADQLWETTMNPESRTLIQVTLDDVAQAEKRVSVLMGDKVEPRRKWIENN......... 638
147 0.000e+00gi|302391744|ref|YP_003827564.1| DNA gyrase subunit B [Acetohalobium arabaticum DSM 5501]  clstr ali  50  4....QKELDYNAEQIQVLEGLEAVRKRPGMYIGSTGTKGLHHLVWEAVDNSIDEFLAGHGEEIKVKIKEGSIISVEDQGRGIPVEVHPDKKLPAAQLVLTTLHAGGKFDSSGYKVSGGLHGVGISVVNALSEWLELTIWRNGYTYTQQYEKGVPVT-EFEKSNSTTK-TGTKIEFKPDEDIFDNVKYKFDVLANRLQESAFLNKGLKISLVDTRPGLEKEVTYQYDGGLEAFIDYLNQDRDLLHDDIVYLE----------EEVDDTYVEVAFQYNKSFNERIYSFANNINTHDGGYHLTGFKTALTRAFNNYAKDNNLLKKSDPKLTGRDLREGLTAVVNVKLTEPQFEGQTKAKLGNSEIRSVVEGAVYNYLNQYLPRHHDMAKEVINKALEXXXXXXXXXXXXELTKRKGVLNNNSLPGKLSDCSSRKSEESELYLVEGDSAGGSAKQGRNRDFQAILPLKGKILNVERARLNKIINNNEIAAIITALGTGIGEEFNIDKLRYHKIIIMTDADVDGAHICTLILTLFYRYMPELIREGHVYVAQPPLYKVTYRGDEEYIYTDKQLQKYLADLDRSKVSIQRYKGLGEMNPSQLWETTMNPENRKLQEIMVDEEREADSIFTRLMGSKAKLRREFIMANADLASNLDV 637
148 0.000e+00gi|338706953|ref|YP_004673721.1| DNA topoisomerase subunit B [Treponema paraluiscuniculi Cuniculi A]  clstr ali  48  4........EYSASSITVLEGLEAVRKRPGMYIGSTGPNGLHHLVYEVVDNCIDEAMAGYCDRITVVLEQGNVVRVEDNGRGIPVDVHPHEGVSALEVVLTKLHAGGKFDKKSYKVSGGLHGVGVSVVNALSLWVEVTVYRDGAEYYQKFNVGMP-LAPVEKRGVSEK-RGTIIRWQADPSIFETVAYDFDVLLTRLRELAFLNNTVVIQLRDERLATAKQVEFAFEGGIRHFVSYLNRGKSVVPERPLYIE----------GSKSDVLVEVALQYHDGYTENVQSFVNDINTREGGTHLEGFKSALTRVANDFLKKSKLAKEREEKLVGEDVRAGLTVVLSVKIPEPQFEGQTKTKLGNSEVRGIVDSLVGERLTLYFEQNPGVLTKILEKSIAEAQXXXXXXXXXXXXXXKSGMDSFGLPGKLADCSLKDPAKCEVYIVEGDSAGGSAKKGRDSKTQAILPLWGKMLNVEKTRLDKVLHNEKLQPIIATLGTGVGKDFDLTKIRYHKVIIMADADVDGSHIRTLLLTFFFRYLPQIIEAGYVYLAMPPLYRIAWSKKELYVYSDTERDEALESIGKKGVAVQRYKGLGEMDGTQLWETTMNPVRRKMMQVVLSDAVEADRVFSTLMGEDVEPRRKFIEENAIYAR-LDV 637
149 0.000e+00gi|428224467|ref|YP_007108564.1| DNA gyrase subunit B [Geitlerinema sp. PCC 7407]  clstr ali  50  2......ANEYGADQIQVLEGLEPVRKRPGMYIGSTGPRGLHHLVYEVVDNSVDEALAGYCHQIQVTLNADGSVSVTDDGRGIPTDVHPRTGRSALETVMTVLHAGGKFGGGGYKVSGGLHGVGVSVVNALSEWVEVTVWRDRKVFKHRFERGVP-IGEMSSEPYPEARTGTSLTFMPDVQIFTGIEFDYAILASRLRELAYLNGGVYISFTDSRSNEPKVEVYHYEGGIQEYIAYLNRDKQPIHEEVIYVQ----------GEREGVQLEVSLQWCDAFTDNLLGFANNIRTVDGGTHLEGLKAVLTRTMNSIARKRNRLKENESNLGGEHIREGLTGVISVKVPDPEFEGQTKTKLGNMEVRGIVESFVGEVLTEYLNFRPGVADAILEKAIQAYNAAEAARRARELVRRKSVLESSTLPGKLADCSSRDASESEIFIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIEKTDDAKIYKNTEIQALITALGLGIGEDFDSSQLRYHRIVIMTDADVDGAHIRTLLLTFFYRYQRSLVEQGYIYIACPPLYKVERGRSHYYCYSDRELQGLIQREPNASYTIQRFKGLGEMMPTQLWETTMNPETRTLKQVEIEDAAEADRIFTILMGDRVAPRREFIETYGLNLADLDI 646
150 0.000e+00METAHIT MH0065 GL0018410 [Complete] locus=scaffold1017_2:2026:3954:+  ali  51  2...NKMNEDYGVNDIQVLEGLEAVRKRPGMYIGTTDAKGLHHLVWEIVDNSIDEALAGYCHNIEIIINKDNSITVKDDGRGIPVGIHPKTGISTVETVYTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSKWVIVTVYKDCKIYQTKFEDGGKTVQKLTVIGECENRTGTSVTFKPDSEIFDTDIYDYETLKIRTRELAFLNRGLQLTLRDDRDDEDTQEKFLYEGGISEYVRFINQGKTPIHDNVIHLE----------GEKNGIFFEVALQYNSGYNENIYSFVNNINTHDGGTHEEGVKRALVRVINSYARKANILKDKDENLKEDDVKEGITMIISCKHPNPQFEGQTKGRLGNSEVKAIADAVFAEGFEQFLLENPDSAKIIVNKALLARNARMAAKKAREATR-KTDLTMTNFFGKLSDCKSKDPSISEIFIVEGDSAGGSAKKGRDSMTQAILPLRGKILNVEKARLDRALGNEEIKTIITAFGTGIGEYFDLSKLRYDKIIIMTDADVDGSHIRVLLLTLFYRFFKPIVEAGHVYAAQPPLFRIMHGKTRKYVLSPQELDDYLATLPRQRAEIARMKGLGEMDAEELNETTMDIEKRVLRKITVDDCIAADAIFEKLMGDDVEPRRKFIEENAGYVQNLDI 642
151 0.000e+00gi|379009896|ref|YP_005267708.1| DNA gyrase subunit B [Acetobacterium woodii DSM 1030]  clstr ali  53  3...ENKSDNYTADQIQVLEGLEAVQKRPGMYIGSTGSRGLHHLVYEVVDNSIDEALAGYCKNINVTIHADDSITVVDDGRGIPTGMNHAQGKTGVELALTVLHAGGKFGGGGYKVSGGLHGVGVSVVNALSEKLTVEVKQKGEIFFQTYQKGKPVDKLXXXXXXXXXXX--XIYFKPDKDIFDETEYDFDILEHRLRELAFLNKGVSISLTNEKDSPKRKENYYYTGGIHSYVEYMNRNKDPLYDKITYFEK----------EQDDYALEIAFQYTTGYSENIFSYANNINTPEGGTHLNGFKSALTRTINTYARKNGFLKGNDKNLTGEDAREGLTAIVSIKLLDPQFEGQTKSKLGNTEVKGIVETIVSDQLSALMEENPSIAKSIIEKTLSXXXXXXXXXXXXXFTRRKSALDSTALPGKLADCREKDPALSEIYIVEGDSAGGSAKSGRDSKTQAILPLRGKILNVEKARLDRILTTDSLKSMIIAFGTGVGEEFNVEKARYHKIIIMTDADVDGAHIRTLLLTFFYRYMPGLIEAGYVYIAQPPLYKITRGKQVDYAYTDRDLEKKMEMIDRSRISLQRYKGLGEMDAHQLWETTMDPGVRTLLQVNIEEAAYADEIFTILMGDKVQPRKEFIERNAKKVKNLDI 638
152 0.000e+00gi|282881781|ref|ZP_06290439.1| DNA gyrase, B subunit [Peptoniphilus lacrimalis 315-B]  clstr ali  50  1MAE--KKRHYDAGDIQVLKGLEPVRKRPGMYIGSTGEKGLHHLVYEVVDNSIDEALAGICDHIKIVITKNGSCYVEDNGSGIPVEIHPQTGKSTVETVLTILHAGGKFDNKAYKVSGGLHGVGVSVVNALSTHLKATIKRNGKIYSQEFQRG-KAISSLKEIGKVDKQTGTKIEFTPDPEIFDTVEFSFDILSKRFREMAFLNKGIKIDFTDERIN--KNEIYHYEGGIKSFVEYINSKKEPIHDEIIYIDEI----------RENTSIEVAIQYTKSYSEEVLTFANNINTEEGGSHLSGFRSAITKTVNDYGRKYNFIKEKEENLSGDDIREGMTAVLSVKLPNPQFEGQTKAKLGNSETKGVVDSVVSEKLSMFLEENPKTSKAILEKAVXXXXXXXXXXXXXEISRAKNNLD-MTLPGKLFDCSDVGSEKSEIFLVEGNSAGGSAKDGRDPEFQAVLPLRGKIMNVEKATEAKMLNSSEIKAMITAFGTGYAGEFDISKLRYNKIIIMTDADVDGAHIMTLLLTFFFRYMRPLIENGHVYVAQAPLYGLEKNSKIRYCHNEEELNLALKAHESKNINIKRYKGLGEMNYDQLWETTMNPDNRLLLRVNIEDFDETDDTFQMLMGQEVEPRREFISENAQYADYID. 638
153 0.000e+00gi|260904977|ref|ZP_05913299.1| DNA gyrase subunit B [Brevibacterium linens BL2]  clstr ali  48  1MTTEDLPH-YDAGDITVLEGLEAVRKRPGMYIGSTSERGLHHLVQEIVDNSVDEAMAGYCSHIEVTILADGGVRVVDDGRGMPVAMHPTEGKPTVEVILTILHAGGKFGGGGYAVAGGLHGVGSTVVNALSERLEVEVRRDGYFWNMNFEKGVP-TGELTRGAETS-ETGTMVTFWPDSTIFETTDFSYEYLRARFQQMAFLNKGMKISLTDERDAKPREATYHYEHGLLDYVQYLNSTKKAVHPDVIVFEAEEA--------EETLSLEIAMQWTTSYSESVHTYANVINTHEGGTHEEGFRTALTSLINNYAREQKLLREKDANLTGDDIREGLTAVISVKLGDPQFEGQTKTKLGNSEVKGFVQRVVRDELGHWMESNPAQAKDVVRKGLQASQARLAARKAREATRRKGLLESSGMPGKLKDCQSKDPTISEVFIVEGDSAGGSATQGRNPNTQAILPLRGKILNVEKARLDRALGNNEVQAMITAFGTGIGEEFDLEKLRYHKIVLMADADVDGQHITTLLLTLIFRYMKPLIEHGYVYLATPPLYRIKWSNAHEFAYTEKESDGLLEAGKAAGKRIQRYKGLGEMNYSELWETTMDPDHRLLKQVSLDDGIVADEIFTVLMGDDVDSRRRFIQENAKDVRFLDI 665
154 0.000e+00gi|386714456|ref|YP_006180779.1| DNA topoisomerase IV subunit B [Halobacillus halophilus DSM 2266]  clstr ali  46  18....KQNQTYSDDSIQVLEGLEAVRKRPGMYIGSTDHRGLHHLVHEIVDNAVDEALAGHGDQMTVTLHKDGSVSVEDEARGMPTGMH-QTGKPTPEVILTVLHAGGKFGQGGYKSSGGLHGVGASVVNALSEWLEVYICRDGERYYQRFENGGLPVTSLEHKG-TTRKSGTTIRFKPDPVIFSVTNFSFETLSERLKEAAFLLKGFRINLIDERSEKIK-EVYQYNDGIESFVSYLNEEKDTLHPVVSF-----------EGSYKDIEADFAFQFNDGFAENILSFVNNVRTKDGGTHESGAKTAITRIFNDYARRAQLIKEKDKNLEGNDIREGFTAVISVRIPEEQFEGQTKSKLGTSEARSAVDAVVAEQLSYFLEENPDVASMLIKKAVKAKEAREAARKAREDARKKKKRKDTLLSGKLTPAQSRNPQKNELYLVEGDSAGGSAKQGRDRRFQAVLPLRGKVINTEKAKIADIFKNEEISTIIHTIGAGVGGDFTLEDCNYDKIIIMTDADTDGAHIQVLLLTFFYRYMRQLVEAGKIFIALPPLYKVSKGKQTEYAWDEEGMHKLLKEFKN-GYSIQRYKGLGEMNADQLWETTMNPESRTLIRVTIDDLARAERRVTTLMGDKVEPRRKWIESH......... 647
155 0.000e+00gi|81427621|ref|YP_394618.1| DNA gyrase subunit B [Lactobacillus sakei subsp. sakei 23K]  clstr ali  51  16.AKEERAKSYDASQIQVLEGLEAVRKRPGMYIGTTSSQGLHHLVWEIIDNGIDEALAGFATEINVVVEPDNSITVTDDGRGIPVGIQAKTGKSALETVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSTELDAVVTQGGKRYYIDFKRG-KVQTPMKMIGDAPEEHGTKVHFVPDPDIFETTIYDDKILTTRIRELAFLNKGLKLTFTDKRADTHEKLEFHYEGGIKSYVEFLDEKKETLLDEPIYVE----------GEQNGITVEVALQYTNDYRTNLLTFANNIHTYEGGTHESGFKTALTRVINDYATKQNIFKASDANLSGEDVREGLTAVVSVKHPDPQFEGQTKTKLGNADARSVTDRMFSDHFTKFLMENPSIARQIVDKGSXXXXXXXXXXXXXEVTRKKNGLEISNLPGKLADNSSKDPEISELFIVEGDSAGGSAKSGRSRLTQAILPIRGKILNVEKASMEKILANEEIRTLFTAMGTGFGQEFDVEKARYHKLIIMTDADVDGAHIRTLLLTLFYRYMRPIVEAGYVYIAQPPLYRVKQGKMMRYIDSDEELQDVLGTLPSPKPEVQRYKGLGEMDASQLWETTMDPENRRMLRVNVEDAEEADQIFEMLMGDRVEPRRLFIEENAVY...... 650
156 0.000e+00gi|145592574|ref|YP_001156871.1| DNA gyrase subunit B [Salinispora tropica CNB-440]  clstr ali  49  75....QDKQEYGAESITVLEGLEAVRKRPGMYIGSTGERGLHHLVWEVVDNAVDEALAGHCDTIDVVLLADGGVRVTDNGRGFPVDPHPKLKKPGVEVALTVLHAGGKFDGKAYAVSGGLHGVGVSVVNALSTRMAVEIQKDGYVWRQSYTDSKP--TPLEK-GESTDATGSAVSFWPDPRVFETVAFDFQTIYRRLQEMAFLNRGLTIHFLDERDGKMREVTFCYQGGIADFVRHLNASKTSIHKSVVEFGT----------EEDGMSVEIAMQWNESYGESVYTFANNINTHEGGTHEEGFRSALTSVINRYGAEKRLLK-SDEKLSGEDIREGLAAIISVKLTNPQFEGQTKTKLGNTPVKSFVQRVCNEWLVDWLDRNPAEAKVIITKASXXXXXXXXXXXXXKLARRKSLLESGSMPGKLADCQSTDPRECEVFIVEGDSAGGSAKQGRDPRTQAILPIRGKILNVEKARIDRVLKNNEVQALITALGTGIHDDFDIEKLRYHKIVLMADADVDGQHIQTLLLTLLFRFMRPLVELGHVYLAAPPLYKIKWNRKAQYAYSDRERDGLIALRQQKKPNIQRFKGLGEMNYPELWETTMNPATRTLRQVTLDDAATADELFSVLMGEDVEARRSFIQRNAKDVRFLDI 719
157 0.000e+00gi|227551202|ref|ZP_03981251.1| DNA topoisomerase (ATP-hydrolyzing) [Enterococcus faecium TX1330]  clstr ali  47  14...KKVNNEYNDSSIQVLEGLEAVRKRPGMYIGSTDSRGLHHLVYEIVDNAVDEALSGYGSEIDVTIHEDNSITVADSGRGMPVGMHA-SGIPTVEVIFTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSKWLTVTIVRDGVEYQQKFKNGGKPDGTLKKIGKTKKANGTIVHFLPDDTIFSTTKFSYEILAERLRESAFLLKGVKISLSDLRGEEPVKEVFHYEEGIKEFVDYLNEEKDTLTPVVYF-----------SGEKEGIEVEVAYQYNDGYSENVLSFVNNVRTKDGGTHEAGMKAAMTKSYNEYARKVGLLKERDKNLEGSDFREGLAAVLSIRVPENQFEGQTKEKLGTPVARTVVDNVISEQMGFYLQENSEMSQMLVRKAIXXXXXXXXXXXXXXXSRKKRKKGESLLSGKLTPAQSRNPKKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTEKAKMQDILKNEEINTMIYTIGAGVGPEFSIEDCNYDKVIIMTDADTDGAHIQVLLLTFFYRYMKPLIEAGKVYIALPPLYKVSKGKKIEYAWTDDELAAMIKKVG-KGYMLQRYKGLGEMNAEQLWETTMDPTSRTLIRVRIDDAAQAERRVTTLMGDKVEPRRKWIENH......... 646
158 0.000e+00gi|332654825|ref|ZP_08420567.1| DNA gyrase, B subunit [Ruminococcaceae bacterium D16]  clstr ali  48  1MAENNEEHEYGGSEIQVLEGLEAVRKRPGMYIGSTSESGLHHLVYEIVDNSIDEALAGYCTDITVTINPGNTITVTDNGRGIPVDIQPQTGRPALEVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVQVHKNGEIYEMKFSRG-KITQEMKVVGKTD-HTGTTVTFKPDPEMFDTLEYNYETLHTRMREEAFLNAGLRIQTVDLRPGQEKEDDMCYEGGIREFVTFINRNKTPIHDGVIYMS----------GAREDSMAEIAMQYNDGYQEVMVSFANNVHTPEGGMHEEGFRRALTNTLNAYGRKIGVLK-NDDKVSGDDCREGLTCVISVKLTEAQFEGQTKAKLGNAEIRTLVNSVVSEKLEIFLEENPKVGKLILEKAMMANRAREAARKARESIRRKTALGGAAMPDKLRDCNEANPELTELYIVEGDSAGGSATQGRDSRFQAILPLWGKMLNVEKARADKVYGNDKLTPVITALGAGIGDDFDLNKLRYHKVIIMADADVDGAHIRTLLLTFFFRFMRPLIDNGYVYAAVPPLYKLTKGKTTRVAFSDEERDKISAELPNAKVIINRYKGLGEMDPHELWETTMDPEKRTLKRIELDDAVRADEIFTLLMGEKVEPRREYIQENAKKAVNLD. 649
159 0.000e+00METAHIT MH0025 GL0090607 [Complete] locus=scaffold16804_4:43:1953:-  ali  51  1MS-IKVEETYDQSKIQVLEGLEPVRKRPGMYIGTTDIKGLHHLIIEIVDNSVDEALAGYCTEITVEITRDGACRVSDNGRGIPTGIHPKEGISAVELVLTKLHAGGKFGGGGYKVSGGLHGVGLSVVNALSEWLEVEVRQNGSIYVQTYNRGVP-QRPLAVKGSTDK-TGTTVTFYPDEEIFDTIVFNYDYIRTRLREVAYLNKGLTIHLIDNREGQERKETFHFAGGILDFVDYLNKAKNTILSKTLYFEKQYG---------DNI-VEIAMQYNDGYDETIFAYANNINNEEGGMHLVGFKNALTKIINDYAHSQKILKE-EEKLSGEDVREGLTAVVSVKLPEPQFEGQTKTKLGNADMRGYVEKAMMEGFGSYIEENPKEARELVSKCVTAQRARDAARNARELTRRKGVFESSSLPGKLADCTDKDPSHCEIYLVEGDSAGGTAKGGRDRRFQAILPLRGKILNVEKVRLARVLENEEIKNMITAFGCGVGAEYDESKLRYDKIIIMTDADVDGSHIRILLLTFFFRYMRPLIENGHVYIAQPPLYKVTKGGKDTYCYSDDELNRVCDEMGRKGYDIQRYKGLGEMNTDQLWHTTMSPETRTLLKVKMEDEVGLDEVFTVLMGDMPELRRKFIEDNATLVADLDI 636
160 0.000e+00gi|374602177|ref|ZP_09675171.1| DNA topoisomerase IV subunit B [Paenibacillus dendritiformis C454]  clstr ali  45  17.ASENRNGEYGADDIQVLEGLVAVRKRPGMYIGSTSSSGLHHLVWEIVDNAVDEHLAKFCSQIDVTIHKDQSVTVRDNGRGIPTGMH-KTGVPTPQVVYTVLHAGGKFGGAGYKKSGGLHGVGASVTNALSEWLVVEIYRDGHIHRQRFESGEPVTG-LEIIGNTNK-TGTKVTFKPDAKVFHNIHLSYDNLAERLQEIAFLNSGLKVILKDERTG--KEDTFCYEGGASEFVRFLNEGKSVLNEVVHF-----------AAEKDETEVEVALQYNDGYTETIASFVNSIPTRGGGTHETGFKTAYTRVMNEYARKNNLLKEKDKNLDGNDLREGMMAVINVKMSDVEFVGQTKDQLGSASARSAVDTVVSEHMSIFLEENPQVAQMLVKKALQASKAREAARKAREEVRSKKRSESSNLNGKLTPAQSKDYTRNELFIVEGDSAGGSAKQGRDSRFQAILPLKGKPLNPEKAKLADILKNDEYRTIIHAIGAGVGTEFEAEESNYAKIIIMTDADTDGAHIQVLLLTFFYRYMKPLIDQGKVYIAQPPLYKIKKGKSVRYAWSDEQLSNYMKQLGS-SAEIQRYKGLGEMNPEQLWETTMDPETRTLLQVRIEDAAKAERRVSTLMGDKVEPRKRWIVENVDFAEF... 661
161 0.000e+00gi|23099148|ref|NP_692614.1| DNA topoisomerase IV subunit B [Oceanobacillus iheyensis HTE831]  clstr ali  46  6........QYSDSSIQVLEGLDAVRKRPGMYIGSTDIRGLHHLVYEIVDNAVDEALAGYGKEIQVTIHKDESVSVKDSGRGMPTGMH-QTGKPTTEVIFTVLHAGGKFGQGSYKTSGGLHGVGASVVNALSEWLEVTTFRDGFQYQQRFENGGRPVTTLEKKGPTRKK-GSVIRFKPDPTIFSTIVYNYETISERLRESAFLLKGLKIELIDERHD--KHDVYEYPEGLKSFVDYLNEEKDALHSIVF-----------MEGEQQEIEVEFAFQFNDGFAENMLSFVNHVRTRDGGTHESGARTAITRTVNDYARRQGLLKEKEKNLEGTDIREGLTGVVSVRVPEDQFEGQTKGKLGTTEARSAVDSVISEHLNYFLEENPDISGMLIKKSIKAKEAREAARKAREEARKKRKRKDALLSGKLTPAQSRNPEKNELYLVEGDSAGGSAKQGRDRKFQAVLPLRGKVINTEKAKLQDVFKNEEISTIIHTIGAGVGGDFNLDDVQYDKIIIMTDADTDGAHIQVLLLTFFYRYMRPLVEAGKIFIALPPLFKVSKGKKLRYAWDEQELKVAIQELK-QGYTIQRYKGLGEMNADQLWETTMNPSSRTLIRVSIDDIARAERRVTTLMGDKVEPRRKWIEGHVKF...... 633
162 0.000e+00gi|392968043|ref|ZP_10333459.1| DNA gyrase, B subunit [Fibrisoma limi BUZ 3]  clstr ali  47  22....NANGSYNADNIQVLEGLEAVRKRPAMYIGDVGIKGLHHLIWEVVDNSIDEALAGYCDKITVTINEDNSITVTDNGRGIPTGINTKMGKSALEVVMTVLHAGGKFDKDTYKVSGGLHGVGVSCVNALSTDLRVEVHREGKIFEQEYKTG-HPQYDVRVIGEAE-DTGTIVRFKPDASIFTETVFKYDTVAGRLRELAFLNKGIHIILSDLRELDENQNEFFSEGGLIEFVKYLDESRPALDGEPVYMEN----------EKGATPVQVALVYNYEAGENVMSYVNNINTHEGGTHVQGFRSAITRVLKNYADRNSLGKNGKVTFSGEDFRKGLTAVISVKVAEPQFEGQTKTKLGNQDVVSAVSQTVADLLETWLEENPKTAQGIIKKVLISAQARIAAEQARIMADRKDFMSGMGLPGKLADCSDTDPEKCELYLVEGDSAGGTAKQGRNRAFQAILPLRGKILNVEKALEHKIYENEEIKNIWTALGVRLGDEMNLDRLRYHKIIIMTDADVDGSHIRTLILTLFYRNMKALIDNGYVYIAQPPLYLVKKGKEERYCWSEQQREAAVKELAGEGVNVQRYKGLGEMNAEQLWSTTMDPDRRSLKQVTVESAADADHVFSMLMGDDVAPRRDFIERNAKYAR-VDV 674
163 0.000e+00gi|339480201|ref|ZP_08655860.1| DNA gyrase subunit B [Leuconostoc pseudomesenteroides KCTC 3652]  clstr ali  52  44.....AAGAYNADQIQVLEGLEAVRKRPGMYIGTTTAQGLHHLVWEIVDNGIDEALAGFASHITVTIEKDNSITVTDDGRGIPVDIQTKTGKPALETVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTDLDVRVVRDNTVYYMDFKVGR-VNTPMKQTEKPTIERGTIVHFKPDADIFETTVYNYNTLLTRVRELAFLNKGLRISITDNRPEEAVSESFHFEGGIKEYVSYLNKDKTAIFPEPVYVE----------GEENGIVVEAALQYTTDIKDNLRTFTNNINTYEGGTHETGFKTALTRVINDYARKNGQLKDNAESLTGEDVREGMTAIVSIKHPDPQFEGQTKTKLGNSDARQATDRMFSETFSRFMMENPAVAKQIVEKGVLAQKARLAAKRAREMTRKQSGLEIGNLPGKLADNTSNDPEISELFIVEGDSAGGSAKQGRNRLTQAILPIRGKILNVGKASLDRVLANEEIRSLFTAMGTGFGDDFNVEKANYHKVIIMTDADVDGAHIRTLLLTLFYRYMRPLVDAGYIYIAHPPLYGVALGKSMTYIDSDEELEDYLSQLPSNKPKVQRYKGLGEMDYDQLADTTMDPQNRRLLRVDPTDAEEAEAVIDMLMGGDVPPRRKFIEDNAVFVENLDI 682
164 0.000e+00gi|88854504|ref|ZP_01129171.1| DNA topoisomerase IV subunit B [marine actinobacterium PHSC20C1]  clstr ali  49  21.....AADSYGADQIQILEGLEAVRKRPGMYIGSTGPRGLHHLVYEVVDNSVDEALAGYCDTINVWIRKDGSVRVRDNGRGIPVDLNQQEQKSTVEVVMTMLHAGGKFGGGGYAVSGGLHGVGISVVNALSAEIDTEVRRQGHVWRMSFANGVPV-GPLEQ-GESTTETGTQQTFWPSKETFETVEFDFETLRARFQQMAFLNKGLRITITDERDEEDVVESYMYERGLVDYVEYLNKAKELIHPDVIAFESE--------DTEKRISLEVAMQWTAGYTESVHTYANTINTHEGGTHEEGFRAALTSLVNRYAREKNIIKEKDENLSGDDVREGLTAVISIKLGEPQFEGQTKTKLGNTEAKAFVQRIAGQQLGDWFDRNPTQARDVIRKAIQASQARLAARKAREQTRRKGLLESSGMPGKLRDCSSKDPSLSEIFIVEGDSAGGSAVQGRNPEFQAILPLRGKILNVEKARLDRALGNAEVQAMITAFGAGVGEDFDPEKARYHKIVLMADADVDGQHITTLLLTLLFRYMRPLIDLGYVYLAQPPLYRLKWSNQHEYVYSDTERDALTEAGLSAGKRIQRYKGLGEMDYKELWETTMDPADRTLLQVTLDDAAAADEIFSTLMGEDVESRRNFIQRNAKDVRFLDI 664
165 0.000e+00gi|333394914|ref|ZP_08476733.1| DNA topoisomerase IV subunit B [Lactobacillus coryniformis subsp. coryniformis KCTC 3167]  clstr ali  45  1MKETQTA--YNDASIQVLQGLEAVRKRPGMYIGSTDSKGLHHLVYEIVDNAVDEALAGYGKEIDVTIHKDNSVTVRDFGRGMPTGMHA-SGIPTIEVILTVLHAGGKFGQGGYKTSGGLHGVGSSVVNALSESMTATVVRDGKKFQETFRNGGQPVGTLKKLGKTREATGTTITFKPDATIFTTIDFNYNVLAERIRESAFLLRDVKFVFTDER-GEGRQEVYHYEDGIKEFVDYLNEDKDTLGPTMFF-----------SGEKDGIQVEFAGQYNDGYSENILSFVNNVRTNDGGSHEAGMKTALTRSFNDYARKVNLLKEKDKNLEGSDVREGLSAVISIRIPEEQFEGQTKGKLGTPQARAAVDNVIGEQLAYYLLENGDFAQMMVKKALKAREARQAARKARDESRRKKKTERL-LSGKLTPAQSRNSKRNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTQKAKMDDILKNEEISTMIYTIGAGVGPEFSVEDSNYDKIIIMTDADTDGAHIQILLLTFFYRYMKPLIEAGKVYIALPPLYRLQKGSQIRYAWTDDELAAEMKTFG-KGSSLQRYKGLGEMNADQLWETTMNPESRTLIRVRIDDAALAERRVTTLMGDKVAPRRKWIESH......... 633
166 0.000e+00gi|339448341|ref|ZP_08651897.1| DNA topoisomerase IV subunit B [Lactobacillus fructivorans KCTC 3543]  clstr ali  45  1MTQAKK-QEYDASSIQVLHGLEAVRKRPGMYIGSTDSKGLHHLVYEIVDNAVDEALAGYGDEINVTIHEDDSITVVDHGRGMPTGMHS-SGKPTPEVILTVLHAGGKFGQGGYKTSGGLHGVGSSVVNALSTHLTVQIVRNGQLYQEDFADGGKPVGTLKKLGKTSKHTGTTVTFKPDPDIFTTTTYNYDILAEQLRESAFLLKGVKITLKDERPGKIREDEFQFKDGIKEFVDYLNEGKSTLGKVMYF-----------DGKKDGIEVEVAAQYNDGYTENMLSFVNNVRTKDGGSHEAGFRSAWTKSFNEYARKVGLLKDKDKNLEGNDVREGLTAIVALKVPEEQFEGQTKEKLGTPVARSVVDNVVSEQLLYYLMENSDFANTLIKKATNARTAREAAKKAREESRKKRKKRERLLSGKLTPAQSKDTSENELFLVEGDSAGGSAKQGRDRKHQAILPLRGKVLNTERAKLPDIMKNEEISTIIYTVGAGVGVDFKIDESNYDKIIIMTDADDDGAHIQILLLTFFYKYMRPMIEAGKVYIALPPLYKLQHGKKVEYAWTNEERDQDIKDF-RSGYSLQRFKGLGEMNADQLWETTMDPAKRTLIRVRIDDAADAERQVSTLMGNKVEPRRKWIESN......... 635
167 0.000e+00gi|348175287|ref|ZP_08882181.1| DNA gyrase subunit B [Saccharopolyspora spinosa NRRL 18395]  clstr ali  49  1MA--PKKSEYNASSITVLEGLEAVRKRPGMYIGSTGERGLHHLVQEVVDNSVDEAMAGYASRVEVTLLADGGVRVVDDGRGIPVGIHPVEKKPTLEVVLTVLHAGGKFDSDSYAVSGGLHGVGVSVVNALSTALEAEIHLDGYVWRQRYED-SKPVADVER-GERTDKTGTTITFWADPTIFETTRYNAETISRRLQEMAFLNKGLTIVLRDERAAEETERTFHYPGGLEDFVRHINATKEPIHKKVVSFNASSK----------DYELEIAMQWNSGYNQSVYTFANTINTHEGGTHEEGFRSALTRVVNSYAKDKKLLKEKDGSLTGDDVREGLAAIVSVKVREPQFEGQTKTKLGNTEVKSFVQTTAFEWLTDWFERNPAEAKVIVNKAVSSAQARMAARKAKELVRRKSAMDIGGLPGKLKDCQSNNPEECELYVVEGDSAGGSAKEGRESRFQAILPLRGKIINVEKSRIDKVLKNNEVQAIITALGTGIHDEFDLSKLRYHKIVLMADADVDGQHIRTLLLTLLFRFMRPLIENGHVFLAQPPLYKIKWPRSEEYAYSDKERDALLAQGAAKDDGIQRYKGLGEMNADELWDTTMNPETRLLLQVSLDDAATADELFSVLMGEDVEARRSFITRNAKDVRFLDV 657
168 0.000e+00gi|229829522|ref|ZP_04455591.1| hypothetical protein GCWU000342_01614 [Shuttleworthia satelles DSM 14600]  clstr ali  51  1MEEEMAQQEYGADQIQILEGLEAVRKRPGMYIGSTSAQGLHHLVYEIVDNSVDEALAGYCHHIRVTINRGNSVTVVDDGRGIPTGINHKAGIPAVEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSLWLEVEIRRDGKIWRQRYERG-KTMGSLKVVGSCDSETGTKVTFLPDDRIFETTEFDYGVLRRRLRETAFLTKGLRISLRDEREEEVREDSFYYEGGIKEFVSYLNRGDKPLYRDVIYCE----------GTSNGVYVEVAMQHNDAYKEACYSFVNNIITPEGGTQVTGFKAAVTNVFNSYAHENKLIKDTE-KLDSDDIREGLTSVISIKIEDPQFEGQTKQKLGNSEARGAVQAVVTEQLTYFLEQNPQAARLIVEKSQLAQRAREAARKARDLTRRKSPLDGAALPGKLADCSSKDPAECEIFIVEGDSAGGSAKEARNRRTQAILPLRGKILNVEKAREDRIYGNAEIKAMITAFGTGIHDEFDIEKLRYHKIIIMTDADVDGAHIATLMLTFLYRFMPELIRQGNVYLATPPLYKIEKNRKEWYAYSDEEQNNILNRIGRDNIKIQRYKGLGEMDAQQLWETTMDPDTRILKRVQVDDEAEINLTFSTLMGEEVEPRREFIEENAKYAT-LDI 641
169 0.000e+00METAHIT MH0060 GL0022640 [Complete] locus=scaffold12088_1:2917:4833:-  ali  51  2.....NENTYNDSDIQVLEGLEAVRKRPGMYIGTASVKGLHHLVWEIVDNAVDESLAGYCDDIEVIVDKGNVIEVRDDGRGIPTGTNSKTGLSTIETIFTVLHAGGKFGGHGYKVSGGLHGVGASVVNALSEWLEVRVYHEGNVYFQRFENGGHSTGPLKIIDTCSKRTGTTVRFKADPEIFETTIYDYNTLKTRLRELAFLNKGLRIILSDLRDIEHKEE-FLYTGGIIEYVKMLNENKTSLNSQIIYVS----------GQEDNISIEVALQYNETYNSAVYSFTNNINTYEGGTHEDGVKRALTRIINNYAKKNKYLKDNDDPLSGEDVREGLTMIISCKHPDPQFEGQTKTKLGNAEVRKIADDVFSEGFERYLLENPDEAKLIMDKCMTXXXXXXXXXXXXELTRRKSDLDVVNFGGKLVDCKEKDPTVCEIFLVEGDSAGGSAIKGRNSMTQAILPLRGKILNVEKARLDRALGNEEIRTIITAFGTGIGQEFDLNKLRYHKIIIMTDADVDGSHIRVLLLTLFYRFFRPIVEAGHVYAAQPPLFCIKHGKTIKYVLNEDEKAEYLASLATTKPDVMRMKGLGEMDAEELNETTMDINTRVLRKITVDDLMQADEIFTRLMGEEVEPRRKFIEDNATFVENLDI 638
170 0.000e+00gi|291297544|ref|YP_003508822.1| DNA gyrase subunit B [Stackebrandtia nassauensis DSM 44728]  clstr ali  49  3.AAEKKQDDYNAGSLTVLEGLEAVRKRPGMYIGSTGERGLHHLIWEVVDNAVDEAMAGHCDTIDVTILADNGVRVIDNGRGFPVDLHPKLKKPGVEVALTVLHAGGKFDSKSYAVSGGLHGVGISVVNALSTRIEMEIQRDGFVWTQSYKHSVP--GPLEQ-GEKSRKTGTSVSFWPDDTIFETTVYNFETIYRRLQEYAFLNKNLKIVLRDERDTKPREVVFQYAEGIADFVRHLNATKSPLHKSVVMFEAKS--------EEDGSSLEVAMQWNESYGESVYTFANAINTHEGGTHEEGFRAALTTCVNKYGTDRKLLKGTD-RLSGDDIREGLAAIVSVKLVEPQFEGQTKTKLGNTEVKSFVQRVCNEWLVDWFDRNPSEAKTIITXXXXXXXXXXXXXXXXXLARRKSLLETSSMPGKLADCQSTDPSESEMFVVEGDSAGGSAKQGRDPRTQAILPIRGKILNVEKARIDKILKNNEVQAMITALGTGIHDDFDIEKLRYHKIILMSDADVDGQHINTLLLTLLFRMMRPLVEMGHVYMSQPPLYKIKWNRKVEYAFSDRERDGLIEMGMSQGKGIQRYKGLGEMNYTELWETTMNPATRALLQVTLDDAATADELFSVLMGEDVETRRNFIQRNAKDVRFLDI 656
171 0.000e+00gi|56963754|ref|YP_175485.1| DNA topoisomerase IV subunit B [Bacillus clausii KSM-K16]  clstr ali  45  1MAKQHV--EYNEDAIQVLEGLEAVRKRPGMYIGSTDVRGLHHLVYEIVDNAVDEALGGYGNTIKVTIHKDQSVSIEDEGRGMPVGMH-RSGKPTPEVIFTVLHAGGKFGQGGYATSGGLHGVGASVVNALSEWLEVEIKRDGYRYTQRFEQGGKPVTTLEKKGKT-RASGTTVRFKPDEGIFSTIQFNSEILAERLREAAFLLKGVQIELTDKRPEKELHEVFKFDTGLEAFVDYLNEGKEALHPVVSF-----------SGSANDIQMDFSFQFHDAYTENVLSFVNNVRTRDGGTHELGAKTAMTRIMNEHARKIGVLKEKDKNLDGSDIREGFTAVVSVRVPEAQFEGQTKSKLGTPEARSAVDAIVSENLSYFLEENPAVATMLLKKAMKAAQAREAARKAREDARKKNKRKDVLLSGKLTPAQSRNPARNELYLVEGDSAGGSAKQGRDRKFQAVLPLRGKVINTEKAKLDDIMKNEEIRTIIHTIGAGVGADFDSADCNYDKVVIMTDADTDGAHIQVLLLTFFYRYMKPLIDEGKIYIALPPLYKVSKGKKEQYAWDENELQAALKKVGR-GSTVQRYKGLGEMNATQLWETTMDPATRTLIRVRLEDAARAEKHVATLMGDKVEPRRKWIESH......... 633
172 0.000e+00METAHIT MH0061 GL0005631 [Complete] locus=scaffold2062_2:513:2453:+  ali  46  1MSELEKDTEYDASEIQVLEGLEAVRKRPGMYIGSTSSSGLHHLVYEIVDNAIDEALAGYCTDITVTINPGDTITVTDNGRGIPVDIQPQTGRPALEVVYTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEWMEVQVYKNGHIYEMKFSRGD-ITQEMKIIGDTDR-TGTTVTFKPDPEIFDTLVYDYDILHTRMREQAFLNAGLRITITDARPGSEQGETMCYEGGIREYVTYLNRNKTPLHQEVIYLS----------GAKGDSTAEIALQYNDGYNETLVSFANDIHTPGGGMHETGFKAALTRVLNAYGTKYGMLKDGDDKVSGEDCREGIAAVISVKLTEAQFEGQTKDKLGNAYIRTLVDGIVSDQLAVYMEEHPAVARTILDKALTANRAREAARKARESIRRKTALGGAAMPDKLRDCNENNPELTELYIVEGDSAGGSATQGRDSRFQAILPLWGKMLNVEKARADKVYGNDKLQPVITALGAGIGDEFDADKLRYHKIIIMADADVDGAHIRTLLLTFFFRFMRPLIENGYVYSAVPPLYKLSRGKQTRVAYSDEERDALRGDNPDAKVDISRFKGLGEMNPHELWETTMDPEKRTLRRITLDDAVAADATFTVLMGEKVEPRKEFIEQKAKYAVNLD. 645
173 0.000e+00gi|300088450|ref|YP_003758972.1| DNA gyrase subunit B [Dehalogenimonas lykanthroporepellens BL-DC-9]  clstr ali  47  7.TDNPGASSYTAEDIQVLGGREAVRKRPGMYIGSTDYRGLHHLVYEVVYNSVDESMAGFCDKINVIIHGDESISVEDNGRGIPVDIQKKTGVSALETVMTVLHAGAKFGGKTYQVSGGLHGVGASVVNALSEWVTVDVRRDGKLYRQQYKEGIP-EAPVAVVGEACGTG-TTTTFKFDSKIFDDATYDFKTLAERMREIAYLNKGLEISITDRRTD--KEQTYYFEGGITGFVRHLNHNRNTIHRLPI----------AIYRKVDDCMVEVALQYNDGFSETNFSFANCINTQDGGTHLTGFRSALTRVINDYVYKNKLVKDSDPSIMGDDCREGMVSIVSVKLPEPQFEGQTKGKLGNAEMKSMVESVVVDQLALYFEEHPDEAKKIIDKVLTSXXXXXXXXXXXXLIIKKNSLDGGSLPGKLAECSEKEPSLCELFLVEGDSAGGSAKQGRNRRFQAILPLRGKILNVEKAAPDKMLSHEEIRAIITALGAGIDDDFDFGKLRYHRVVMMTDADVDGSHIRTLLLTFFFRHMSKLITNGGLYIAQPPLYRVKQGQNERWVFSDAEKDEALKEFKGKSVDVQRYKGLGEMSAEQLWSTTMNPATRTMLTVEIEDAAHADATFNLLMGDQVPPRKAFIQAHAQQVKNLDI 641
174 0.000e+00gi|328957567|ref|YP_004374953.1| DNA topoisomerase 4 subunit B [Carnobacterium sp. 17-4]  clstr ali  47  10MPKE-LNKEYNDDSIQVLEGLEAVRKRPGMYIGSTDARGLHHLVYEIVDNSVDEALSGFGTEIDVTLHKDNSISVKDNGRGMPIGMHS-SGIPTVQVIFTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSEWLTVTIIREGVHYQQKFVEGGKAKGSLKKIKTNNEKNGTIVHFKPDPTIFTTTNLSYDVLAERLRESAFLLKGLRITLTDERNE--QSEVFYYEEGIKEFVSYLNEDKDNLTPVAYF-----------EGENNEIEVEFSFQYNDGYSETILSFVNNVRTKDGGTHEAGMKTAITKTFNEYARKVNLLKEKEKNLEGTDFREGLAAVISIRIPENQFEGQTKSKLGTPQARSAVETVVSDQLNFYLIENGDLSQQLIRKALKAREARDAARKAREESRKKRKKNDTLLSGKLTPAQSKNAKRNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTEKAKLQDVMKNEEISTMIYTIGAGVGPEFDIADCNYDKIIIMTDADTDGAHIQTLLLTFFYRYMKPLFEAGKVYLALPPLYKLSRGKKEKYAWTDDELVQVTKDFG-KNYILQRYKGLGEMNADQLWDTTMNPETRTLIRVKIDDAAQAEKRVSVLMGDKVEPRRKWIESH......... 642
175 0.000e+00gi|332299200|ref|YP_004441122.1| DNA gyrase subunit B [Treponema brennaborense DSM 12168]  clstr ali  49  2......NASYSASNITVLKGLEAVRKRPGMYIGSTGPDGLHHLVYEVVDNCIDEAMAGFCDTIVVVLEKDDIVRVEDNGRGIPVDIHPTEGISALELVLTRLHAGGKFDKGSYKVSGGLHGVGVSCVNALSSWLEAYVEKDGKKYYMKFNTGA-AESPVKETGTTDRRG-TTIRWKADSTIFETTTYNFDVLCTRLRELAFLNSGIKIVFRDERLTNPKEVVFQFEGGIRHFVSYLNEGKKVIPEEPVYIS----------GERDDIQVELCIQYNDGYNENMLSFVNDINTREGGTHLEGLKSALTLVMNEFLKNNKLLKKKEEKLTGEDVRAGLTSVISVKVPEPQFEGQTKTKLGNTEVRGIVASLSNEQLTLFFEQNPRLIEQILEKAVSEAAARIAARKAKEATRRKNSMDSFGLPGKLADCSSKDPTECEVYIVEGDSAGGSAKQGRDPKIQAILPLWGKMLNVEKTRIDKVINNDKLQPVIASLGAGIGKDFNVEKLRYHKIIIMADADVDGSHISTLLLTFFFRYMPQLIEHGYVYIAMPPLYKIKLGKKEHFVFSDAERDEILQTLGDDKVDIQRYKGLGEMEWKELKETTMDPANRKMKRVELTDAVAADHIFTTLMGEEVEPRRKFIEDNAVYAT-LDV 638
176 0.000e+00gi|379731364|ref|YP_005323560.1| DNA gyrase subunit B [Saprospira grandis str. Lewin]  clstr ali  48  1MEENKQNADYGADNIQALEGLEAVRMRPGMYIGSTDSKGLHHLVWEVLDNSIDEHLAGYCDEVTITVHPNNSVSVFDNGRGIPVGMHQKLKKSALEVVMTVLHAGGKFDKKTYQVSGGLHGVGVSCVNALSSFLKAEVHREGQVYVQEYSCGIP-QTEVAVIGQTER-TGTKVTFLPDASIFSATNYIYENLAKRLRELAYLNKGLRLIIIDERDGSFKREEFFSEGGLKEFVQEMNNNRDILLPEPIHV----------MGEEEGVFVEVAFQYNNSYRENLRSFVNNINTIEGGTHVSGFRRAVGHELKKYGERTGLFAKAKATISSEDFREGLTAVVAVKVPNPQFKGQTKGELGNQEVNSIVSGAVRKAFAIYLEENPSIAKLIIDKVILXXXXXXXXXXXXEMVQRKNVLTGSGLPGKLADCSSRDASLSEIFLVEGDSAGGTAKQGRSREFQAILPLRGKILNVEKAMEHKIYENEEIKNIFTALGVRIGDRYDTEKLRYHKIVIMCDADVDGSHIVTLILTFFFRYMRPLVENGYVYIAAPPLYLVKKGKKQVYCWDEAQRQMAVAELGGQGVGVQRYKGLGEMNAEQLWETTMNPETRTLRQVQIEDAEMADETFSMLMGDAVPPRRKFIEENAKYA-NVD. 657
177 0.000e+00gi|427418615|ref|ZP_18908798.1| DNA gyrase subunit B [Leptolyngbya sp. PCC 7375]  clstr ali  48  2......TTDYGADQIQVLEGLEPVRKRPGMYIGSTGPRGLHHLVYEVVDNSVDEALAGYCKTITIDLNADGSVTVTDDGRGIPTDVHARTGKSALETVMTVLHAGGKFGGGGYKVSGGLHGVGVSVVNALSEWVEVTVWRNKKEHLQRYERGE-AQGELSVKSGADSQTGTSVSFKPDQLIFETVEFDYSTLAGRLRELAYLNAGVDITFTDHRADEPKINRYFYEGGIREYVEYINKEKQPIHPDIIYV----------TGEKNGVQVEAALQWSDAYSDNLMGFANNIRTVDGGTHLEGLKAVLTRTMNNFARKRNKRKDNEPNLAGENIREGLTAVISVKVPEPEFEGQTKTKLGNTEVRGIVDSLIGETLSEYLDFNPNVVDSILEKAIQSFNAAEAARRARDLVRRKSVLESSTLPGKLADCSSRDPAESEIFIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIEKTDDSKIYKNNEVQSLITALGLGIGEEFDSSQLRYHRICLMTDADVDGAHIRTLLLTFFYRYQRALIDQGFVYIACPPLYKLERGRSHTYCYSEQELQRGISALANAKYNVQRFKGLGEMMPTQLWDTTMNPESRTLKKVEIEDAAEAERIFTVLMGDRVAPRREFIETYGLNMADLDI 645
178 0.000e+00Oral.Meta HOMD aot848_c_2_2994 Actinomyces sp oral taxon 848 F0332 [293142 - 290974] DNA gyrase, B subunit  ali  47  53.....KGQAYDASSITVLEGLEAVRKRPGMYIGSTGERGLHHCVYEVVDNSVDEALAGICDHIEVTILADGGLRVRDNGRGIPVNEHPTEHKPAVEVVMTILHAGGKFGNGGYAVSGGLHGVGVSVVNALSTRMETEVRRDGYVWRISFENGVP-TGPLER-GEQTDEHGTTQTFWANPDIFETTHYDFETLRRRFQQMAFLNKDLRITLTDERTPGYRSVSYMYSGGLLDYVKHLNTTKEVVHPDVVYFEAEDRERQIQCEVA--MQCEVAMQWTSAYSETLNTFANTINTTEGGTHEEGFRSALTSVINKYARDKGLLKDKDPNLSGDDIREGLTAIISVKLGNPQFEGQTKTKLGNTEARTFVQQQVYSHLTDWLDMHPNEAKDIIRKXXXXXXXXXXXXXXXXXXXXKSVLESASMPGKLKDCTSRNPEECEIFIVEGDSAGGSAVNGRDPEHQAIMPIRGKILNVEKARLDRALSSDTIQGLITAFGTGIGDEFDMAKLRYHKIVFMADADVDGSHIATLLLTLVYRYMRPLIEGGHVYLAMPPLYRIKWTNAVHYVFSDRERDEKLVEGKDKGFRIQRYKGLGEMNAEELWDTTMNPEARTLKQVSIDDAAATDETFSILMGEDVESRRGFIQRNAHDVRFLDI 723
179 0.000e+00gi|116326860|ref|YP_796580.1| DNA gyrase subunit B [Leptospira borgpetersenii serovar Hardjo-bovis str. L550]  clstr ali  49  1MS--QKETSYSAGQIKILEGLEAVRKRPGMYIGTQDETGLHKMVYEVVDNSVDEAMAGHCTEIRISILPNNIIEVKDNGRGIPVDIHPDKKISTIEVVMTILHAGGKFENDAYKVSGGLHGVGVSVVNALSEYLEVEVHQKGKIYTQKYEKGIPV-SPVEIKGDSS-ERGTIVRFKPDATIFTTVDFQFDILSARFRELAFLNKGLVLIVEDRRRGAEGENEFQFSGGIVSFVEHINENKHPMHK-VIHFERN----------KDDVLAEISIQYSETYTENIFCFTNNINNNLGGTHLEGFRAALTRTLNDFLKKTTLSKKHPTGLSGEDVKEGLTAVISIKIPQPQFNSQTKEKLVNAEIKGIMQTLSSEGLTLFFEENPNITKKILEKCILSAKAREAARKARDLTRRKTVLEGGGLPGKLADCSEKDPAFSELYLVEGDSAGGSAKQGRDRNTQAILPLKGKILNVEKARLDKILSSEEIRILVSALGTGIGEDFNINKIRYHKIMIMTDADIDGSHIRTLLLTFFFRYMRPVIERGYLYVAQPPLYLIKHGKNSTYAYSDKEKEELLKNVGTEKVVIQRYKGLGEMNPEQLWETTMDPSNRVVLKVKLDDFVEAEETFNILMGDEVQPRKQFIEINAAKVANLD. 640
180 0.000e+00gi|352517734|ref|YP_004887051.1| topoisomerase IV subunit B [Tetragenococcus halophilus NBRC 12172]  clstr ali  47  1MTLAKKTNEYNDASIQVLEGLEAVRKRPGMYIGSTDQRGLHHLVYEIVDNAVDEALSGYGNTIDVTICEDNSVQVTDYGRGMPVGMHS-SGIPTVEVIFTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSSWLEVTIVRDGIQYKEVFKNGGKPEGTLEKIGKTKEANRTTVHFLPDPTIFSGAKISYDMLAERLRESAFLLMGVEINLTDLRGEEKVEESFLYEEGIKEFVDYLNEEKDTLTPVAYF-----------SGEKDGIEVEFAFQYNDGYSENILSFVNNVRTKDGGTHEAGMKASLTKSFNEYARKVGLLKDKDKNLEGSDFREGLAAILSVRIPESQFEGQTKEKLGTPAARTAVDNVIGEQLIFYLQENSDMSQMLVRKASKARLAREAARKAREESRKKRKKGESLLSGKLTPAQSKNPEKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTEKANMQDILKNEEINTMIYTIGAGVGPEFSLEDCNYDKIIIMTDADTDGAHIQVLLLTFFYRYMKPLVEQGRVYIALPPFYKVTKGQEDKYAWTDEELEVITKGMG-KGYTLQRYKGLGEMNAEQLWETTMDPEHRTLVRVRIDDAAQAERRVTTLMGDKVAPRRKWIESN......... 637
181 0.000e+00gi|339301389|ref|ZP_08650492.1| DNA topoisomerase (ATP-hydrolyzing) ParE [Streptococcus agalactiae ATCC 13813]  clstr ali  47  13.......TNYGDDAIQVLEGLDAVRKRPGMYIGSTDGTGLHHLVWEIVDNAVDEALSGFGNRIDVIINKDGSITVTDHGRGMPTGMHA-MGKPTVEVIFTVLHAGGKFGQGGYKTSGGLHGVGSSVVNALSSWLEVEIIRDGAIYRQRFENGGKPVTTLKKIGTAPKKSGTSVSFMPDQSVFSTIDFKFNTIAERLKESAFLLKNVTLTLTDNRSEEAEHLEFHYENGVQDFVEYLNEDKETLTPIMFF-----------EGEEQEFHIEVALQYNDGFSDNILSFVNNVRTKDGGTHETGLKSAITKSMNDYARKTGLLKEKDKNLEGSDYREGLSAILSILVPEEQFEGQTKDKLGSPLARPIVDGIVSEKLTYFLMENGDLASNLIRKAIKARDAREAARKARDESRKKSKKDKGLLSGKLTPAQSKNAKKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVLNTAKAKMADIIKNEEINTMIHTIGAGVGPDFNLDDINYDKVIIMTDADTDGAHIQTLLLTFFYRYMRPLVEEGHVYIALPPLYKMSKGKIVEYAWTDIELEELRQKFG-KGSLLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVPPRRQWIEDNVKF...... 645
182 0.000e+00gi|289770511|ref|ZP_06529889.1| DNA gyrase, B subunit [Streptomyces lividans TK24]  clstr ali  49  33.SHGDASASYDASAITVLEGLDAVRKRPGMYIGSTGERGLHHLVQEVVDNSVDEALAGHADTIDVTILPDGGVRVVDNGRGIPVGIVPSEGKPAVEVVLTVLHAGGKFGGGGYAVSGGLHGVGVSVVNALSTRVAVEVKTDGYRWTQEYKLGVPTASLARH--EATEETGTTVTFWADGDIFETTDYSFETLSRRFQEMAFLNKGLKINLTDERESEVKSVSYHYEGGIVDFVTYLNSRKELVHPTVIDLEAEDKDKSL--------SLEVAMQWNGGYTEGVYSFANIIHTHEGGTHEEGFRAALTSLINKYARDKKLLREKDDNLTGDDIREGLTAIISVKLAEPQFEGQTKTKLGNTEVKTFVQKVVYEHLTDWLDRNPNEAADIIRKGIQAAHARVAARKARDLTRRKGLLESASLPGKLSDCQSNDPTKCEIFIVEGDSAGGSAKSGRNPQYQAILPIRGKILNVEKARIDRILQNQEIQAMISAFGTGVHEDFDIEKLRYHKIILMADADVDGQHINTLLLTFLFRFMRPLVESGHVYLSRPPLYKIKWGRDDEYAYSDRERDALIEMGRQAGKRIQRFKGLGEMNAEELRITTMDQEHRVLGQVTLDDAAQADDLFSVLMGEDVEARRAFIQRNAKDVRFLDI 694
183 0.000e+00gi|374724157|gb|EHR76237.1| DNA gyrase subunit B [uncultured marine group II euryarchaeote]  clstr ali  47  2......SDDYGASSIQVLEGLEAVRKRPGMYLGDPDGTALHHCIWEVVDNSVDEHLAGHTAQIDIVLNPDHSVSVRDYGRGIPVGIHEEYGISAAEVIMTKLHAGGKFDNSSYKVSGGLHGVGVSAVNAVSEWMDVTIHRNGTIYFQRYEAGVPV-APLAEIGTCD-DTGTTISFKPDLTIFEVTEFEFEQINTRVRETAFLNAGLMIVIADDRNEEGHKVEHHYEGGLSEFVSQLNERREIMHENVITITGSKDI------EKGPVEVELALQWSDAFSESIMCYTNIIRNKDGGTHMSGLRTALTSCVNGYAKKRNLLKG--EGLSGEDVREGLAAVVSVKHPDPSFSSQTKDKLVSSEVTGIVQTIVYEKLGEFFEENPNVAKQIVDKALLASKAREAARKARDLTRRKGVLEGGGLPGKLADCQSRDPSECEVYLVEGDSAGGSAKTGQDFRIQAILPLRGKILNVEKHNIAKVFQNNEIQTMIRAFGAGVGNNFNPEKLRYSKIILMTDADIDGAHIRTLMLTFLWRFMRRAITEGHVYIAQPPLYQLSKGRVNKYAFTDEERDAIVDELPNAKIGVQRYKGLGEMNPEQLWSTTMDPETRTMLKVTVKDAEETDRMFEILMGEDVPDRRAFIERHAKEVTNLDI 649
184 0.000e+00gi|148821196|ref|YP_001285950.1| DNA gyrase subunit B [Mycobacterium tuberculosis F11]  clstr ali  49  44..KKKAQDEYGAASITILEGLEAVRKRPGMYIGSTGERGLHHLIWEVVDNAVDEAMAGYATTVNVVLLEDGGVEVADDGRGIPVATHA-SGILTVDVVMTQLHAGGKFDSDAYAISGGLHGVGVSVVNALSTRLEVEIKRDGYEWSQVYEKSEPL--GLKQ-GAPTKKTGSTVRFWADPAVFETTEYDFETVARRLQEMAFLNKGLTINLTDERPHKVKSRTFHYPGGLVDFVKHINRTKNAIHSSIVDFSGKGTGH----------EVEIAMQWNAGYSESVHTFANTINTHEGGTHEEGFRSALTSVVNKYAKDRKLLKDKDPNLTGDDIREGLAAVISVKVSEPQFEGQTKTKLGNTEVKSFVQKVCNEQLTHWFEANPTDAKVVVNKAVSSAQARIAARKARELVRRKSATDIGGLPGKLADCRSTDPRKSELYVVEGDSAGGSAKSGRDSMFQAILPLRGKIINVEKARIDRVLKNTEVQAIITALGTGIHDEFDIGKLRYHKIVLMADADVDGQHISTLLLTLLFRFMRPLIENGHVFLAQPPLYKLKWQRSDEFAYSDRERDGLLEAGAGKKINIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGEDVDARRSFITRNAKDVRFLDV 714
185 0.000e+00gi|343491935|ref|ZP_08730314.1| DNA gyrase subunit B [Mycoplasma columbinum SF7]  clstr ali  54  1MADKR---DYGASNLRVLEGLDPVRVRPGMYIGSTGIKGLHHLVWEIVDNSVDECMAGFANEIKITLTKDGYVQVEDNGRGIPTDMHPETGMSGVETALTKLHAGGKFDSNTYKVSGGLHGVGASVVNALSDDLEAWVKRDGKLHYAHFQNGGQIIQPLTILDEVDKETGTTIKFHPDFTVMDKNNFDKDVIVDHAKQIAYLNKGLKISVKDERDNTYNE--FVFEGGIVDYVKELNTGQTLITEQIIYAEGEYS-----HGEDAPVQVEVALQYNSKITGNIVSYANNILTTEGGTHENGFYDALTRLLNSYGLDSGIIKKDEEKVSREDVKEGLVAIISIKHTDPIFEGQTKTKLGNKDARIAVNKVFSENLERFLNENPNEAKLIVQKTLAAKKSRIAAETARDAARRKTVFESGSLPGKLADCTSKNAEISELYIVEGNSAGGSAKMGRDRTTQAILPLRGKVINVEKNQASKVFNNEEINSLIAALGTGVLDNFNINKLRYHKIIIMTDADVDGAHIRTLLLTFFYRYFRKLIEYGFIYIAQPPLYKIQQNKNVEYAYNDEQKDEIMSKLPNSKINIQRYKGLGEMDPEQLWETTMNPETRLMLQVQIEDAARADQMFTILMGDDVAPRREFIEQNAKYVKNID. 641
186 0.000e+00METAHIT MH0059 GL0003537 [Complete] locus=scaffold16682_4:2926:4935:+  ali  45  8...KKAEEQYSASSIQVLEGLEAVRKRPSMYIGDIGERGLHHLVYEVVDNGIDEAMAGYCTEIGVTILPDNSIRVSDNGRGIPTGMHPKEHRSALEVVMTVLHAGGKFNKDSYKVSGGLHGVGVSCVNALSDSLIAEVHREGHIFVQKYSKG-KPLAPVEIVGDCN-DTGTIITFHPDPTIFTTIVYKYDTLAARMRELAYLNKGIKITITDEREDEYVTDEFYSKEGLKEFIDYLDAGATQLIPEPVCVQSDKV-----------IPIDIALSYNNGFSEKIYSYVNNINTIEGGTHLQGFKMGLSRSLKNYAEKNNLLAKFKGDLAPEDFREGLTAVVSVKIAEPQFEGQTKTKLGNPEATSAVSQATSAAMDQYLEEHPKEGKLLIEKIVLAATARSAARKAREMVQRKTAMTGAGMPGKLADCSERNPEICELFLVEGDSAGGTAKQGRDRRIQAILPLRGKILNVEKAAGDRAFDSVEVRNIYTALGVTVAQEMDLSKLRYHKVIIMTDADVDGSHIACLILTFFFRYMFDLIKNGYVYLATPPLYLVKKGKEEVYCWTDEQRFEATARLGKKGVTVQRYKGLGEMSDQQLWDTTMDPAKRRLRKITIDNAAEAERTFSMLMGDDVPPRRQFIEENAHYA-NID. 668
187 0.000e+00gi|269954816|ref|YP_003324605.1| DNA gyrase subunit B [Xylanimonas cellulosilytica DSM 15894]  clstr ali  48  1MA-NRNDGGYDAGNITVLEGLEAVRKRPGMYIGSTGERGLHHLVTEVVDNSVDEALAGYADTIDVTLLADGGVRVVDNGRGIPVAIHPTEGKPTVEVVMTILHAGGKFGGGGYAVSGGLHGVGISVVNALSRRVVSEIARDGYHWRMEFADGGHPVGELQRLEPTE-ETGTTQTFWADPEIFETTEFDFETLRARFQQMAFLNKGLTITLTDERAGPARTVTYRYDGGLTDYVKHLNSSKRVIHPEVIDFESE--------DTERKISLEIAMQWTSAYSESVHTYANTISTTEGGTHEEGFRAAMTNLVNSYAREKGILKEKEDNLTGDDIREGLTAVISIKLGEPQFEGQTKTKLGNTEAKTFVQRVVREQLTDWFDSHPNEAKDVIRKAISASQARIAARKAREATRRKGLLSSGGMPGKLKDCQSNRPEECEIYIVEGDSAGGSAVRGRNPHNQAILPIRGKILNVERARLDKALSNLEVQSLITAFGTGIGEDFDASKLRYHKVILMADADVDGQHIATLLLTLLFRYMRPLIEQGHVYLAMPPLYRLKWSNAPHYVYSDKERDAFIREGLANGKRIQRYKGLGEMDYQELWETTMDPDHRTLRQVTMDDAAAADEIFSMLMGEDVESRRSFIQRNAKDVRFLDI 681
188 0.000e+00gi|271961616|ref|YP_003335812.1| DNA topoisomerase [Streptosporangium roseum DSM 43021]  clstr ali  50  2........SYDASSITVLEGLEAVRKRPGMYIGSTGERGLHHLVYEVVDNSVDEALAGHADRIEVTLLADNGVRVVDNGRGIPVGIVEAEGRPAVEVVLTVLHAGGKFDSKSYAVSGGLHGVGVSVVNALSSKLEVEIRTDGHHWQQSYA----ETRPLHVKGEATEETGTSITFWADSTIFETTTWNFETLSRRFQEMAFLNKGLTISLRDERNGEPKEATYHYEGGLSDFVKHLNSKKEPAHVSVIDFEESG----------EGISVEIAMQWNNSYSESVYTFANTINTAEGGTHEEGFRAALTSIVNRYAREQKFLKEKDDNLAGEDIREGLTAIISVKLADPQFEGQTKTKLGNTEAKSFVQKACNDHLRDWFERNPGEAKDIINKSLQASRARLAARQARDLTRRKSLLEGSGLPGKLADCQWSDPEKCELFIVEGDSAGGSAKGGRDSKFQAILPIRGKILNVEKARIDKVLRNTEVQALITAMGTGVHDEFDITKLRYHKLILMADADVDGQHINTLLLTLLFRFMRPLIEAGHVYLSQPPLYKIKRGEDASYAYSDPERDAIIADGIARGKRIQRFKGLGEMNASQLWETTMNPETRVLRLVTLDDAAQADELFSVLMGEDVEARRSFIIRNARDVRFLDV 647
189 0.000e+00gi|339626334|ref|YP_004717977.1| DNA topoisomerase IV subunit B [Sulfobacillus acidophilus TPY]  clstr ali  49  4....PSTPEYNENQIQVLEGLEAVRKRPGMYIGSTDVRGLHHLVYEIVDNSIDEALAGVCDRIQVTLYRDGRVGVRDNGRGVPTGIHPKVGIPTLEVVLTMLHAGGKFGGGGYKVSGGLHGVGLSVVNALSKELTATSRFNGGIFVQHYAQGKPLDA-LTRIGDTD-ETGFEVVFLPDPDIFEEVRFSFETIANRLREQAFLNSGVLLELKDEASG--REMRYHYTGGVVSFVQYLNLNRDVIHPKPIAFSA----------ERDGVFVETALQYNDSYTETLFTFANTIRTLEGGSHEAGFKAALTRVCNDYGRKLGLLKDADNNLSGDDVREGLTMILSVKLPEPQFEGQTKTKLGNSEVRGITEAIVAEGLSTYFEENPSIAKRILXXXXXXXXXXXXXXXXXXLTRRKSVLESSSLPGKLTDCTSKDPAESELFLVEGDSAGGSAKQGRDRQFQAVLPLRGKILNVERARLDKILGNEEIRAMITAIGTGIGDEFDLTKARYHRIVIMTDADVDGSHIRTLLLTFFYRYMTPLIEAGYVYIAQPPLYLVKKGKQERYLYDDAALEQLLNEWGRGNITIQRYKGLGEMNAEQLRDTTMNPETRTLLRVELEDAAAADWIFTVLMGDKVESRRDFIQEHAHLVRNLD. 635
190 0.000e+00gi|366089076|ref|ZP_09455549.1| DNA gyrase subunit B [Lactobacillus acidipiscis KCTC 13900]  clstr ali  50  10.AKEKRANEYDASQIQVLEGLEAVRKRPGMYIGSTSTQGLHHLVWEIIDNGIDEALAGFCDEINVTVETDNSITVKDNGRGIPVDIQKKTGRPAVETVYTILHAGGKFGGGGYKVSGGLHGVGASVVNALSSELEVQVTRDPNVYAMDFAYG-KVKTQLHVIAQTSEHTGTKVHFKPDTDIFTETHYDIKVLTTRIRELAFLNKGLKLTIADQRPEKPTFEEFHYAGGIKHYVEFLNKGKEVLFPEPVYVE----------GEMNGITVEVSLQYTDDFHSNLLTFTNNIHTYEGGTHEAGFKTALTRVINDYARKQGILKDNDDNLSGEDVREGITAVVSVKHPDPQFEGQTKTKLGNSDARTATDKLFSETFSQFMYENPTTAKQIVEKGSLXXXXXXXXXXXXEVTRKKNGLEISNLPGKLADNTSKDPEISELFIVEGDSAGGSAKQGRSRLTQAILPIRGKILNVEKASLDRILANEEIRSLFTALGTGFGEEFDVSKANYHKLIIMTDADVDGAHIRTLLLTLFYRFMKPMIDAGYVYIAQPPLYQVRQGKMIRYIDSDEELQDILSQLPSPKPAIQRYKGLGEMDADQLWKTTMNPENRRMMRVSLSDAEEANQVFEMLMGDHVGPRRQFIEENATYVENLD. 651
191 0.000e+00gi|261415262|ref|YP_003248945.1| DNA gyrase subunit B [Fibrobacter succinogenes subsp. succinogenes S85]  clstr ali  48  1MAEEKAEADYSGSSITVLEGLEAVRVRPAMYIGSTDIRGLHHLVWEVVDNSVDEALAGFCNHIEISILPGNGIRVTDNGRGIPTDIHPKEKVGTIQVVMTKLHAGGKFNNSSYKVSAGLHGVGVSCVNALSNKLIVTVRRNGRVVRQEFARGVPC-GPQVDIGESDGTTGTSVEFYPDDTIFSETVYVYDTLATRFRELAFLMSGLRLTLTDERDPEHKQDTFCFPGGVSEFVRYVDEHRTPLFAEPIHLVLPDGQYPL----------EVAMWYNDGYQENFFSFVNNVNTYDGGTHVTGFKTALTRVISKFAQDMPKGK-KEAQITSDDIREGLTAVIAIKVSQPQFEGQTKRKLGNSEIAGYVASAFGAKLEEYFQENPAAVKIILDKVYNAAVAREAAHRARTLARRKNVLESGGLPGKLADCSSRDPKECEMFIVEGDSAGGSAKMGRSREFQAILPIRGKILNVEKASLHRVLDTEEIQNLVNAIGTGIGTEFKIEKLRYDKIIIMTDADVDGSHIQTLLLTFFFRYMRPLIDAGHIFLAMPPLYKLKIGQKERYLFDENEKDKVMAEIEDKKVAITRFKGLGEMSPEQLNDTTMNPKTRFLKQCHVEDSVLADQIFSMLMGEDVEPRRKFIETNAYKVLNLDI 646
192 0.000e+00gi|227494193|ref|ZP_03924509.1| DNA topoisomerase (ATP-hydrolyzing) [Actinomyces coleocanis DSM 15436]  clstr ali  48  1MAEEQTTSSYGASDITVLEGLEAVRKRPGMYIGSTGERGLHHLVYEVVDNAVDEALAGYCDHIEVTIREDGAVTVVDNGRGIPVDIHPTEGKPTVEVVMTILHAGGKFGGGGYAVSGGLHGVGISVVNALSKRVDTEIRRQGYVWRQSFGNGGKPLTEL-VRGEETEETGTSQTFYPDPEIFETVEFSFETLRKRFQQMAFLNKGLRISLTDERTDEPLTVTYQYDQGLYDYVKFINSTKETIHDDIIAFEHDAEA----------LSVEIAMQWTKAYSESVFTYANTISTTEGGTHEEGFRAALTSVINKYAREKGILKDKHDNLSGDDIREGLTAVISVKLTEPQFEGQTKTKLGNTEARTFVQQQVYSQFGDWLDSHPAEAKAVIIKALSAQEARLAARKAREATRRKGVLESASMPGKLRDCSSRDAAKCEIYIVEGDSAGGSAVMGRDPEHQAILPLRGKILNVEKARLDRALDSQEIRALISAFGTGIGDEFDISKLRYGKIVLMADADVDGQHITTLLMTLLFRYMRPIVEAGHVYLAQPPLYRLKWNAQHEFVYSDAERDAALAKGKAEGRRVQRYKGLGEMNAQELWETTMDPSKRTLKKIEIAEAATADEIFSILMGDDVESRRSFIQRNAQDVRFLDV 671
193 0.000e+00gi|307352947|ref|YP_003893998.1| DNA gyrase subunit B [Methanoplanus petrolearius DSM 11571]  clstr ali  49  2.....AQNNYNASNITVLEGLEPVRERPAMYIGSTDVRGLHHLVYEVVDNAVDEALAGVCDHIIVTLGRDGTCTVEDNGRGIPVDIMEEQGKSALEVVMTVLHAGGKFDKNTYQVSGGLHGVGVSVVNALSEFLQVEVFRDGYIYDMGFARGG-LKSDLTAAPDAFEKHGTKISFKPDALIFETVTFDYDILSHRMRELAFLNRGITIEISDERSGYA--DIFNYEGGISEFVTYLITGKETVHPDVIYFDTKDAASMT--------EVEVALQYSTAYSETMMTFVNSVNTREGGTHLEGFRSALTRAINKSAKDNNLMKGMSESLKGEDVREGLVTVISLKVANPQFEGQTKMRLGNSNVKGIVDSLVYQSLTEYFEENPKVIQAIVSKAVGXXXXXXXXXXXXXLARRKSTLESGGLPGKLADCSERDPSKSEIYIVEGDSAGGSAKQGRSRQFQAILPLRGKILNVEKANPHRILKNAEIQTLISAIGCGFGESFDVEKARYHHIIFMTDADVDGAHICTLLLTFFYRYMPELIEKGYIYIAQPPLFRVAKGKNEKYAFSEEEMKRYVKEFGDKGVSVQRYKGLGEMNADQLWHTTMAPESRVLKQVSVIEASYADEIFSKLMGDDVEARKEFIIRHSKEVTNLDI 640
194 0.000e+00gi|374376167|ref|ZP_09633825.1| DNA gyrase, B subunit [Niabella soli DSM 19437]  clstr ali  49  9..EPMETPAYGADSIQVLEGLEAVRKRPAMYIGDIGVKGLHHLVYEVVDNSIDEALAGYCKNIIVTIHEDNSISVEDDGRGIPTGINQKQGVSALQVAMTILHAGGKFDKGSYKVSGGLHGVGVSCVNALSTRMHTVVCRDGKIFEQEYHIGVP-DYPVREIGTTEK-HGTFQQFWPDGSIFMTTEYKREILEGRLRELSYLNKGISINLIDKREGAEIKKIFYSEGGIVEFVEMLDKGRNGLIPNILSVDG--------HDENSNVAVEVALTYNDSFNEHIYSYVNNINTIEGGTHVTGFRQALTRVFKTYGDKNGFFEKAKVAIEGDDFREGLSAIISVKVPEPQFEGQTKTKLGNSEVSGVVQTTVARVLEAFLEENPKDAKNIINKVILXXXXXXXXXXXXDLVQRKSVLSGGGLPGKLADCSDRDPGRCELYLVEGDSAGGTAKQGRDRSFQAILPLRGKILNVEKAMEHKIYENEEIRNIYTALGVTVGDDLNLEKLRYHKLIIMTDADVDGSHIATLILTFVYRYMKELVEQGYVYLAQPPLYLVKKGKEAAYAYNEDQRKALVERLGADSVNIQRYKGLGEMNAEQLWETTMDPDRRTLKQVTIESAAEADRVFSMLMGDEVAPRREFIETNAKYAK-LDI 659
195 0.000e+00gi|420162320|ref|ZP_14669079.1| DNA topoisomerase (ATP-hydrolyzing) [Weissella koreensis KCTC 3621]  clstr ali  53  20....TEAGAYDASQIEVLEGLEAVRKRPGMYIGTTSSQGLHHLVWEIVDNGIDEAMAGFADHVTVTIEADNSVTVTDNGRGIPVDLQKKTGKSALETVFTVLHAGGKFDGGGYKVSGGLHGVGASVVNALSTRLDAIVVRDGKGYQMAFERGRTVQTITEISAEGEVERGTIVHFVPDADIFETTVFNAKTLIDRVRELAFLNKGLRISFTDKRNDENKTETFYYEGGLREYVEYLNRNKTVLFEEPVYVE----------GTSNNIEVEVALQYTDDYRSNVLSFANNINTWEGGTHETGFKTAMTRVINDYARQNNILKEDDDTLTIDDLREGLTAIVSVKHPDPLFEGQTKAKLGSSDARTAVYRMFNETFKRFMYENPVIAKQIVEKGQSXXXXXXXXXXXXEESRKKTGLEISNLPGKLANNTSKDPAISELFIVEGDSAGGSAKQGRERLTQAILPIRGKILNVEKAQMKTILANEEIRSLFTAMGTGFGEEFNIEKVHYHKLIIMTDADVDGAHIRTLLLTLIYRYMRPLLEAGFVYIAQPPLYQVRQGKFVKYLDTDQELNELLPTLASPKPVVQRYKGLGEMDAEQLWETTMDPTQRRMLRVELDDAEEADQVFSMLMGDKVEPRREFIEQNARYAE-LDV 658
196 0.000e+00gi|