current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

13507742
Query: gi|13507742|ref|NP_109691.1| DNA gyrase subunit B MPN003 [Mycoplasma pneumoniae M129], from M.pneumoniae

Results of PSI-BLAST search in nr85s
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650
# E-value Template Links and tools%idFirst MEDNNKTQAYDSSSIKILEGLEAVRKRPGMYIGSTGEEGLHHMIWEIIDNSIDEAMGGFASTVKLTLKDNFVTIVEDDGRGIPVDIHPKTNRSTVETVFTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSSFKVWVAREHQQYFLAFHNGGEVIGDLVNEGKCDKEHGTKVEFVPDFTVMEKSDYKQTVIASRLQQLAFLNKGIQIDFVDERRQNPQSFSWKYDGGLVQYIHHLNNEKEPLFEDIIFGEKTDTVKSVSRDESYTIKVEVAFQYNKTYNQSIFSFCNNINTTEGGTHVEGFRNALVKIINRFAVENKFLKETDEKITRDDICEGLTAIISIKHPNPQYEGQTKKKLGNTEVRPLVNSIVSEIFERFMLENPQEANAIIRKTLLAQEARRRSQEARELTRRKSPFDSGSLPGKLADCTTRDPSISELYIVEGDSAGGTAKTGRDRYFQAILPLRGKILNVEKSHFEQIFNNVEISALVMAVGCGIKPDFELEKLRYNKIIIMTDADVDGAHIRTLLLTFFFRFMYPLVEQGNIYIAQPPLYKVSYSNKDLYMQTDVQLEEWKQQHPNLKYNLQRYKGLGEMDAIQLWETTMDPKVRTLLKVTVEDASIADKAFSLLMGDEVPPRREFIEQNARNVKNIDILast
1 0.000e+00gi|159028965|emb|CAO87426.1| unnamed protein product [Microcystis aeruginosa PCC 7806]  clstr ali  49  2......TSNYGAEQIQVLEGLEPVRKRPGMYIGTTGPRGLHHLVYEVVDNSIDEALAGYCTHIEVDIKADGSVSVTDDGRGIPTDVHPTTGKSALETVLTILHAGGKFGSGGYKVSGGLHGVGISVVNALSAWVDVTVWRDHKVHTQRYERGIPVT-ELVSSPSQEEKTGTRVNFLPDTEIFQGIEFDYSTLSGRLRELAYLNAGVKITFSDYRAEEPHIETYCYEGGIKEYVAYMCREKETLHKDIIYVSG----------EKNGINIEVAFQWCDAYSDNILGFANNIRTIDGGTHLEGLKAVLTRTLNNVARKRNKIKENEPNLAGENVREGLTAVISVKVPEPEFEGQTKTKLGNTEVRGIVDSLVGETLNEYLEQNPQVADTIIEKAVQAYKAAEAARRARDLVRRKSVLESSPLPGKLADCSERDPEKSEIYIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIEKTDDAKIYKNTEIQSLITALGLGIGEDFDPSQLRYHRIVLMTDADVDGAHIRTLLLTFFYRYQKNLIDQGYVYIACPPLYKLERGKNHSYCYSDRELQQKIAEFPNANYTIQRFKGLGEMMPQQLWDTTMNPETRTLKRVEIEDAAKAEELFTILMGDRVAPRREFIETHGPNLTDLDI 640
2 0.000e+00gi|502939241|ref|WP_013174217.1| DNA gyrase subunit B [Syntrophothermus lipocalidus]  clstr ali  51  1MNINGSKNEYTALDIQVLEGLEAVRKRPGMYIGSTDSRGLHHLVFEIVDNSIDEAVAGYCDEIKVIILDDSTVTVTDNGRGIPVDMHPKMGIPALEVILTTLHSGAKFGGSGYTISGGLHGVGLSVVNALSRWLEVEVARDGQLYHQRYERGKPVT-PLAVTGAC-QTTGTKITFSPDPEIFEEICFSAEIIGQRLRELSYLNQGTRIVLCDKRTG--RDVEYYHTGGIRDFVKYLSKNREPLSPEPIYF----------RIGKEGTVVEVAIQYNTGYTETLLSYANNIHTQEGGTHELGFKNGLTRVVNEYAKKQGMLKENEGNLLGEDIREGMTAVISVLVQDPQFEGQTKTKLGNAFIRSLVEGAVSDFVGAFFDENPSLAKKIVEXXXXXXXXXXXXXXXXXLTRRKNLLDSTSLPGKLADCSEKDPALSELYLVEGDSAGGSAKQGRDRNFQAILPLRGKILNVEKARLDKVLSNEEIRALITAIGTGIGEDFDINKARYHRLIIMTDADVDGSHIRVLLLTFFYRYMRPLIEAGYVYVAQPPLYELKRGKEVHYIYNDRELQRFLEQQGNKKYGVKRYKGLGEMNPEQLWETTMNPENRTLLQVRIEDAIAADVIFSSLMGEKVEPRREFIQENARLVTNLDI 636
3 0.000e+00gi|551064027|ref|WP_022796106.1| DNA gyrase subunit B [Bavariicoccus seileri]  clstr ali  52  1MSEEELAHEYNASQIQVLEGLEAVRKRPGMYIGSTSSTGLHHLVWEIVDNSIDEALAGFATKIMITINKDNSITVLDDGRGIPVDIQQHTGRPAVETVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSSKLTVQVFKDGIIYQQEYERGV-VKYDLKKVGETT-EHGTKVHFIPDKEIFETTEFDYNTLMTRVRELAFLNKGLNLTLTDLRGEEPVSEKFHYEGGIKSYVSYLDRNVDVLFDEPIYLEG----------EQDSILVEVSLQYTNTYKTTLMSFTNNIHTYEGGTHEAGVKTALTRVINDYARKNNLMRDNEANLSGEDVREGMTMVLSIKHPDPQFEGQTKTKLGNSEARTITDRLFSVHFDRFMMENPTIARQIVDKGLLASKARLAAKRAREVTRKKSGLEISNLPGKLADCSSNDPSINEIFIVEGDSAGGSAKTGRSRHFQAILPIRGKILNVEKASIEKILANQEIRSLFTAMGTGFGGDFDVSKARYHKVIIMTDADVDGAHIKTLLITLFYRYFRPIVEKGYLYIAQPPLYKVKQGKNEEYLNSDEELTELLKTLPKPKPLINRYKGLGEMNAEQLWETTMDPENRYLSQVDIGDAEEANQVLDMLMGDRVEPRREFIEDNAVYVDNLDI 645
4 0.000e+00  ali  51  2......SNNYQAEDITVLEGLEAVRKRPGMYIGTTSERGLHHLVWEVVDNSVDEALAGFCTHIEVNILPNNVIEVIDNGRGIPIDIHPKYGKSALEIVLTVLHAGGKFENNNYKVSGGLHGVGISVVNALSEWTEVEVRKNGKIWYQKYDRGIP-EAPVKEIGESDD-HGTTVRFKPDFEIFETLVFDYNTLKNRLKELAYLNKGLVITITDSRKEPFKKEVFEFEGGISDFLKEITKDTEKLIKDPIHMVG----------EVDNIAVEVAFTYTVNQNEVIYSFVNNINTHEGGTHVQGFRTALTRTINDVGKSQGILKEKDKNLQGNDIREGIIAIVSVKVAQPQFEGQTKTKLGNSEVTGVVSTVVGNSLKMVLEDNPSDTKIIIEKILNSRKAREAAQRARELVLRKSALEVGSLPGKLADCSSKNPEECEIYIVEGDSAGGSAKQGRDRFHQAILPLRGKILNVEKAGLHKALENNEVRAMITAFGAGIGDNFDITKLRYGKIILMTDADVDGAHIRTLLLTFIYRYMVELIYNGNVYIAQPPLYKISYGKQIKYAYSDRELAEATAEFEDDNYTLQRYKGLGEMNPEQLWETTMDPEHRTLLRVSIDDARAADMLFDKLMGDKVEPRREFIEENAEYVKNLDI 635
5 0.000e+007030380552 SRS024081_LANL_scaffold_75490__gene_124575 DNA gyrase, B subunit [Human Tongue dorsum microbiome from visit number 2 of subject 159510762]  ali  50  1MSEE--TTNYGADQIQILEGLEAVRRRPGMYIGTTASRGLHHLVYEIVDNSVDEAIAGYCSRIDVTINPDNTVCVQDNGRGIPVGINHKAGLPAVEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVQVFHDGKVYEQRYERG-KVCYPLRIKEECEGKTGTRVVFKPDAQIFETTEFEFSVLRQRLREMAFLTKGLTIFLTDLRIGENQEEKYHYEGGIKEFVAYLNRSKSALYNPIMYFEG----------DRNKVHVEVSMQHNDSFTESTYTFVNNINTPDGGTHLEGFKTALTNVFNRYARDGKMLKDADENLSGEDIREGLTSIISVKIEDPQFEGQTKQKLGNSEARGAVLSVVSEQLTYFLEQNPTVAKIILDKAITAQHAREAARRARDLTRRKSAMDGMGLPGKLADCSDKDPKNCEIFIVEGDSAGGSAKSARSRATQAILPLRGKILNVEKARDERIYGNAEIKAMITAFGCGIHDDFDISKLRYDKIIIMTDADVDGAHIATLMLTFLYRFMPELIKQGHVYLAMPPLYKLEKNKKVWYAYSDEELNQIIAEVGRDNNKIQRYKGLGEMDPEQLWETTMNPDSRTLKRIGFDEETEIDVTFTTLMGDQVEPRKEFIEKNARFVKNLDI 646
6 0.000e+00JGI.Meta 7030380552 SRS024081_LANL_scaffold_75490__gene_124575 DNA gyrase, B subunit [Human Tongue dorsum microbiome from visit number 2 of  ali  50  1MSEE--TTNYGADQIQILEGLEAVRRRPGMYIGTTASRGLHHLVYEIVDNSVDEAIAGYCSRIDVTINPDNTVCVQDNGRGIPVGINHKAGLPAVEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVQVFHDGKVYEQRYERG-KVCYPLRIKEECEGKTGTRVVFKPDAQIFETTEFEFSVLRQRLREMAFLTKGLTIFLTDLRIGENQEEKYHYEGGIKEFVAYLNRSKSALYNPIMYFEG----------DRNKVHVEVSMQHNDSFTESTYTFVNNINTPDGGTHLEGFKTALTNVFNRYARDGKMLKDADENLSGEDIREGLTSIISVKIEDPQFEGQTKQKLGNSEARGAVLSVVSEQLTYFLEQNPTVAKIILDKAITAQHAREAARRARDLTRRKSAMDGMGLPGKLADCSDKDPKNCEIFIVEGDSAGGSAKSARSRATQAILPLRGKILNVEKARDERIYGNAEIKAMITAFGCGIHDDFDISKLRYDKIIIMTDADVDGAHIATLMLTFLYRFMPELIKQGHVYLAMPPLYKLEKNKKVWYAYSDEELNQIIAEVGRDNNKIQRYKGLGEMDPEQLWETTMNPDSRTLKRIGFDEETEIDVTFTTLMGDQVEPRKEFIEKNARFVKNLDI 646
7 0.000e+00gi|548577643|ref|WP_022528847.1| GyrB [Lactobacillus shenzhenensis]  clstr ali  53  19...EELAKSYNASQIQVLEGLEAVRKRPGMYIGATSSQGLHHLVWEIIDNGIDEALAGFATKIEVTVEEDGSVTVEDDGRGIPVDIQKKTGKPALETVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSTHLAVTVARDGKKYYMDFHRG-KVSTPMKLVGDPEHEHGTIVHFVPDPEIFETTTFDDKILVTRIRELAFLNKGLKLTFTDKRQETHEKLVFHYEGGIKSYVEYLDHGKDVLFQDPIYVEG----------QEKGITVEVALQYTTGYHSILMTFANNIHTYEGGTHEAGFKAALTRVINDYAHKQNIIKDPDEKLSGDDVREGLTAVVSIKHPDPQFEGQTKTKLGNSDARTVTDRTFAEMFTKFLMENPNEARAIVDKGMVASKARVAAKRAREMTRKKSGLEISNLPGKLADNTSKDPEISELFIVEGDSAGGSAKSGRSRLTQAILPIRGKILNVEKASMDRILANDEIRSLFTAMGTGFGGDFDISKARYHKVIIMTDADVDGAHIRALLLTLFFRYMRPLVDAGYIYIAEPPLYQVRQGKYVKYVDSDEELQEVLQTLPSPKPAIQRYKGLGEMDASQLWDTTMNPENRRLERVNVQDAIEADAVFDMLMGDKVEPRREFIEKNATYA---DI 654
8 0.000e+00gi|489652274|ref|WP_003556660.1| DNA gyrase subunit B [Lactobacillus buchneri]  clstr ali  51  1MADQKETNEYDASQIQVLEGLEAVRKRPGMYIGTTSSQGLHHLVWEIVDNGIDEALAGFATKITVTVEKDNSITVTDDGRGIPVDIQKKTGKPALETVYTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEELDVAVTRNGKVYYMDFSRG-HVTTPMKVIDHSDDLHGTKVHFLPDPDIFETTTFDIKVLTARLRELAFLNKELRIIVRDMRPEKPTEQDFLYEGGIRHYVEYLDKDKETLLKEPIYVEGMD----------NGITVEVAIDYSEDYHSTLMTFTNNIHTYEGGTHEEGFKRALTRVINDYARKNNLLKDNEANLSGEDVREGTTAVVSIKHPDPQFEGQTKTKLGNSDARTVTDRIFSDHFSKFLMENPKLARKIIDRGLLASKARSAAKRAREVTRRKSGLEISSLPGKLADNTSKDPKISELFIVEGDSAGGSAKQGRARLTQAILPIRGKILNVEKASMDRILANEEIRSLFTAMGTGFGDDFDLSKINYHKLIIMTDADVDGAHIQTLLLTLIYRYMRPLIDAGYVYVAQPPLYQVRQGKMQRYIDSDDDLNQFLGTLPSPKPVIQRYKGLGEMDAEQLWDTTMNPENRHLLRVESSDAAEANHVFSMLMGDKVEPRREFIEDNATFVENLDI 647
9 0.000e+00gi|503433990|ref|WP_013668651.1| DNA gyrase subunit B [Aerococcus urinae]  clstr ali  52  23.NQPNQAGEYNASQIQVLEGLEAVRKRPGMYIGSTGAPGLHHLVWEIVDNSIDEALAGYADKIDIKIESDGSITVIDNGRGIPVDIQEKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTKLRVEVYRDGKIYQQEYSRG-HIVSDLKVVGESDK-TGTVVNFVADPEIFDTTDYDFQTLNKRVRELAFLNKGLHITLEDRREEDSQEVAYQYEGGIKEYVQYLNENKEILFEEPVYLEG----------QMDDIEVEVAFQYTAGYHSNFMSFANNIHTFEGGTHESGIKTALTRTINDYARSQNLLKEKDDNLSGEDVREGLTLIVSIRHPNPQFEGQTKMKLGNSEVRTITDRLFGQHLEQFLYETPNIARQIVDKGILASKARQAAKRAREMTRKKSGLEISNLPGKLADCSSRVPEECELFIVEGNSAGGSAKLGRDRHFQAILPIRGKILNVEKASMDRILANEEIRSLFTAMGTGWGNDFDVTKARYHKLVIMTDADVDGAHIRTLLLTLIYRYMRPLLDAGYIYIAVPPLYQVRQGKNVHYVNSDQELNDYMKTLARPRPAVQRYKGLGEMDAEQLWETTMDPTQRQMLQVTVDDAQEADRNISMLMGDLVAPRRDFIENNATYAT.... 657
10 0.000e+00gi|496485027|ref|WP_009193597.1| DNA gyrase subunit B [Cesiribacter andamanensis]  clstr ali  47  1MSEKANSSEYGASNIQVLEGLEAVRKRPAMYIGDVGVKGLHHLIWEVVDNSIDEALAGYCDHIIVEIFEDNSVRVTDNGRGIPTDLHVKENRSALEVVMTVLHAGGKFDKDTYKVSGGLHGVGVSCVNALSIPMRVEVHRKGKIFEQEYAKGIP-QYSVREIGTTEK-TGTIVHFKPDAEIFTTTVYNFETVASRLRELSFLNAGITLELFDHREGKAIHQKFHSQGGLKEFVEYLDSTREKLIPSPIHI----------TNDKGDIPVEVAMSYNTSYSENVVSYVNNINTIEGGTHVAGFRRALTRTLKSYADKSGMLEKVKLEISGDDFREGLTSVISVKVAEPQFEGQTKTKLGNSDAMGAVDTAVAEALGYWLEEHPREAKQIVQKVILAAQARHAARKAREMVQRKNVLGSNSLPGKLADCSDSDPAVCELYLVEGDSAGGSAKQGRDRGFQAILPLRGKILNVEKAQEHRIYDNEEIKNMITAMGVSFGEDLNMDKLRYHKIIIMTDADIDGSHIRTLILTFFFRYMRDLIDKGYLYIALPPLYLVKRGKDERYAWSEEERIRLVKEMAEDSVGIQRYKGLGEMNPEQLWTTTMDPEMRSLKRVSVESAAEADHLFSMLMGDEVAPRRDFIERNAKYAK-LDV 652
11 0.000e+00gi|652854009|ref|WP_027128149.1| DNA gyrase subunit B [Fusobacterium perfoetens]  clstr ali  52  2...EGKMSNYQAENITVLEGLEAVRKRPGMYIGTTSERGLHHLVWEIVDNSIDEALAGYCNKIIVNVLPNNIIEVIDNGRGIPTGTHPKYGKSALEIVLTVLHAGGKFENDNYKVSGGLHGVGVSVVNALSEWLEVEVKRDGKIWFQRYDRG-KPEEDVKIIGEAS-ETGTKVTFKADGEIFETLVYSYETLETRLKELAYLNKGLRIELNDMRKEPVKSAELEFQGGIIDYIKDVEKDSIKLIKEPIYMSG----------ESDGVIFEAVMLYNTNQRETIYSFVNNIHTHEGGTHVSGYKVALTRVINDLGKAMGYLKDKDGKLQGSDIREGLTAIVSVKIPQPQFEGQTKTKLGNSEVTGVVSSIVGNQLKMYLEDNPSDMKVIIDKVLSSKKAREAAQKARELVLRKSALEVGSLPGKLADCSSKNPEECEIYIVEGDSAGGSAKQGRDRRFQAILPLRGKILNVEKAGLHKALENSEIRSMITAFGTGIGDNFDISKLRYGKIVIMTDADVDGAHIRTLLLTFFYRYLVDLLHDGHIYIAQPPLYKISSGKSIQYAYTDKQLKEIQIKMENKKYTLQRYKGLGEMNPEQLWETTMDPDVRTFYQVKVDDAREADLIFDKLMGDKVEPRREFIEAHAEFVKNLDI 638
12 0.000e+00JGI.Meta 7034405225 SRS014459_WUGC_scaffold_234__gene_119 DNA gyrase, B subunit [Human Stool microbiome from visit number 1 of subject 76357  ali  51  1MTME--NDNYGAEQIQVLEGLEAVRKRPGMYIGSTSSTGLHHLVYEIVDNSVDEALAGYCTHIQVYINEDNSITVVDDGRGIPVEIHKKQGIPAVEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSTWLEVEITRDGKVYKQRYEKG-KVMYKLQVIGEPEGVSGTKVTFLPDHTIFEDNIYDYDILRNRLREMAFLTKGLKISLTDKRLIPEKVRSFHYEGGIKEFVTYLNRHRDPLYNEVIYCEGV----------RDGISVEVALQHNDSYNESTYSFVNNINTPEGGTHLTGFKSAITKVFNDYARKNNIIKEKDDNLSGDDLREGLAAIVSIKISDPQFEGQTKQKLGNSEARPAVESVVTEQLTYYLEQNPQIAKIIVNKAAVAQRARIAARKARDVARKANLSDNMALPGKLADCSDKDPKNCEIYIVEGDSAGGSAKTARSRATQAILPLRGKILNVEKARIDRILGNEEIKAMITAFGTGIHENFNIEKLRYNKIIIMTDADVDGAHIATLLLTFFYRFMPDLIRKGHVYLAQPPLYKLEKNKKVWYAYSDDELNSILDEVGRDNNKIQRYKGLGEMDAEQLWETTMDPEKRILLRVDDDDESEIDMTFNVLMGDKVEPRREFIETNAKYVKNLDI 641
13 0.000e+00gi|493974396|ref|WP_006917483.1| DNA gyrase subunit B [Lactobacillus coleohominis]  clstr ali  52  21.......SKYDASQIQVLKGLEAVRKRPGMYIGSTTAQGLHHLVWEIVDNGIDEALAGFTDEINVVVEPDNSITVTDNGRGIPVDIQKETGKPALETVFTVLHAGGKFGNGGYKVSGGLHGVGASVVNALSTELDVRVARQGKEYYMDFQ-GGHVKTPMKVIGLPETQHGTIVHFKPDPDIFETTVYNIKTLTDRIRELAFLNKGLKITIEDKRNDEDNRQEFHYEGGIRHYVEFLNRGHELIFDPPIYVEG----------EYNGITVEVSLQYTSGYRCNLLTFTNNIHTYEGGSHETGFKTALTRVINDYGRKSGQLKGNNSTLSGDDVREGLTAVVSIKHPNPQFEGQTKTKLSNSDARTATDHIFSETMNRFMMEHPDTAKKIVEKGMLASKARVAAKRAREVTRKKSGLEISNLPGKLADNTSKDPSISELFIVEGDSAGGSAKQGRSRLTQAILPIRGKILNVEKASLNRVLANDEIRSLFTALGTGFGEDFDVSKANYHKLIIMTDADVDGAHIRTLLLTLFYRFMRPMIEKGYVYIAQPPLYQVRQGKFVKYIETDEELEQVVNSLPSPKPVIQRYKGLGEMDAEQLWETTMDPENRHLLRVDLDDAAAADEIFPMLMGTKVGPRRDFIEKNATFVKNLD. 655
14 0.000e+00gi|489229963|ref|WP_003138309.1| DNA gyrase subunit B [Lactococcus raffinolactis]  clstr ali  55  12..KKEKAAEYDASQIQVLEGLEAVRMRPGMYIGSTSSEGLHHLVWEIVDNSIDEALAGFASHIEVFIEPDNSITVVDDGRGIPVDIQEKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVTVFKQGKKYYQEYHRGV-VGGDLEMIGETD-RHGTTVHFTPDPTIFETTEFDFQKLAKRVRELAFLNSGLRISITDKRPEEAESLHYHYEGGIQSYVEYLNEEKTVLFEPAIFTEG----------EMEGIAVEVAMQYTGSYHSMVLSFANNISTHEGGTHEQGFRTALTRVINNYAKSNKLLKENEENLTGDDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVSGIVNKLFSEEFGTFLLENPQVARRIVEKGILASKARIAAKRAREVTRKKSGLEISNLPGKLADCSSNDPTQTEIFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKASMEKILANEEIRSLFTAMGTGFGADFDVSKARYQKLVIMTDADVDGAHIRTLLLTLFYRYMRPVVEAGYVYIAQPPIYGVKLGDKITYVNQETELQTAVLEMGNRKPIVQRYKGLGEMDDHQLWETTMDPEHRTMAQVSVEDAAEADQIFDMLMGDRVEPRRDFIEANAQYST-IDI 653
15 0.000e+00gi|653089450|ref|WP_027339690.1| DNA gyrase subunit B [Halonatronum saccharophilum]  clstr ali  54  2......ETNYNAEQIQVLEGLEAVRKRPGMYIGSTSLKGLHHLVYEVVDNSIDEALAGYCDTIKVYIEEDNIISVEDNGRGIPVSLHPKLKKPALEVVMTVLHAGGKFGGEGYKVSGGLHGVGVSVVNALSEWVKVEVKRDGKIYTQSYERGIPKT-EVEVIGQTE-ERGTKISFKADDLIFEETEYKFKTLAQRLKELAYLNKGINISIIDKRKEEEVKEEYKFDGGIVSFVKEINSRQDPIHEEIIFYE----------DEFETGHVEIAIQYNDEYVDKIFTFANNINTHEGGTHLSGFKTSLTRTVNDYARKNKIIKDNDENLSGDDIREGIVAIINVKLTEPQFEGQTKTKLANREVRGVVDSITSEKLSTILEENPQLGKIIVEXXXXXXXXXXXXXXXXELTKRKTALSSTSLPGKLADCSSRDPEESEIYIVEGDSAGGSAKQGRDREFQAILPLKGKILNVEKARLNKILSNNEIRSLITALGAGISDDFDIEKVRYKKIIIMTDADVDGSHIRTLLLTFFYRYMRDLIEEGTIFIAQPPLFKISKGKSEYYVYNDRQLDKLLNEIGNDRISLQRYKGLGEMNPEQLWETTMDPENRTLKKVQISDAVIADEIFTTLMGDKVKPRKEFIQRHAKEVQNLDI 633
16 0.000e+00METAHIT MH0046 GL0001932 [Complete] locus=scaffold21929_2:7081:9036:-  ali  49  1MSEEIKNSDYSADSIQVLEGLEAVRKRPAMYIGDISEKGLHHLVYEVVDNSIDEALAGYCSNVDVIINEDNSIVVTDNGRGIPVDIHEKEGKSALEVVLTVLHAGGKFDKGTYKVSGGLHGVGVSCVNALSTYLKAEVRRNGHIYMQEFSCG-KPLHDVQMVGDAD-TTGTTITFKPDGSIFTVTEYKYDILATRLRELAFLNAGITLRLTDKRDGTYKSETFHSNEGLKEFVHYIDRSKEKLIPDVIHI----------VTEKQGIPVEVAMTYNTSYNESVFSYVNDINTIEGGTHVAGFRRGLTRTLKKYAEDSKLLEKAKVEIQGDDFREGLTAVISIKVAEPQFEGQTKTKLGNSEVTGAVDQAVGEALGYYLEEHPKEAKTIVEKVVLAASARQAARKAREQVLRKSPLTGGGLPGKLADCQSKDASLCELFLVEGDSAGGTAKQGRNSKFQAILPLRGKILNVEKAMDHKVFESEEIQNIYRAMGVTIGTELNMDKLRYHKVIIMTDADVDGSHIATLILTFFFRRMRALIENGYVYLATPPLYLCKKGKVEEYCWTDQQRQAFILKYGGKQIQTQRYKGLGEMSDHQLWETTMNPENRTLKQITIDNAAEADQIFSMLMGEDVGPRREFIEENATYA-NID. 650
17 0.000e+00JGI.Meta 7040985061 SRS011105_Baylor_scaffold_1357__gene_2552 hypothetical protein [Human Anterior nares microbiome from visit number 1 of s  ali  52  6.SDVNNTDNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSQDLEVYVHRNETIYHQAYKKGVP-QFDLKEVGTTDK-TGTVIRFKADGEIFETTVYNYETLQQRIRELAFLNKGIQITLRDERDEEVREDSYHYEGGIKSYVELLNENKEPIHDEPIYIH----------QSKDDIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRALTRVLNSYGLSSKIMKEEKDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGIMXXXXXXXXXXXXEVTRRKSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVYNDRELDKLKSELPTPKWSIARYKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYA-NLD. 643
18 0.000e+00gi|518368848|ref|WP_019539055.1| DNA-cytosine methyltransferase [Proteiniphilum acetatigenes]  clstr ali  47  1MSEEEKKNNYSAQNIQVLEGLEAVRKRPAMYIGDVSEKGLHHLVSEVVDNSIDEALAGYCTDINVTINEDNSITVKDNGRGIPVDYHEKEKKSALEVVLTVLHAGGKFDKGTYKVSGGLHGVGVSCVNALSIYLKAEIHKDGKIYVQEYSKGKPY-ADVKIVGET-KESGTIITFKPDDTIFTTMEYRYDILATRLRELAYLNAGVTLTLTDKREGVFKTERFYSETGLKEFVRYIDKNKESLIQEPIHI----------VTEKNGIPIEIALTYNDTYNENIYSYVNNINTIEGGAHLTGFRRGLSRTLKKYAEDSKMLDKVKVEISGDDFREGVTAVLSVKVAEPQFEGQTKTKLGNSEVIGAVDQAIGEALKYYLEEHPKDARVIVEKVILAATARQAARKAREMVQRKSPLSGAGLPGKLADCSSKDPSQSEIFLVEGDSAGGTAKQGRNRIFQAILPLRGKILNVEKAMPHKVLESDEIKNIYTALGVSIGKELNIEKLRYHKIILMTDADVDGSHIDTLILTFFFRYMRLLIESGYVYIATPPLYLCKKGKIEEYCYNDQQRQAFINKYADGNIHTQRYKGLGEMNAEQLWETTMNPENRTLKQVTIENAADADIIFSMLMGEEVAPRREFIEENATYA-NID. 651
19 0.000e+00gi|548238199|ref|WP_022456465.1| dNA gyrase subunit B [Parabacteroides sp. CAG:409]  clstr ali  49  1MSEENTSSDYSADSIQVLEGLEAVRKRPAMYIGDISEKGLHHLVYEVVDNSIDEALAGYCSNVDVIINEDNSIVVTDNGRGIPVDIHEKEGKSALEVVLTVLHAGGKFDKGTYKVSGGLHGVGVSCVNALSTYLKAEVRRNGHIYMQEFSCG-KPLHDVQMVGDAD-TTGTTITFKPDGSIFTVTEYKYDILATRLRELAFLNAGITLRLTDKRDGTYKSETFHSNEGLKEFVHYIDRSKEKLIPDVIHI----------VTEKQGIPVEVAMTYNTSYNESVFSYVNDINTIEGGTHVAGFRRGLTRTLKKYAEDSKLLEKAKVEIQGDDFREGLTAVISIKVAEPQFEGQTKTKLGNSEVTGAVDQAVGEALGYYLEEHPKEAKTIVEKVVLAASARQAARKAREQVLRKSPLTGGGLPGKLADCQSKDASLCELFLVEGDSAGGTAKQGRNSKFQAILPLRGKILNVEKAMDHKVFESEEIQNIYRAMGVTIGTELNMDKLRYHKVIIMTDADVDGSHIATLILTFFFRRMRALIENGYVYLATPPLYLCKKGKVEEYCWTDQQRQAFILKYGGKQIQTQRYKGLGEMSDHQLWETTMNPENRTLKQITIDNAAEADQIFSMLMGEDVGPRREFIEENATYA-NID. 650
20 0.000e+00JGI.Meta 7024792624 SRS013951_WUGC_scaffold_12317__gene_20361 DNA gyrase, B subunit [Human Stool microbiome from visit number 1 of subject 7  ali  51  9...KKMSNNYDAEQIQVLEGLEAVRKRPGMYIGSTSTRGLHHLVYEIVDNSVDEALAGYCNHIEVFINPDNSITVVDNGRGIPVGIQEKTGKSALEVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVEVTRDGHVYKQTYKRGN-VDSTLQIIANPEDKSGTKVTFLPDKTIFDDWIYDYDTLRTRLRETAFLTKGLKITLTDLRVDPPKERHFHYEGGIKEFVEYMNRHREALYDKVIYCEGL----------KDGVYVEVAMQHNDSYNEMIHSYVNNINTPEGGTHLTGFKSAITKIFNDYARKNNLLKEKEDNLSGEDLREGMSAIVSVKIGEPQFEGQTKQKLGNSEVRPVVENIVSEQLTYFLEQNPNIAKIIINKSVMXXKANLA--------------DNMALPGKLADCSDKDPKNCEIYIVEGDSAGGSAKKARSRATQAILPLRGKILNVEKARIDRILENAEIKAMITAFGTGIHENFDIDKLRYNKIIIMTDADVDGAHIATLLLTFFYRFMPDLIRKGHVYLAQPPLYKLEKNKKIWYAYSDDELNSILNEVGRDSNKIQRYKGLGEMDAEQLWETTMDPEKRILLKVDDDDESEIDMTFNVLMGDKVEPRRQFIETNAKFVKNLDI 648
21 0.000e+00gi|546668770|ref|WP_021884375.1| dNA gyrase subunit B [Clostridium sp. CAG:590]  clstr ali  49  3...KSQEQEYGADQIQILEGLEAVRKRPGMYIGTTSEKGLHHLVYEIVDNAVDEALAGYCNEITVTINKDGSVTVVDNGRGIPTGIQEKAGIPAVDVVFTMLHAGGKFGGGGYKVAGGLHGVGASVVNALSDWLEVEIYRDGKVHKQRYEKG-KIIHPLEVTGNT-RKRGTKVTFMPDETIFETLNFDFDTLRTRLREMAFLTKGLKITLADKRAGKEKEREFHYEGGIKEFVQYINRHKDPLYDKIIYCEG----------EKDGVIVEVAMQHNNSYSESVYTFVNNIGTIEGGTHLTGFRSAITKVFNDYARNNKMLKDNEDNLSGDDLREGLAAIVSIKIGDPQFESQTKIKLGNSEARTAVDSVVTEQLTIFLELNPKVAKIIVNKAIQAQRARIAARKARDVARKSTLSDSMALPGKLADCSDKNPENCEIYIVEGDSAGGSAKTARSRSTQAILPLRGKILNVEKARIDRILGNEEIKAMITAFGTGIHENFDISKLRYHKIIIMTDADVDGAHIATLMLTFFYRFMPDLIREGHVYLAQPPLYKLEKNKKVWYAYSDEELDNILKEVGRDNNKIQRYKGLGEMDATQLWDTTMDPEHRILLRVGIEDESEVDLTFNTLMGDKVEPRREFIEANAKFVKNLDI 640
22 0.000e+00gi|553956439|ref|WP_023152906.1| DNA gyrase, B subunit [Eubacterium brachy]  clstr ali  50  6MAKEVKNHNYGADQIQVLEGLEAVRVRPGMYIGSTGEKGLHHLVYEIVDNSVDEALAGYCKNIDVVIEEDNSIMVQDDGRGMPVDMHPKEKIPAVEVIHTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTRMEVEVKRDGNVYGLSFEKG-KIVEKLHVIGSTSK-TGSKTRFWPDPEIFEETVYDYETLEHRLREMAFLNKGIKITLEDRREGRKVKKEFHYEGGIKEFVAYMNSNKEPVHNEIVYFEAHGSDKNG----KGDMEIEIAFQYVDRYSELITSYANNINTVDGGYHLSGFKSALTRVFNDYAKKNKLLKDNDPALSGDDVREGITAVVSVKLTNPQFEGQTKGKLGNSEMRGFVESNTTEHVSAFLQENPNQAKAIINKAIQASRAREAARKARDIIRKNNVLEGFSLPGKLSDCQEKDPALSEIFLVEGDSAGGSAKQGRDRKRQAVLPLRGKILNVEKARLDKILNSDEIKNMITAFGCNIGDDFDIEKLRYHKIIIMTDADVDGAHIRTLLLTFFYRYMKPLVEGGYVYAAQPPLFQVKKGNEVHYTYSDREQEKLLAELSEKKVNIQRYKGLGEMDYHQLWETTMDYNTRTLIQITLEDVTMADEIFTTLMGDKVPPRKKFIEDNAKYVKNLDV 651
23 0.000e+00gi|547470700|ref|WP_022089474.1| dNA gyrase subunit B [Eubacterium sp. CAG:156]  clstr ali  51  3.NNTNVENEYGADQIQILEGLEAVRKRPGMYIGTTSTRGLHHLVYEIVDNAVDEALAGYCSEIDVQINKDNSITVKDNGRGIPVGINEKTGLPAVQVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSQWLEVKVCREGKIHYQKYEYG-HVVSELKVIGECDDFTGTEVTFLPDNTIFEDTVYQFKVLEERLRETAFLTKNLKIILRDVREEEPKEEIFHYEGGIKEFVSYLNEGKTALYDDILYCEGTV----------NNVYVEVALQHNDGYNENTISFVNNINTPEGGTQVEGFKRALTKTFNSYARTKKVLKDNEENLSGEDIREGLTAIISVKIEDPQFEGQTKQKLGNSEARAAVENVMSEQLTYFLEQNPNVGKIICEKAVLAQRARFAARNAREATRRKTALDVAALPGKLADCSDKDPKKCEIFIVEGDSAGGSAKKARTRATQAILPLRGKILNVEKARIDKIMANAEIRAMITAFGTGIQDDFDISKLRYDKIIIMTDADVDGAHIDTLMLTFFYRFMPELIKDGHVYLAMPPLYQVTRNKKNYYAYNDDELNKILTEIGRDNNKIQRYKGLGEMDASQLWETTMDPNTRILKQVKIDDETEIDKTFTTLMGDEVEPRREFIEANAKFVQNLDV 644
24 0.000e+00METAHIT MH0054 GL0062188 [Complete] locus=scaffold60272_2:263:2215:-  ali  56  1MEDEDKKEEYTEKNIQVLEGLEAVRKRPGMYIGTTAEAGLHHLVWEIVDNAIDEALAGYCTVVKVTINPGDTITVSDNGRGIPVGIVAKTGKSAVETVYTVLHAGGKFGEGGYKVSGGLHGVGASIVNALSSWLEVVVHKEGGIFKIRFENGGHVAKPLERIGDATD-TGTIVTFKPDASIFETTIYNYDTIRDRLRQMAFLNKGVKIIVRDERTSDVREDVFHYEGGVKEYVKYLNANKTPLFEDVIYCEGIDS----------GIVVEVAMQYNDSYSANVYSFCNNINTHEGGTHEEGFRMALTRIINAYARQNKFLKDNDDNLTNDDVREGLTAIISVKHPNPQYEGQTKTKLGNSEVRKIVSNVVGTQLERYLLENPKTAKLIIDKVVLASNARLAARNAREATRRKSALDVASLPGKLADCSSKDAEKCELFIVEGNSAGGSAKNGRDRETQAILPLRGKILNVEKAQQKRIFNNAEIGNMIIAIGGGFGPEFDVSKIRYHKIVIMTDADVDGSHIRILLLTFFYRYMRPLIENGYVYIAQPPLYRATYRQKHYYCYNDEQLEVLKSKLPNAKLDIQRYKGLGEMDDNQLWETTMDPEARKMMRVALDDAIEADLVFDMLMGEKVEPRKEFINKYAKFVKNLDI 650
25 0.000e+00METAHIT O2 GL0055790 [Complete] locus=scaffold20280_2:8215:10152:-  ali  51  1MSENQENQNYDENQIQVLEGLEAVRKRPGMYIGSTGPKGLHHLVYEIVDNSIDEALAGFCSEIRVDILEGNVIRVSDNGRGIPTGIHPKEGISAATVVYTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLELTVKDGSSVHFQRFERGE-YSEPLKIIGETE-ETGTSVMFKADGEIFEDTTYDYEVLLKRLREQAFLNAGIKIVFSDKRDEEIKSEVLHYEGGIRQFVEHIHKTKESLSDKVIYVSGM----------QGDSFAEVAMQYNDSYNEVILSFANNIHTVDGGSHETGFKNALTKVINEYGKKFNLLKDGE-KLLGDDVREGLTAIISVKLTDCEFEGQTKGRLGNPEVKGFVEKMVMEKLMCYLEENPVEAKAIFEKSVAAQRAREAAKKARETARRKTAMESASLPGKLADCSEHDTEMTEIYIVEGDSAGGSAKEGRDRRYQAILPLWGKMLNVEKARIDKVYGNEKLMPVVTALGTSIGEDFDISKLRYGKIIIMADADVDGSHIRTLLLTFFFRFMKPLITNGNIYIAQPPLFKVFRGKKVRYAFSDEERDEYIAELNGTKPEVQRYKGLGEMDPEQLWETTMNPETRTMLKIDMEDAVKADETFTILMGDKVAPRREFIEANAKYVENLDI 645
26 0.000e+00  ali  56  1MEDEDKKEEYTEKNIQVLEGLEAVRKRPGMYIGTTAEAGLHHLVWEIVDNAIDEALAGYCTVVKVTINPGDTITVSDNGRGIPVGIVAKTGKSAVETVYTVLHAGGKFGEGGYKVSGGLHGVGASIVNALSSWLEVVVHKEGGIFKIRFENGGHVAKPLERIGDATD-TGTIVTFKPDASIFETTIYNYDTIRDRLRQMAFLNKGVKIIVRDERTSDVREDVFHYEGGVKEYVKYLNANKTPLFEDVIYCEGIDS----------GIVVEVAMQYNDSYSANVYSFCNNINTHEGGTHEEGFRMALTRIINAYARQNKFLKDNDDNLTNDDVREGLTAIISVKHPNPQYEGQTKTKLGNSEVRKIVSNVVGTQLERYLLENPKTAKLIIDKVVLASNARLAARNAREATRRKSALDVASLPGKLADCSSKDAEKCELFIVEGNSAGGSAKNGRDRETQAILPLRGKILNVEKAQQKRIFNNAEIGNMIIAIGGGFGPEFDVSKIRYHKIVIMTDADVDGSHIRILLLTFFYRYMRPLIENGYVYIAQPPLYRATYRQKHYYCYNDEQLEVLKSKLPNAKLDIQRYKGLGEMDDNQLWETTMDPEARKMMRVALDDAIEADLVFDMLMGEKVEPRKEFINKYAKFVKNLDI 650
27 0.000e+00  ali  51  1MSENQENQNYDENQIQVLEGLEAVRKRPGMYIGSTGPKGLHHLVYEIVDNSIDEALAGFCSEIRVDILEGNVIRVSDNGRGIPTGIHPKEGISAATVVYTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLELTVKDGSSVHFQRFERGE-YSEPLKIIGETE-ETGTSVMFKADGEIFEDTTYDYEVLLKRLREQAFLNAGIKIVFSDKRDEEIKSEVLHYEGGIRQFVEHIHKTKESLSDKVIYVSGM----------QGDSFAEVAMQYNDSYNEVILSFANNIHTVDGGSHETGFKNALTKVINEYGKKFNLLKDGE-KLLGDDVREGLTAIISVKLTDCEFEGQTKGRLGNPEVKGFVEKMVMEKLMCYLEENPVEAKAIFEKSVAAQRAREAAKKARETARRKTAMESASLPGKLADCSEHDTEMTEIYIVEGDSAGGSAKEGRDRRYQAILPLWGKMLNVEKARIDKVYGNEKLMPVVTALGTSIGEDFDISKLRYGKIIIMADADVDGSHIRTLLLTFFFRFMKPLITNGNIYIAQPPLFKVFRGKKVRYAFSDEERDEYIAELNGTKPEVQRYKGLGEMDPEQLWETTMNPETRTMLKIDMEDAVKADETFTILMGDKVAPRREFIEANAKYVENLDI 645
28 0.000e+00JGI.Meta 7062859359 C5335603__gene_367555 DNA gyrase, B subunit [Human Supragingival plaque microbiome from visit number 1 of subject 159814  ali  50  6MAKEVKNHNYGADQIQVLEGLEAVRVRPGMYIGSTGEKGLHHLVYEIVDNSVDEALAGYCKNIDVVIEEDNSIMVQDDGRGMPVDMHPKEKIPAVEVIHTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTRMEVEVKRDGNVYGLSFEKG-KTVEKLHVIGSTSK-TGSKTRFWPDPEIFEETVYDYETLEHRLREMAFLNKGIKITLEDRREGRKVKKEFHYEGGIKEFVAYMNSNKEPVHNEIVYFEAHGSDKNG----KGDMEIEIAFQYVDRYSELITSYANNINTVDGGYHLSGFKSALTRVFNDYAKKNKLLKDNDPALSGDDVREGITAVVSVKLTNPQFEGQTKGKLGNSEMRGFVESNTTEHVSAFLQENPNQAKAIINKAIQASRAREAARKARDIIRKNNVLEGFSLPGKLSDCQEKDPALSEIFLVEGDSAGGSAKQGRDRKRQAVLPLRGKILNVEKARLDKILNSDEIKNMITAFGCNIGDDFDIEKLRYHKIIIMTDADVDGAHIRTLLLTFFYRYMKPLVEGGYVYAAQPPLFQVKKGNEVHYTYSDREQEKLLAELSEKKVNIQRYKGLGEMDYHQLWETTMDYNTRTLIQITLEDVTMADEIFTTLMGDKVPPRKKFIEDNAKYVKNLDV 651
29 0.000e+00gi|501263944|ref|WP_012306962.1| DNA gyrase subunit B [Synechococcus sp. PCC 7002]  clstr ali  50  2......TSNYSAQQIQVLEGLEPVRKRPGMYIGTTGPRGLHHLVYEVVDNSVDEALAGYCTEINVEINADGSVTVTDNGRGIPVDVHPSTGKSALETVMTVLHAGGKFGAGGYKVSGGLHGVGVSVVNALSEWVEVTVWRDETTYKQRYERGVP-QGELTEAPAPQHLSGTSVCFLPDAKIFETTVFDYNTLAGRLRELAYLNAGVRIVFTDHRSEKQASNTYFYEGGIKEYVAYMNREKSPLHEEIIYVTG----------EKNGVQLEVALQWTDAYSDNLLGFANNIRTVDGGTHLEGLKSVLTRTMNTVARKRNKLKDNDSNLAGENIREGLTAVISVKVPDPEFEGQTKTKLGNSEVRGIVDSFVGEVLTEYFEFNLNVVDAILEKAIQAFKAAEAARRARELVRRKSVLESSLLPGKLADCSERDPAKTEIYLVEGDSAGGSAKQGRDRAFQAILPLRGKILNIEKTDDAKIYKNNEIQSLITALGLGIGEEFNPEKLRYHRVVIMTDADVDGAHIRTLLLTFFYRYQRELVDQGYIYIACPPLYKLERGKNHAYCYSDRELQDQISQLPNAKYNIQRFKGLGEMMPQQLWDTTMNPESRTLKRVEIEDAAEADRIFTVLMGDRVAPRREFIEMNAPNMDDLDI 640
30 0.000e+00gi|492845170|ref|WP_005999124.1| DNA gyrase subunit B [[Eubacterium] infirmum]  clstr ali  50  1MSEEKVNTQYDAAQIQVLEGLEAVRKRPGMYIGSTGARGLHHLVYEVVDNSVDEALAGYCKHIKIIINKDGSLTVEDDGRGMPVDNHPKLGIPAVEVIHTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTDMVVEIKRNGKIYRQEYKRG-KTVTPLEVIGES-KSTGSKTTFWPDAEIFETIEFDYDTLQHRFREMAFLNKGIKISITDERDTPKKKEVFHYEGGLKEYVHYINQNKEVLHKEVIYFE---------VENKNSMEVEVALQYTDRYNEFILSYANNINTTDGGTHMAGLKSALTRAINDYAKKSKILKDSDPALSGEDIREGITAIVSVKLAQPQFEGQTKAKLGNSEVRGFVETATNDNLTAYLEEHPQEAKIIIEKCIRASRAREAARKARDITRRKNALDSTSLPGKLADCSEKDPALSEIFLVEGDSAGGSAKQGRDRSRQAVLPLRGKILNVEKARLDKILNSEEIKNMITAFGCGVGNDFDASKLRYHKIIIMTDADVDGAHIRTLLLTFFFRHMTPLIEGGYVYAAKPPLFMTKQGKDVYYTYSEPEQDKLLAELSGKKIDIQRYKGLGEMDFHQLWETTMDFNNRTLVQITMDDASQADEIFTILMGDKVPPRKKFIEDNAKYAE-IDI 641
31 0.000e+00gi|546850527|ref|WP_021897802.1| dNA gyrase subunit B [Faecalibacterium sp. CAG:1138]  clstr ali  52  3...ERVESNYDESAIQVLEGLEPVRKRPGMYIGSTDERGLHHLVYEVVDNAIDEASAGYCDYIRITLQHDGSCMVEDNGRGIPTGIIEKEGKSAVEVVLTKLHAGGKFGGGGYKISGGLHGVGVSCVNALSEWLEATVYQNGKVFKQVFNRGV-AQAPLKEIGPSDGRTGTTITFYPDDEIFETLDFNYDTLKVRIRELAYLNRGITIEFNDLRPDEPRREKFHYEGGIVQFVNTLNQGKETVFPEVIYIDDTY----------ENGEIELALQYNDSYTDTVYAFANNINTVEGGTHLEGFKASLTKIINDYAKKANIIK-GDEKLSSEDVREGLTAVLSVKLTNPQFEGQTKTKLGNSEMRSVVSKAVTEHLGSYLEEHPKEAKDLIMKSVLAAKAREAARSARDLARRKSALESTTLPGKLADCTDKDPSLCEIYMVEGDSAGGTAKTGRDRRFQAILPLRGKILNVEKARLHRVLENEEIKSMITAFGCGINQDYNEEKLRYNRIICMTDADVDGSHIRILLLTFFFRFMRPLIENGHVYIAQPPLYKVQRQKTIKYCYSDDELRQTLAEMGGKGTEVQRYKGLGEMDAEQLWETTMNPQTRILLKVTMEDAVSADQTFSLLMGEQPELRRKFIEDNATLVADLDI 637
32 0.000e+00gi|640529171|ref|WP_024963116.1| DNA gyrase subunit B [Trueperella pyogenes]  clstr ali  49  1MAENENDQTYDASNITVLEGLEAVRKRPGMYIGSTGERGLHHLVYEVVDNSVDEALAGFCDHIEITLLENGGCRVSDNGRGIPVDIHPTEGLPAVQVVMTVLHAGGKFGNGGYAVSGGLHGVGVSVVNALSTRMDTEVRRDGYVWRISYENGVPV-APLE-KGEPTDETGTTQTFWPNGDIFETIDFDFETLRHRLQQMAFLNKGLRITLTDEREGEEVEVTYKYDGGLLDYVKHLVKTKEPVHADPIYFEAEDQEKK--------ISVEVAMQWTTSYSETLHTFANTINTTEGGTHEEGFRTALTSVINKYARDKGLLKEKDANLSGDDIREGLAVVISVKLGEPQFEGQTKTKLGNTEARTFVQQQTYAQITDWLDMNPSDAKEVIRKATQAYQARIAARKAREATRRKSVLESASMPGKLKDCTSRDPQECEIFIVEGDSAGGSAVNGRDPQHQAIMPIRGKILNVEKARLDRALSSDSIQNLITAFGTGVGEEFDIGKLRYHKIVFMADADVDGQHIATLLLTLVYRYMRPLIEAGYVYLAMPPLYRIKWTNAHQYVFSDAERDAVLKEGKAEGQGIQRYKGLGEMNDSELWDTTMNPETRTLKRVNIGEAAATDEAFSILMGEDVGSRRSFIQRNARDVRFLDI 678
33 0.000e+00METAHIT V1 GL0107692 [Complete] locus=scaffold15858_6:6253:8178:-  ali  51  1MTME--NDNYGAEQIQVLEGLEAVRKRPGMYIGSTSSTGLHHLVYEIVDNSVDEALAGYCTHIQVYINEDNSITVVDDGRGIPVGIHKKQGIPAVEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSTWLEVEITRDGKVYKQRYEKG-KVMYKLQVIGEPEGVSGTKVTFLPDHTIFEDNIYDYDILRNRLREMAFLTKGLKISLTDKRLIPEKVRSFHYEGGIKEFVTYLNRHRDPLYNEVIYCEGV----------RDGISVEVALQHNDSYNESTYSFVNNINTPEGGTHLTGFKSAITKVFNDYARKNNIIKDKDDNLSGDDLREGLAAIVSIKISDPQFEGQTKQKLGNSEARPAVESVVTEQLTYYLEQNPQIAKIIVNKAAVAQRARIAARKARDVARKANLSDNMALPGKLADCSDKDPKNCEIYIVEGDSAGGSAKTARSRATQAILPLRGKILNVEKARIDRILGNEEIKAMITAFGTGIHENFNIEKLRYNKIIIMTDADVDGAHIATLLLTFFYRFMPDLIRKGHVYLAQPPLYKLEKNKKVWYAYSDDELNSILDEVGRDNNKIQRYKGLGEMDAEQLWETTMDPEKRILLRVDDDDESEIDMTFNVLMGDKVEPRREFIETNAKYVKNLDI 641
34 0.000e+00  ali  46  1MTEEQINSNYSAENIQVLEGLEAVRKRPAMYIGDISTKGLHHLVYEVVDNSIDEALAGYCDHIEVTINEDNSITVQDNGRGIPVDFHEKEQKSALEVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTHMTTQVFRNGKIYQQEYECG-HPLYPVKEIGTSDI-TGTRQQFWPDNTIFTDTVYNYEILATRMRELAYLNAGIKITLTDLRENNAKMEIFYSEEGLKEFVRYIDSSREHLVNDVIYI----------NTEKQGTPVEVAIMYNTSYNENIHSYVNNINTIEGGTHLAGFRRALTRTLKKYADDNKMLEKAKVEIAGDDFREGLTAVISIKVAEPQFEGQTKTKLGNSEVMGAVDQAVGEALNYYLEEHPKEAKMVVDKVILAAQARVAARKARESVQRKSPMSGGGMPGKLADCSSKDPEECELFLVEGDSAGGSAKQGRDRRFQAILPLRGKILNVEKAMWHKAFESDEVNNIIQALGIRFGKEANIDKLRYKKVIIMTDADVDGSHIDTLIMTLFFRYFPQVIRNGYLYIATPPLYLCKKGKVEEYCWTDQQRQKFIDTYGGGSVHTQRYKGLGEMNPEQLWSTTMNPENRMLKQISIENAAEVDYIFSMLMGEDVGPRREFIEKNATYA-NID. 652
35 0.000e+00gi|551008725|ref|WP_022753294.1| DNA gyrase subunit B [Butyrivibrio fibrisolvens]  clstr ali  51  1MSNNEEVQ-YGADQIQILEGLEAVRKRPGMYIGTTAARGLHHLVYEIVDNSVDEALAGACDHIEVTITPGNTIIVKDNGRGIPTGINHKSGLTGVEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVKVKQGGKIYMQRYERG-HVCYPLKEIGTCEEDTGTCVEFKPDAEIFETTVFDYNVLRQRLREMAFLTRGLKISLTDERIPEPRVEHFHYEGGISEFVAYLNKSKTPLYDQIMYFEG----------DKNEVHVEVSVQHNDAYNESIYTFVNNINTPEGGTHLEGFKIATTKIFNDYAKAQKLVKETDENLTGEDIREGMTAIISVKIGDPQFEGQTKQKLGNSEARGAVASIVSEQLTYFLEQNPQIAKTIIEKAVLAQRARDAARKARDLTRRKTALDGLGLPGKLADCSDKNPENCEIFIVEGNSAGGSAKNARSRATQAILPLRGKILNVEKASVDRIYGNAEIKTMITAFGTGIHEDFDISKLRYGKIIIMTDADVDGAHIATLMLTFLYRFMPELIKQGHVYLAQPPLYKLERNKKTWYAYSDEELNNIIAQVGRDNNKIQRYKGLGEMDAEQLWETTMNPETRTLLRVNMDDDAESDVTFTTLMGDKVEPRREFIEANAKFVQNLDI 649
36 0.000e+00  ali  51  9...KKMSNNYDAEQIQVLEGLEAVRKRPGMYIGSTSTRGLHHLVYEIVDNSVDEALAGYCNHIEVFINPDNSITVVDNGRGIPVGIQEKTGKSALEVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVEVTRDGHVYKQTYKRGN-VDSTLQIIADPEDKSGTKVTFLPDKTIFDDWIYDYDTLRTRLRETAFLTKGLKITLTDLRVDPPKERHFHYEGGIKEFVEYMNRHREALYDKVIYCEGL----------KDGVYVEVAMQHNDSYNEMIHSYVNNINTPEGGTHLTGFKSAITKIFNDYARKNNLLKEKEDNLSGEDLREGMSAIVSVKIGEPQFEGQTKQKLGNSEVRPVVENIVSEQLTYFLEQNPNIAKIIINKSVMXXKANLA--------------DNMALPGKLADCSDKDPKNCEIYIVEGDSAGGSAKKARSRATQAILPLRGKILNVEKARIDRILENAEIKAMITAFGTGIHENFDIDKLRYNKIIIMTDADVDGAHIATLLLTFFYRFMPDLIRKGHVYLAQPPLYKLEKNKKIWYAYSDDELNSILNEVGRDSNKIQRYKGLGEMDAEQLWETTMDPEKRILLKVDDDDESEIDMTFNVLMGDKVEPRRQFIETNAKFVKNLDI 648
37 0.000e+00JGI.Meta 7007385746 SRS016095_WUGC_scaffold_39576__gene_110731 DNA gyrase, B subunit [Human Stool microbiome from visit number 1 of subject  ali  51  1MSENQENQNYDENQIQVLEGLEAVRKRPGMYIGSTGPKGLHHLVYEIVDNSIDEALAGFCSEIRVDILEGNVIRVSDNGRGIPTGIHPKEGISAATVVYTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLELTVKDGSSVHFQRFERGE-YSEPLKIIGETE-ETGTSVMFKADGEIFEDTTYDYEVLLKRLREQAFLNAGIKIVFSDKRDEEIKSEVLHYEGGIRQFVEHIHKTKESLSDKVIYVSGM----------QGDSFAEVAMQYNDSYNEVILSFANNIHTVDGGSHETGFKNALTKVINEYGKKFNLLKDGE-KLLGDDVREGLTAIISVKLTDCEFEGQTKGRLGNPEVKGFVEKMVMEKLMCYLEENPVEAKAIFEKSVAAQRAREAAKKARETARRKTAMESASLPGKLADCSEHDTEMTEIYIVEGDSAGGSAKEGRDRRYQAILPLWGKMLNVEKARIDKVYGNEKLMPVVTALGTSIGEDFDISKLRYGKIIIMADADVDGSHIRTLLLTFFFRFMKPLITNGNIYIAQPPLFKVFRGKKVRYAFSDEERDEYIAELNGAKPEVQRYKGLGEMDPEQLWETTMNPETRTMLKIDMEDAVKADETFTILMGDKVAPRREFIEANAKYVENLDI 645
38 0.000e+00JGI.Meta 7067050650 SRS062544_LANL_scaffold_69498__gene_88044 DNA gyrase, B subunit [Human Tongue dorsum microbiome from visit number 3 of s  ali  53  2......SAEYGADQIQILEGLEAVRKRPGMYIGSTSLKGLHHLVYEIVDNSVDEALAGECSHIEVFINEDNSITVVDDGRGIPVGINKKSGLPAVQVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSKWLEVLVETDGKAYKQRYERG-KVVTPLEEIGPTD-RHGTTVTFLPDEEIFEDTVFDYATIKQRLREMAFLTKGLRISLTDKREDGKKTDSFHYEGGIMEYVSYLNKNQTVLYDKIIYCEG----------KKGTVQVEVALQHNDGYNEGCYSFVNNINTPEGGTHLTGFRNALTKTFNEYAKLMKLVKENDPALTGEDIREGMTAIVSIKIPEPQFEGQTKQKLGNSEARGAVESIAGEQIMIFLEQNPAIGKMIVEKALLAQRARDAARKARDLTRRKTALEYMNLPGKLADCSDKNPDNCEIYLVEGDSAGGSAKDARDRATQAILPLRGKILNVEKSRLDKILENKEIQSMITAFGTGIHEDFDINKLRYKKIIIMTDADIDGAHIDTLMLTFIYRFMPELIRKGHVYLAQPPLYKVEKGNKIWYAYNDKELENIMSEIGRDNNKIQRYKGLGEMDAEQLWETTMDPERRVLLKVMMENASEIDLTFNTLMGDKVEPRREFIEQNAKYVRNLDI 636
39 0.000e+00gi|489624816|ref|WP_003529256.1| MULTISPECIES: DNA gyrase subunit B [Clostridium]  clstr ali  52  1MENNETNEEYGASDIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNAIDEALAGYCDKIDVRILPGDIIVVEDNGRGIPVGIQPKMGIPAVTVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTWLEVEVSDGAHIYRQRFERG-KTITDLEMIGDTTK-TGTKVTFQADPEIFESTVYEYETLETRLREQAFLNAGIHIELVDERDPENRQKNFLYEGGISSFVEFLHKRKEVIHPDIIHVKGALTDGSA--------EAEVAMQYNESYNELLISFANNIHTTDGGTHEEGFKRALTRIMNDYARKYNILKDGDKNLSGEDVREGLTAIISVKLKEAQFEGQTKAKLGNTEIRTLVDNLISEKLSAYLEENPATARAIFEKAMAASRAREAARKARELVRRKSALESAALPGKLADCQSRNPEETEIYIVEGDSAGGSAKGGRDRKFQAILPLWGKMLNVEKARLDKVYGNDKLMPVITALGCGIGDEFDLAKLRYGKVIIMADADVDGSHIRTLLLTFFFRFMKPLIEEGHIYIAQPPLYRLTKGKNHYYAYSDKERDQMLKEMTVTAP-IQRYKGLGEMDSEQLWETTMNPETRIMLKVELEDAAAADETFTILMGDKVEPRREFIEKNAKYVQNLDV 646
40 0.000e+00gi|503042030|ref|WP_013277006.1| DNA gyrase subunit B [Acetohalobium arabaticum]  clstr ali  54  1MDRNEFNHTYDADQIQVLEGLEAVRKRPGMYVGGTGARGLHHLVYEVVDNSIDEALAGYCDNIEVIIEPGNVVTVIDDGRGIPISSHPNLNKPAVEIVMTVLHAGGKFDNEGYKVSGGLHGVGVSVVNALSEWLEVEVMRDNKIYHQRYEEGVPVK-DLTVIGES-QASGTMIKFKPDLEIFESIDFEYKKLIKRLKELAYLNKGIKIEIKDKRRDEIKTDIFQYDGGIVSFVQELNENKDPIHEEPIYFE----------TEEEDNHIEVAIQYNETYVDNIFTFANNINTHEGGNHLSGFKSALTRTINDYARRHDYLKEDDSNLSGDDIREGIVAIVNVKLPDPQFEGQTKTKLANSEVRGIVDSVVSENLDRFLEEDPEIGSIIVQXXXXXXXXXXXXXXXXXLTRRKSALTSTALPGKLADCSSRDPEESELYIVEGDSAGGSAKQGRDRKFQAILPLKGKILNVEKARLNKILNNNEIRSLITALGTGIGKEFDMEQARYKKIIIMTDADVDGAHIRTLLLTFFYRYMRPLLEAGNIYIAQPPLYKVNKGRKEYYVYNDRKLEELLNEIGRSGISIQRYKGLGEMNPKQLWETTMDPENRTTLQVQIEDAVMADDIFTTLMGDKVAPRRKFIQKHAKEVKEIDI 639
41 0.000e+00gi|503217790|ref|WP_013452451.1| DNA-cytosine methyltransferase [Marivirga tractuosa]  clstr ali  50  1MSTEKKNKDYSAGNITVLEGLEAVRKRPAMYIGDVGVKGLHHMIWEVVDNSIDEAMAGHCTTITVEINEDNSVTVMDDGRGIPVDIHEKEGRSALEVVMTVLHAGGKFDKDSYKVSGGLHGVGVSCVNALSTMLKATVYRDGKIYEQEYSEGFP-KEPVKPVGETD-VTGTKIQFKPDASIFMETEFKYETVASRLRELAYLNAGIKIKLQDHRDGDSKEENFFSEGGLLEFVEYLDVSREKLIPQPIYMEG----------EKNGVPVQVALNYNTSYSENVVSYVNNINTIEGGTHVSGFRRALTRTLKSYADKSGLLEKQKIEITGDDFREGLTAIISVKVAEPQFEGQTKTKLGNSDVMGAVESCVSETLQYFLEENPKAAKTIVQKVILAAQARNAAKKAREMVQRKNVMSGSGLPGKLADCSEKDPSICELYLVEGDSAGGSAKQGRDRNFQAILPLKGKILNVEKAQEHKIYDNDEIKNILTALGVRFGTELNLEKLRYHKIVIMTDADVDGSHIRTLILTLFFRYMRELIDMGYVYIAQPPLYLIKRGKTERYVFTEDERVEVVKEISPDGVHLQRYKGLGEMNPEQLWTTTMDPHTRKMKQVSVESAAEADHLFSMLMGDEVPPRRDFIEKNAKYAK-IDI 653
42 0.000e+00gi|651641671|ref|WP_026627483.1| DNA gyrase subunit B [Dysgonomonas capnocytophagoides]  clstr ali  48  1MTDKEKNDSYSADNIQVLEGLEAVRKRPAMYIGDIGEKGLHHLVYEVVDNSIDEALAGFCSDIKVSINEDNSITVWDNGRGIPVDFHEKEQKSALEVVLTVLHAGGKFDKGTYKVSGGLHGVGVSCVNALSTYLRAEVRRQGKLYMQEFSCG-KPLHDIEVLGDAEDS-GTTITFKPDTSIFIVSEYKYDTLASRLRELAFLNAGVRLSLTDLRDGSYKSEVFYSEKGLEEFVKYIDSSKEALIDHVIHI----------TTEKQGIPVEVAMTYNTSYNENIFSYVNNIHTIEGGTHLTGFRRGLSRTLKKYADDMKMLEKVKVEISGDDFREGLTAVVSIKVAEPQFEGQTKTKLGNNEVIGAVDQAVGEALGYYLEEHPKEAKTIVEKVILAATARYAARKAREMVQRKSPLTGGGLPGKLADCSSKDAMSCEIFLVEGDSAGGTAKQGRDRGFQAILPLRGKILNVEKAMPHKVLESEEIKNIYTALGVSIGKELNIEKLRYHKVVIMTDADVDGSHIATLILTFFFRHMRPLIERGYVYIATPPLYLCKKGKIEEYCWDDRQRQAFIDKYGEGNIHTQRYKGLGEMNASQLWDTTMNPEHRTLRQVTIENAAEADHIFSMLMGEDVAPRREFIEDNATYAK.... 649
43 0.000e+00gi|494091402|ref|WP_007032233.1| DNA gyrase subunit B [Amycolatopsis decaplanina]  clstr ali  49  1MTENK--SEYNASSITVLEGLEAVRKRPGMYIGSTGERGLHHLVQEVVDNSVDEAMAGFATKVEVTLLADGGVRVVDDGRGIPVDMHPKEQKPTLEVVLTVLHAGGKFDSDSYAVSGGLHGVGVSVVNALSTKLIAEVKRGGHSWRQVYTDQVP--GELEDLGPAED-TGTTITFWADGDIFETTTYNFETISRRLQEMAFLNKGLTLSLRDERVADEKEKTYCYPGGLEDFVKHINGSKDPIHASVISFEAKGT----------GLEVEVAMQWNNGFTPSVYTFANTINTHEGGTHEEGFRAALTRVVNAYAREKKLLKEKDANLSGDDVREGLAAIVSIKLSEPQFEGQTKTKLGNSEAKTFVQQTSNEWLADWFERNPTEAKTIINKSISSAQARMAARKARDLVRRKGALEIGGLPGKLKDCRSTNPSECELYIVEGDSAGGSAKEGRDSMYQAILPIRGKIINVEKARIDRVLKNTEVQSLITALGTGIHEEFDIEKLRYHKIVLMADADVDGQHITTLLLTFLFRFMPPLIEHGHVFLSRPPLYKIKWPRQDEYAYSDRERDAVIQEAGRKLPKIQRYKGLGEMNAEELWETTMDPANRLLGQVTLDDAAQADDLFSVLMGEDVEARRSFITRNAKDVRFLDV 655
44 0.000e+00gi|505170637|ref|WP_015357739.1| DNA gyrase subunit B [[Clostridium] stercorarium]  clstr ali  48  3.SEVEKDKKYDEEQIQVLEGIEAVRKRPGMYIGSTSVRGLHHLVYEILDNSIDEALAGFCDKIKVIIHKDNSVTNIDNGRGIPVGIHPKMGIPTLEVVHTTLHSGGKFGGSGYKVSGGLHGVGAAVVNALSEWMVVEVMRDGKRYRQRYERGKAVTG-IEIVGEAD-STGTITTFKPDPEIFEVVEFDYEMLLKRFREIAFLNKGLTIQFIDERGDEVKENILHYEGGIISFVKYINQNKDVIHDDIIYLEG----------QKENMEIEIAFQYTDSFNENIFSYANNIPTTEGGTHVTGFKAAITKVINDYARKINMLKDNDKNLSGEDVREGITAIINMKLTDPQFEGQTKTKLGNADVRQFVENLVTEKLQYILEENPKTARIIVEKSLASYRAREAARKARELTKRKSAMENFSLPGKLADCQEKDPRLCELFIVEGDSAGGSAKMGRDRRYQAILPLWGKMLNVEKSRADKVYGNDKLTPIITALGAGFGDDMDLSKLRYHKVIIMADADVDGHHIRTLLLTFFYRYMRPLIENGHVYIALPPLYKVSKGKEEYYVYNDNELEKLLKEKGWKRGEIQRFKGLGEMNPEQLWETTMDPKTRKMLKVDLNNPVEAEEIFTILMGEKVEPRKEFIHQYAKKVNNLDV 643
45 0.000e+00gi|548190859|ref|WP_022411619.1| dNA gyrase subunit B [Ruminococcus sp. CAG:330]  clstr ali  49  1MTEEMKQQSYDESQIQVLEGLEAVRKRPGMYIGSTGPKGLHHLVYEIVDNAIDEALAGYCTEITVDILPENVVRVTDNGRGIPVGIHPKEGISAATVVYTILHAGGKFGGSGYKVSGGLHGVGASVVNALSEWLKLTVKDGSHVYFQEFHRGN-YDKPIAVIGDTT-ETGTAVEFKADPEIFETTEYDFEVLLKRLREQAFLNAGIRIVFSDKRNEEPHTEILHYEGGIRQFVEYLQKKRESLSEDVIYVSGMD----------GDSFAEIALQYNDSYNDLILSFANNIHTADGGTHEIGFKNALTKVINEYGKKFGLLKDG-TRLLGDDVREGLTAIVSVKLTECEFEGQTKGRLGNPSVKPFVEKMVFDKLMTYFEENPTVARAIFDKSISAQVAREAARKAKETARRKSAMESASLPGKLADCSEKTTEGTELYIVEGDSAGGSAKEGRDRRYQAILPLWGKMLNVEKARIDRVYGNEKLMPVVTALGTSIGEDFDISKLRYGKVIIMADADVDGSHIRTLLLTFFFRFMRPLITNGNVFLAQPPLFKVSKGKKYKYAFDEAERDRYIAEFADAKVGVQRYKGLGEMSSEQLWETTMNPETRSMIRVDMEDAERADEIFTILMGDKVAPRKEFIEKNARYVQNLDV 648
46 0.000e+00gi|504400513|ref|WP_014587615.1| DNA gyrase subunit B [Methanosaeta harundinacea]  clstr ali  54  11....EVVEEYDASTIQVLEGLDAVRRRPAMYIGSTNLAGLHHLVYEVVDNSIDEAMAGRCSEINLVLHADGTASVRDDGRGIPVDIHEHYKKPALEIVMTKLHAGGKFDHKSYKVSGGLHGVGVSVVNALSEWMEVEVRRNNLVYWQRYERGRPV-SDLEVHGVSDH-TGTTVRFKPDPEIFEAVEFSFDTLASRLRELAFLNRGLKISVEDERT--AKRREYLYDGGIVSFVEHLNKNKDILHSPPIYF----------NREKDGTSVEVALQYNNTYNENVLSFANNINTREGGTHLAGFRAALTKTTNEYARANKLLKD-DTKLTGDDLREGLVAVISVRLADPQFEGQTKTKLGNSAVGGIVSSLVSEGLSEFFEENPLVTVKIVEKATQAYRARVAARKARELTRRKNALSSGGLPGKLADCAEKDPQLSELYIVEGESAGGSAKQGRNRHFQAILPLRGKILNVERARLDKILKNNEIRNIITALGTGIGDDFQLDRARYRKVVIMTDADVDGSHIRTLLLTFFYRYMRELVEAGYVYIAQPPLYQVKRGKAATYAYSEADLAGIL-EGSGGKATVQRYKGLGEMNPEQLWETTMDPERRTMLKVTLEDAMEADEIFSILMGEKVEPRREFIEAHARDVRNLDV 640
47 0.000e+00gi|518932959|ref|WP_020088834.1| DNA gyrase subunit B [Lactobacillus parabrevis]  clstr ali  51  8.TKAEQAREYDASQIQVLEGLEAVRKRPGMYIGSTSAQGLHHLVWEIVDNGIDEALAGFADSIHVTVEKDNSITVSDNGRGIPVDIQQKTGKPALETVYTILHAGGKFGGGGYKVSGGLHGVGASVVNALSTHLEVQVIRGGKRYGITFKRGNKPMYVMEE-GLDPDRHGTIVHFLPDPDIFETTTFDIKTLTTRVRELAFLNKGLRITIRDERPETPTEDDFHYEGGIRHYVDYLNENKTTLFEPPIYVEG----------EENGITVEVALQYTDDYHNNLLTFTNNIHTYEGGTHEEGFKRALTRVVNDYARQNKLMKDNEPNLTGDDVREGMTAVVSVKHPDPQFEGQTKTKLGNSDARTAVDHTFADHFMRYLMEHPDIARKVVDKGTLASKARVAAKRAREVTRKKSGLEISNLPGKLADNTSKDPAISELFIVEGDSAGGSAKQGRSRLTQAILPIRGKILNVEKASMDRILANEEIRSMFTAMGTGFGSDFDVSKANYHKLIIMTDADVDGAHIRTLLLTLIYRYMRPLLDAGYVYIACPPLYRVRQGKMQRYLDSDDELKELLGQLPAPKPQIQRYKGLGEMDAEQLWDTTMKPENRRLLRVDAQDAINADQVFSMLMGDKVAPRREFIEDNATFAE-LDV 648
48 0.000e+00gi|651430177|ref|WP_026530089.1| DNA gyrase subunit B [Arthrobacter sanguinis]  clstr ali  50  38......SKDYGASDITVLEGLEAVRKRPGMYIGSTGPRGLHHLVTEVVDNSVDEALAGYATHIEVTLLADGGVRVVDDGRGIPVDMHPTEGKPTLEVVMTVLHAGGKFGGSGYAVSGGLHGVGISVVNALSTHVDTVVKRQGYTWSMSFENGGEPIGGI-VKGEETTETGTSQSFWPDPEIFDVTDFDYETIRMRLQQMAFLNKGLRISLTDERTPEFRSVTYQYDEGLVDYVKFLNSAKESVHDEIISFSNEDT--------KERIALDIAMQWTAAYTESVYTYANNINTHEGGTHEEGFRAALTGLINRYAREKNLIKEKEENLTGEDIREGLTAVVSVKLSEPQFEGQTKTKLGNSIAKRFVQGVVNDQLGDWLERNPQTAREIVRKALQASQARIAARKARETTRRKGLMDSAGMPGKLKDCQSKDPSRSEIYIVEGDSAGGSAVQGRNPETQAILPLRGKILNVERARLDRALSNTEVQAMITAFGAGIGEDFDVQRARYHKIVLMADADVDGQHITTLLLTLIFRYMRPLIESGYVYLAQPPLYRIKWSNAHDYVFSDKERDDALAAGQAKGNGIQRYKGLGEMDYQELWETTMNPETRTLLQVTMEDAAAADQVFSVLMGDDVESRRNFIQQNAKDVRFLDI 701
49 0.000e+00  ali  49  1MSVANKPDHYDGSDIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEVVDNAVDEALAGYCDEIKVWIHQDNSISVDDNGRGIPIDKHPKEKIPTVEVVLTILHAGGKFGGEGYKVSGGLHGVGVSVVNALSSRVEVQVRKEGKEYFIGFDHG-KTSEKLREVGPTKRGNGTTVSFWPDPEIFETTVYDFDTLANRFREMAFLNKGLKIVLYDERDGNPRTEVFQYAGGIVDFVKFLNEGKETLN-KPIYFEA----------ENDDGTVEVAMQWSTSYSTNVMAFANNINTHEGGTHLDGFKQAVTRTINEYARSKGILKEKDSNLSGDDTREGCAAIVSVKLHDPQFEGQTKTKLGNTEIRPLVQNAVTQGLAEYLEENPTPAKRIIGKATQALKAREAARKAREMTRRKGVLDSFALPGKLADCSSKTPENSELFIVEGDSAGGSAKQARDRKTQAILPLRGKILNVERAGLHRSLSSDTISSLITAIGTNIGDDFDADQSRYHRIIIMTDADVDGAHIRILLLTFFYRYMPELINRGYIYIAQPPIFGLKKKKIERYIYDESSLGSVLAEYDDPKFDVQRYKGLGEMDPDQLWETTMEPATRTLLQVSIDDAAEAERVVSDLMGDQVEPRKEFIQKHARDVRFLDI 650
50 0.000e+00JGI.Meta 7014744543 SRS050422_LANL_scaffold_8481__gene_9223 DNA gyrase, B subunit [Human Stool microbiome from visit number 2 of subject 763  ali  46  1MSEDQNEGSYSADSIQVLEGLEAVRKRPAMYIGDISVKGLHHLVYEIVDNSIDEALAGYCDHIEVTINEDNSITVQDNGRGIPVDFHEKEQKSALEVAMTVLHAGGKFDKGSYKVSGGLHGVGMSCVNALSTHMVTQVYRNGKVYQQEYEIG-KPLYPVKEVGVSEH-TGTRQQFWPDNTIFTETVYKYEILAGRMRELAYLNAGIKITLTDRREGQFKQEVFYSEEGLKEFVRYLESSRDHLINDVIYL----------NTEKQGIPIEVAIMYNTGFSESIHSYVNNINTIEGGTHLAGFRRALTRTLKKYAEDSKMLEKVKVEIAGDDFREGLTGVISVKVAEPQFEGQTKTKLGNNEVMGAVDQAVGEALSYYLEEHPKEAKQIVDKVILAATARHAARKAREMVQRKSPMSGGGLPGKLADCSDKDATKCELFLVEGDSAGGTAKQGRNRAFQAILPLRGKILNVEKAMYHKALESEEIRNIYTALGVTIGTEEDIDKLRYHKIIIMTDADVDGSHIDTLIMTFFFRYMPQIIQNGYLYIATPPLYLCKKGKIEEYCWTDAQRQKFIDTYGGGSVHTQRYKGLGEMNAQQLWETTMDPENRMLKQVNIENAAEADYIFSMLMGEDVGPRREFIEDNATYA-NID. 654
51 0.000e+00gi|503475039|ref|WP_013709700.1| DNA gyrase subunit B [Carnobacterium sp. 17-4]  clstr ali  54  9.SKQDRAKEYDASQIQVLEGLEAVRKRPGMYIGSTSSEGLHHLVWEIVDNSIDEALAGFADEINLIIEKDESITVIDNGRGIPVDIQAKTGRPALETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSITLDVYVHKDGKIYHQQYAQG-KVVHDVEVIGETDK-HGTTVHFVPDPEIFETVEFHFDKLATRVRELAFLNKGLKITVEDKREGKEKFLEYHYEGGIKSYVEFLNENKTVLYDEPIFLEG----------EQQGITLEVAMQHTDGYHNNLLSFANNIHTYEGGTHEFGFKTALTRVINDYAKKNKIIKENEENLTGEDVREGLTIVLSIKHPDPQFEGQTKTKLGNSEARTITDRLFSAHFDKFLMENPQVARQIVEKGXXXXXXXXXXXXXXEVTRKKSGLEISNLPGKLADCSSKDPTISELFIVEGDSAGGSAKQGRSRLFQAILPIRGKILNVEKATLDRILANEEIRSLFTAMGTGFGNDFDVSKARYHKLVIMTDADVDGAHIRTLLLTLFYRYMRPVVEAGYVYIAQPPLYQVRQGKKMVYLDSEEELDNYLKEIPSPKPVIQRYKGLGEMDAEQLWETTMNPENRRMLQVTVDDAIEADKSCDMLMGDRVEPRRLFIEENARYVQNLDI 647
52 0.000e+00gi|546162123|ref|WP_021803991.1| DNA gyrase subunit B [Clostridium intestinale]  clstr ali  53  3...EENKQKYDDSQIQVLEGLEAVRKRPGMYIGSTSSRGLHHLVYEIVDNSIDEALAGYCKNIDVYIHEDNSITVIDDGRGMPVGINDKLGKATVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEACEVIVTRDGYIWKQSYSKGN-VLTPLIKLEESEPEHGTKTHFKPDVEIFEETVYDFEILSKRLRELAFLNKGINIRLVDERDEN--EELYYYEGGIKSFVSYLNRNKEVLHKEPIYVEGV----------KDGVAVEVALQYHDGYNENIFSFANNIDTIEGGTHLVGFKTALTRAVNDYGKKFGHLKDADKNLSGDDIREGLTSVVSVKISDPQFEGQTKTKLGNSEVRGIVDGVVGETVSLFLEENPNIGKIIIDKALVXXXXXXXXXXXXXLT-RKSVLERSSLPGKLADCSSKDPLECEIYIVEGDSAGGSAKQGRNRRFQAILPLRGKILNVEKQRLDRILNADSIRSMITAFGAGIGTDFDVEKIRYNRIIIMTDADVDGAHIRTLLLTFFYRYMRELIDGGHVYIAQPPLYKVTRNKKEWYAYTDAELEVVLKEIGGKNTNIQRYKGLGEMNASQLWETTMDPDKRTLLKATVDDAMAADEIFTILMGDKVEPRREFITNNAKKVVNLDI 638
53 0.000e+00gi|610423986|gb|AHW61190.1| DNA gyrase subunit B [Draconibacterium orientale]  clstr ali  49  1MSEIEKNGNYGADSIQVLEGLEAVRKRPSMYIGDTNEKGLHHLVYEVVDNSIDEALAGYCNNIEVIIHENNSITVKDDGRGIPTERHSKENKSALEVVMTVLHAGGKFDKDSYKVSGGLHGVGVSCVNALSTYLKAEVHRDGKIYVQEYAKG-KPQGDVQIIGKTDK-TGTFVTFVPDNSIFLTTEYKYEILAARLRELAFLNAGIKLRIIDERDGSFKSENYFSEAGLKEFVEYLDGTREKLIEEVVHI----------TTEKNNIPVEIALQYNTSFSENIHSYVNNINTIEGGTHLTGFRRGLTRTLKNYADQSGMLQKLKFDISGDDFREGLTAIISVKVQEPQFEGQTKTKLGNSEVSLSVDQATSEALQNYLEENPKAAKQIVQKVILAAQARHAARKAREMVQRKNALSGGGLPGKLSDCSEKDPAQCEVFLVEGDSAGGTAKQGRDRRTQAILPLRGKILNVEKAMQHKIFENEEIKNIFTALGVTIGTELNMEKLRYHKIVIMTDADVDGSHIATLIMTFFFRYMNDLIKKGHLYIAAPPLYLIKKGKREAYAWSDKQRLQLIDEWADGNVHTQRYKGLGEMNAEQLWSTTMNPEQRTLQQVTIENAAEADHIFSMLMGDDVPPRRKFIEDHATYA-NID. 655
54 0.000e+00gi|653273792|ref|WP_027471726.1| DNA gyrase subunit B [Cytophaga fermentans]  clstr ali  48  1MSEENQENGYSANSITVLEGLEAVRKRPAMYIGDVGVKGLHHLVYEVVDNSIDEALAGHCDTISVIIKEDNSVLVKDNGRGIPVDLHEKEGKSALEVVMTVLHAGGKFDKDSYKVSGGLHGVGVSCVNALSTYLKAEVHRNGKAYQQEYAIGVP-QGELQELGATDD-TGTIITFKPDDSIFNTTEYKYSILANRLRELAFLNRGIRITLTDEREGNQRTDEFHSERGLVEFVEFIDETREKLTENVIHI----------TTEKNDVPVELAIQYNTSFGENVYSYVNNINTIEGGTHLTGFRRGLTRTLKTWADKSGLLSKLKFDIAGDDFREGLTAVISVKVQEPQFEGQTKTKLGNSEVSLAVDQAVSTALTHYLEENPKDAKIIVNKVILAATARHAARKAREMVQRKTVMSGGGLPGKLADCSDKDPAICEVFLVEGDSAGGTAKQGRNRRFQAILPLRGKILNVEKALQHKVFENEEIKNIFTALGITIGTELNLEKIRYHKVVIMTDADVDGSHITTLIMTFFFRYMRDLIKNGYLYIATPPLYLCRKGKNVEYCWNEQQRQDFVAKYSGGKVHIQRYKGLGEMNAEQLWETTMNPEQRTLRQVSIESAAEADRVFSMLMGDDVPPRKEFIEENATYA-NID. 655
55 0.000e+00METAHIT MH0014 GL0153790 [Complete] locus=scaffold19111_3:381:2351:+  ali  46  1MSEENSGSNYSASNIQVLEGLEAVRKRPAMYIGDISEKGLHHLVYEVVDNSIDEALAGYCTHIEVTINEDNSITVQDNGRGIPVDFHEKEKKSALEVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTHMTTNVFRGGKVYQQEYECG-KPLYPVKEVGTCPGMTGTRQTFWPDGNIFTVTEYKYSILQARMRELAYLNKGITITLTDKRDGSFKQEVFHSEEGVKEFVRFLNSTNTPLIDDVIYL----------NTEKQGIPIECAIMYNTGFRENLHSYVNNINTIEGGTHEAGFRTALTRVLKKYAEESKALEKAKVEISGEDFREGLIAVISVKVAEPQFEGQTKTKLGNNEVSGAVNQAVGEALTYYLEEHPKEAKVIVDKVVLAATARIAARKARESVQRKSPMGGGGLPGKLADCSSRNPEECELFLVEGDSAGGSAKQGRSRQFQAILPLRGKILNVEKAMWHKAFESDEVNNIIQALGIRFGVDGDIDKLRYYKIIIMTDADVDGSHIDTLIMTLFYRYMPEVIQGGHLYIATPPLYKCSKGKISEYCYTDEERQAFMQKYGDGGIHTQRYKGLGEMNPEQLWETTMNPETRMLKQVHIENAAEADYIFSMLMGDDVAPRREFIEKNATYA-NID. 655
56 0.000e+00  ali  46  1MSEENSGSNYSASNIQVLEGLEAVRKRPAMYIGDISEKGLHHLVYEVVDNSIDEALAGYCTHIEVTINEDNSITVQDNGRGIPVDFHEKEKKSALEVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTHMTTNVFRGGKVYQQEYECG-KPLYPVKEVGTCPGMTGTRQTFWPDGNIFTVTEYKYSILQARMRELAYLNKGITITLTDKRDGSFKQEVFHSEEGVKEFVRFLNSTNTPLIDDVIYL----------NTEKQGIPIECAIMYNTGFRENLHSYVNNINTIEGGTHEAGFRTALTRVLKKYAEESKALEKAKVEISGEDFREGLIAVISVKVAEPQFEGQTKTKLGNNEVSGAVNQAVGEALTYYLEEHPKEAKVIVDKVVLAATARIAARKARESVQRKSPMGGGGLPGKLADCSSRNPEECELFLVEGDSAGGSAKQGRSRQFQAILPLRGKILNVEKAMWHKAFESDEVNNIIQALGIRFGVDGDIDKLRYYKIIIMTDADVDGSHIDTLIMTLFYRYMPEVIQGGHLYIATPPLYKCSKGKISEYCYTDEERQAFMQKYGDGGIHTQRYKGLGEMNPEQLWETTMNPETRMLKQVHIENAAEADYIFSMLMGDDVAPRREFIEKNATYA-NID. 655
57 0.000e+00JGI.Meta 7066446790 C2694023__gene_117540 hypothetical protein [Human Buccal mucosa microbiome from visit number 2 of subject 159814214]  ali  51  2......STEYDASQIQILEGLEAVRKRPGMYIGSISSRGLHHLVYEIVDNSVDEALAGFCKTIEVTINKDNSITVLDDGRGIPVDIQKKAGIPALEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSKNLEVRVYKNGKIHEMKFERGN-VLKKLEIVGKCEDKHGTEVRFLPDDTIFEETIYDYDILKVRLRETAFLTKDLKIKLIDKRVED-KQDIFHYEGGIKEFVEYLNKGKEAIYSNVLYCEG----------EKEKVYVEVALQHNDSFTENIYTFVNNINTPEGGTHLTGFKNALTKTFNDYARKNKLLKDNEDNLSGEDIREGLTAIISVKVSEPQFEGQTKQKLGNSEAAIAVNGIVSEQLTYFLEQNPSIAKIICEKAILXXXXXXXXXXXXDLTRRKSALDGLKLPGKLADCSSKNASECEIFIVEGDSAGGSAKSARKRDTQAILPLRGKILNVEKARIDKVFSNAEIRAMITAFGTGIHEEFDISKLRYNKIIIMTDADVDGSHIDTLMLTFIYRFMPELIKEGHVYLAQPPLYKLEKNKRVWYAYSDEELNNILNEVGRDGNKIQRYKGLGEMDAEQLWETTMDPERRILLKVVIDEETETDLTFTTLMGDEVEPRREFIENNAKYVQNLDI 637
58 0.000e+00gi|497854596|ref|WP_010168752.1| DNA gyrase subunit B [Epulopiscium sp. `N.t. morphotype B`]  clstr ali  52  1MSNNI----YDESQIQILEGLEAVRKRPDMYIGSTSAKGLHHLVYEIVDNAVDEALAGFCDKVTVTIHKDNSISVLDNGRGIPVGIHKDKGISAAEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSSWLISRVYQHGKIYEQKFKKG-HVVESLHPIGTTD-QTGTFVHFLPDETIFEETVYDFAILKKRFQETAFLTKGLKIKLIDERVEPKLEKIFHYEGGVSEFVLFLNKNKTPIYENIFYCEG----------EKDDVSIEVAFCHNDGYNENIFSFANNINTIEGGTHLSGFKNALTKTVNDYAKKMKILKDNDKSLSGEDIREGITGVISIKISEPKFEGQTKTKLVNTNVRTIVDNIVSEKFMIFLEQNPTIAKIIIQKATMASHARDAARKARDLTRRKNVLENSTLPGKLADCSERDPKKCEIYIVEGDSAGGSAKSARSRQNQAILPLRGKILNVEKARLDKMLASEEIRNMITAFGAGINEDLNIEKLRYHKIILMTDADVDGAHIRTLLLTFFYRFYRELITGGFIYIAQPPLYLVEKNKKKHYAYNDRELELILTEIGRNGITMQRYKGLGEMNPDQLWDTTMNPATRTLVKVNIEDAVEADEIFTALMGDKVEPRREFIKEYAKLVKNLDI 635
59 0.000e+00gi|491510557|ref|WP_005368191.1| DNA gyrase subunit B [[Eubacterium] yurii]  clstr ali  52  11..EEKVNSEYGAEQIQVLEGLEPVRKRPGMYIGSTGSKGLHHLVYEVVDNAIDEALAGFCKNIYVSIDVNNGITVIDDGRGIPVEVHPKTGKSTLETVLTVLHAGGKFGAGGYKVSGGLHGVGVSVVNALSKSLTAVVKKDGKIYKQEFEKGNPV-SDVHVVGDCPEERGTCISFLPDETVFEETVYSFEVLEHRLRELAFLNKGISITLEDNRTIEKVTRKYHYEGGIIEYVKALNKNREAL-TEVIYFNKLDEEFSYD--------IEIAMQYTDAYVENIYSFANNINTVEGGMHLIGFKSALTRVVNDYARKNNMLKEKDENFTGEDIREGLTAIISVKLPEPQYEGQTKTKLGNPQMRSSVEQITVDQVATFLEENPATARIIMEKCMRSQRARQAAKRARDLTRRKGILESTSLPGKLADCREKDPSKSEIFIVEGDSAGGSAKEGRNSQNQAILPLRGKILNVEKARLDKALQSDTIKNMITAFGCGIGSEFDDSKLRYHKIIIMSDADVDGAHIRTLILTFFFRYMRPLIEKGYVYIAQPPLFSIEKGKKTYYAYSPEELEAKLNEIGRERTVVSRNKGLGEMDAEELGDTTMDPAKRVLLKVNLEDAIAADEIFDILMGDKVEPRREFIQKNAKYVENLDI 649
60 0.000e+00gi|517794770|ref|WP_018964978.1| DNA-cytosine methyltransferase [Porphyromonas gulae]  clstr ali  48  7..KNTSASEYSASNIQVLEGLEAVRKRPAMYIGDISEKGLHHLVYEVVDNSIDEALAGYCDNVEVIIEEDNSITVRDNGRGIPVDYHEKEGKSALEVVLTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTYLRAEVHRDGKIHMQEFSCG-KPLHDVEVIGSTD-RTGTTIQFKPDSSIFSVTEYQYSILAKRLRELSYLNAGITLSLTDKRIIKEKQDVFYSEEGLKEFVRHLDRMKEPLVDNVIHI----------VTEKQGIPVEVAMTYNTSYLENVYSYVNDINTIEGGTHLAGFRRGLTRTLKKYATDSKLLDKVKVEITGDDFREGLTAVISIKVAEPQFEGQTKTKLGNNEVTGAVDMAVSEALEYYLEEHPKEAKLIVDKVVLAATARQAARKAREMVQRKSPLSGGGLPGKLADCSSKDPEQCELFLVEGDSAGGTAKQGRDREFQAILPLRGKILNVEKAMQHKVFESEEIRNIYTALGVTIGTELNLSKLRYHKVVIMTDADVDGSHIATLILTFFFRNMRTLIENGYVFIATPPLYLCKKGKEQEYCWTEQQRQAFIDRYADGNVHVQRYKGLGEMNEEQLWETTMDPEKRTLRKVTIENAAEADAIFSMLMGDEVGPRREFIEENATYAR.... 651
61 0.000e+00gi|518074515|ref|WP_019244723.1| DNA-cytosine methyltransferase [Candidatus Alistipes marseilloanorexicus]  clstr ali  48  1MSTEEKNQEYSASSIQVLEGLEAVRKRPAMYIGDIGVRGLHHLVYEVVDNSIDEALAGYCTDIDVTINEDDSITVRDNGRGIPTDFHEKEGRSALEVVLTVLHAGGKFNKDSYKVSGGLHGVGVSCVNALSTLLTAEVHRQGRIFRQQFSKGTP-LAPMEVIGETEEDHGTIITFKPDDTIFSVTEYDYETLSSRMRELAYLNKGVRLNITDRRNGEFVHDSFYSTEGLKEFVQFLDASREPLTETPIYID----------TEKDGVPVEVAMQYNTSFSENVHSYVNNINTIEGGTHLTGFRRALTRTLKKYAEDSGLLAKLKFEINGDDFREGLTAIVSVKVAEPQFEGQTKTKLGNSEVAGAVDQAISGALTHYLEENPKDARAIVSKVILAATARHAARKARELVQRKTVLSGSGLPGKLADCSSRDRDQAEIFFVEGDSAGGSAKQGRDRNFQAIMPLRGKILNVEKAMEHRIFENEEIRNIFTALGVTIGTELNLEKLRYGRVIIMTDADVDGSHIATLMLTFFFRYMNNLIKNGHVYIATPPLYQVKKGKNSRYCWTEEEREAALEEFGAKGAHVQRYKGLGEMNPEQLWETTMSPKTRILRKVNIESAAEADRIFSMLMGDDVPPRREFIERHAKYA-NIDI 653
62 0.000e+00gi|493397372|ref|WP_006353487.1| DNA gyrase subunit B [Clostridium methylpentosum]  clstr ali  50  2...EKLNQNYDENQIQVLEGLEAVRKRPGMYIGSTGPKGLHHLVYEIVDNAIDEALAGFCTQIDVEILPGNIIHVVDNGRGIPTGIHQKEGISAATVVYTILHAGGKFGGGGYKVAGGLHGVGASVVNALSEWLELKVYDGENIHYQRFERG-HYDKQMEVIGKTD-RTGTEVAFKADPEIFSETEYDYDTLLTRLREQAFLNAGVKIVMADRRQPEPVVENLHYEGGIISFVEFIHKRKETLHPDVIYLKA----------QEGDSVAEVALQYNDSYNELILSFANNIHTAEGGTHEIGFKNALTRVFNDYGRKNNLLKEADKNLSGDDVREGLTAIISVKLTECEFEGQTKSKLGNIEVRALVDRMVSEKLTNFFEENPSVARSIFDKALNAQRAREAARKARELTRRKSALETASLPGKLADCSERDPALTELYIVEGDSAGGSAKSGRERKYQAILPLWGKMLNVEKARLDRVYGNDKLMPVVTALGTSIGDDFDITKLRYNKIVIMADADVDGSHIRTLLLTFFFRFMRPLIDQGHVYIAQPPLYKLSRGKQHRYAYSDKERNQYLSELPDAKVDIQRYKGLGEMDPEQLWETTMNPENRVMIKVEMEDAVAADEVFTILMGDKVGPRREFIEKNAQYVQNLDV 642
63 0.000e+00gi|502527162|ref|WP_012813423.1| DNA gyrase subunit B [Desulfotomaculum acetoxidans]  clstr ali  52  3...ERITERYGAEEIQVLEGLEAVRRRPGMYIGSTGAKGLHHLVYEVVDNSIDEAMAGYCDHIEVFINEDNSITVTDNGRGIPVDIHSKTGNSAVELVMTTLHAGGKFGGGGYKVSGGLHGVGVSVVNALSKWLEVEVRRQGKIFFQRYERGIPV-SDLKIVGDSS-FTGTKITFSPDEEIFEDVIFSRETLEQRLQELAYLNSRVKIYLKD--FINNLEFSYMYEGGIKDFVAHINQDKILLPEAPLYF----------VREKDHVMVEVAMQYTDAYFENLFSYVNNIHTIDGGTHEAGFRSALTRVINDYAKKNNLIKNNEGNLSGEDIREGLTAVISIKVPEPQFEGQTKGKLGNSEVRGIVDSVVAEGLSTFLEENPAVSKKIIEKSISAFRAREAARKARELTRRKNVLESSTLPGKLSDCSNRDPSESELYLVEGDSAGGSAKQGRDRKFQAILPLKGKILNVEKARLDKILNNDEIRAMITALGTGIGEDFDITKARYHKLIIMTDADVDGSHIRTLLLTFFYRYMRPLIEAGYIFIAQPPLYRLKKGKMEIYLYSDRDLENKLKEVGRNGISIQRYKGLGEMDAQQLWDTTMDPENRTILMVELENAAEADKIFDTLMGDRVEPRRSFINKHAHDVRNLDI 635
64 0.000e+00gi|517153229|ref|WP_018342047.1| hypothetical protein [Cytophaga aurantiaca]  clstr ali  48  1MSEEQNAAGYSADSIQVLEGLEAVRKRPAMYIGDIGIKGLHHLVWEVVDNSIDEALAGHCTDITVEINENNSITVTDNGRGIPTGVIAKYGKSALEVVLTVLHAGGKFDKDSYKVSGGLHGVGVSCVNALSTDMKVTVYSHGKVHQQEYKKGIP-QYDVKEIGESEI-HGTKVQFLPDDSIFTSSEYKYETIANRLRELSFLNKGIRITLQDHREGKSEIETFHSEGGLREFVEYVDSTRERLIPRPLYME----------SDKGPIPVEVAMLYNTSYSENVFSYVNNINTVEGGTHVAGFRRALTRTLKSYADKSGMLEKLKMEVTGDDFREGLTAVISVKVQEPQFEGQTKTKLGNSDVMGAVDQVVGEMLNTYLEENPKEAKIIVQKVILAAQARNAARKAREMVQRKNVLSGSGLPGKLADCSESDPEKCEIYLVEGDSAGGSAKQGRDRKYHAILPLRGKILNVEKAQEHRIYENDEIKNMITALGVSFGTELNLTKLRYHKVIIMTDADIDGSHIRTLILTFFFRYMRALIDGGHVYIAQPPLYLVKRGKEEKYCWTEEQREVAVKELAKDGVGIQRYKGLGEMNPEQLWSTTMDPEKRSLKQVSVESAAEADHLFSMLMGDEVAPRRDFIEKNARYAK-IDI 652
65 0.000e+00gi|502959841|ref|WP_013194817.1| DNA gyrase subunit B [Methanohalobium evestigatum]  clstr ali  52  1MADKQV---YDSTNIQVLEGLEAVRKRPSMYIGSVDSRGLHHLVYEVVDNSIDEALAGYCSEINTILNSDGSVTLEDDGRGIPVDTHAKYNKSALEVVMTLLHAGGKFDKNSYKVSGGLHGVGVSVVNGLSEWLDVEVKRDDKRYYQHYEKGYPKT-EVQVLGESEGN-GTKFTFKPDSEIFESTEFDYDSLSTRLRELAFLNKGIKITIKDERSEEGQEDVFQYDGGIVSFVKHLNKNRSPIHEEPIYFEG----------ESDGTIVEISLQYTDSYGEYVYSFANNINTHEGGTHVIGFKTALTRVANDYIRKNEIEKGN-VRLTGEDIREGLTAIISAKIPDPQFEGQTKTRLGNSDVKGVVESLVTEELSRYLEENPKIANSIIKKALSXXXXXXXXXXXXXLTRRKSALEVSTLPGKLADCSETDPSVSEIFLVEGDSAGGSAKMGRDRRFQAILPFRGKIINVEKARLSKVLKNNEILSLITAMGTGIGEDFDINKARYHKVIIMTDADVDGAHIRTLILTFFFRYMNEMVDNGYVYIAQPPLYRIKKGKKEFYIHTEKEKNAKLKELGEKGVSIQRYKGLGEMNPEQLWATTMNPESRKLTQVTMEDAAAADEMFSILMGEEVEPRRQFIEKHATEVVNLDV 634
66 0.000e+00gi|497264682|ref|WP_009578899.1| DNA gyrase subunit B [Fulvivirga imtechensis]  clstr ali  48  1MSDNQKKKEYSAGNIQVLEGLEAVRKRPAMYIGDVGVKGLHHLIWEVVDNSIDEALAGYCNEISVTINENNSITVSDNGRGIPTDIHTKEKRSALEVVMTVLHAGGKFDKDTYKVSGGLHGVGVSCVNALSTDLRAEVHRNGKIYEQEYKIGVP-QYSVREIGDTDK-TGTTITFQPDSSIFNVTEYTYETVASRLRELAYLNAGIRILRDLDDDGKPKSDDFFSEGGLKEFVQYLDSTREKLIPEPIYMD----------SEKGENPVQVAMSYNTSYSENVVSYVNNINTIEGGTHVAGFRRALTRTLKAYADKSGLLDKVKVEISGDDFREGLTAVISVKVAEPQFEGQTKTKLGNSDVSGSVDTVVGEMLNNYLEENPKEAKSIVQKVIIAAQARHAARKAREMVQRKNVLSGTGLPGKLADCSNNDPTISELYLVEGDSAGGSAKQGRDRNFQAILPLRGKILNVEKAQEHKIYENEEIKNMITALGVSFGTELNMTKLRYHKIIIMTDADVDGSHIRTLILTFFFRYMHALIEKGYVYIALPPLYQLKRGRDERYCWTEEERMKLIKEMAGEGVGVQRYKGLGEMNPEQLWTTTMDPENRSLKRVTIESAAEADHLFSMLMGDEVAPRREFIERNAKYAK-VDI 651
67 0.000e+00gi|653150463|ref|WP_027399619.1| DNA gyrase subunit B [Anaerovorax odorimutans]  clstr ali  53  4....DTKQQYNAEQIQVLEGLEPVRKRPGMYIGSTGPKGLHHLVYEVVDNSIDEALAGFCKNINITIQEDNSIVVEDDGRGMPVDKHPKLGLPAVEVIHTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEFMEVEIKRNGKIYSQSYSRG-KTQTPLTVVGESTN-TGSKTMFKPDYEIFEELEFDYNILEHRFREMAFLNKGIKITLKDEREGKEKLDVFHYEGGIKEFVKHQNKNKEVIHPDIIYFE---------YQKDDELEVEVAMQYTDRYNELILSYANNINTTEGGTHMIGFKSALTRVFNDYAKKNKFIKENEEALSGEDVREGLTAIISVKLTNPQFEGQTKTKLGNSEMRGFVETTTNENLTGFLEENPQQAKIIIDKCLXXXXXXXXXXXXXXLTRRKGVLDGLTLPGKLADCSEKDPAISEIFLVEGDSAGGSAKSGRDRKRQAILPLRGKILNVEKARLDKILNSEEIKNMITAFGCNIGEEFNEEKLRYHKIIIMTDADVDGAHIRTLLLTFFYRYMTPLIEGGYVYIAQPPLFQTKKGKEVHYTYSERDQEKLMADLSDKKANIQRYKGLGEMDFHQLWETTMDYNNRTLIQVTIDDVTAADEIFTTLMGDKVPPRRQFIEENAKYVKNLDI 640
68 0.000e+00METAHIT O2 GL0020942 [Complete] locus=scaffold2100_3:377:2305:-  ali  49  1MSEQQPQHEYDGSQIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNAIDEALAGFCDHIEVNIREGNIIRVTDNGRGIPVDIQPKLGIPAVTVVFTILHAGGKFGGDGYKVAGGLHGVGASVVNALSEWLNVVVRKDGVAYKQSFKRGV-ADADLQNLGPTDEPDGTTVTFKPDPEMFEVLDYDYDTLNTRLREEAFLNAGVRITLTDERAGQEKQESMCYEGGIRSFVDHIHQKREVLHPDVIYLKGQL----------NDSIAEVALQYNNSYNELILSFANNVNTPDGGTHEEGFKSALTRVFNDFGREKGYIKEKDDNLSGSDVREGLTAVISVKLTEAQFEGQTKAKLGNTEIRGLVSGIVYDKLKEFFEENPAVAKAIYEKAMQXXXXXXXXXXXXXLVRRKSALENSRMPGKLADCREKDPTKTEIYIVEGDSAGGSAKMGRDSKIQAIPPLWGKMLNVEKARIDKIYGNDKLTPVVTALGCGLGEEFDVSKLRYHKVFIMADADVDGSHICTLLLTFFFRYMRPLIEGGYVYIAQPPLFKLQKGKQVRYAYNEPEVSQISAEMG-QGTKVSRYKGLGEMNPEQLWETTMDPEHRVIVQITIEDAMAADEAFTILMGDKVEPRKEFIERNAQYA-NLDV 642
69 0.000e+00  ali  49  1MSEQQPQHEYDGSQIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNAIDEALAGFCDHIEVNIREGNIIRVTDNGRGIPVDIQPKLGIPAVTVVFTILHAGGKFGGDGYKVAGGLHGVGASVVNALSEWLNVVVRKDGVAYKQSFKRGV-ADADLQNLGPTDEPDGTTVTFKPDPEMFEVLDYDYDTLNTRLREEAFLNAGVRITLTDERAGQEKQESMCYEGGIRSFVDHIHQKREVLHPDVIYLKGQL----------NDSIAEVALQYNNSYNELILSFANNVNTPDGGTHEEGFKSALTRVFNDFGREKGYIKEKDDNLSGSDVREGLTAVISVKLTEAQFEGQTKAKLGNTEIRGLVSGIVYDKLKEFFEENPAVAKAIYEKAMQXXXXXXXXXXXXXLVRRKSALENSRMPGKLADCREKDPTKTEIYIVEGDSAGGSAKMGRDSKIQAIPPLWGKMLNVEKARIDKIYGNDKLTPVVTALGCGLGEEFDVSKLRYHKVFIMADADVDGSHICTLLLTFFFRYMRPLIEGGYVYIAQPPLFKLQKGKQVRYAYNEPEVSQISAEMG-QGTKVSRYKGLGEMNPEQLWETTMDPEHRVIVQITIEDAMAADEAFTILMGDKVEPRKEFIERNAQYA-NLDV 642
70 0.000e+00  ali  51  2......SSNYQAENITVLEGLEAVRKRPGMYIGTTSERGLHHLVWEIVDNSVDEALAGYCNRIEVSILPDNIIEVKDNGRGIPVGIHPKYGKSALEIVLTVLHAGGKFENDNYKVSGGLHGVGVSVVNALSEWLEVTVRTDGKVWYQRYDRGIP-EEDVKEIGVAGDEHGTTVKFKADYEIFETLVYDYNTLKNRLKELAYLNKDLEICLSDSRKEPFKKEEFKFEGGIVDFLKEITEDTEKLISEPIYMSG----------EIDNVAVDIAFLYTVNQAEIIYSFVNNINTHEGGTHVSGFRTALTRVINDVGKTQGYLKEKDGKLLGNDIREGVTAIVSVKVPQPQFEGQTKTKLGNSEVSGIVSTIVGNSLKIVLEDNPNDTKIIIDKILNSKKAREAAQRARELVLRKSVLEVGSLPGKLADCSSKDPAECEIYIVEGDSAGGSAKQGRDRSHQAILPLRGKILNVEKAGLHKALENNEVRSMITAFGTSIGDSFNIEKLRYGKIIIMTDADVDGAHIRTLLLTFLYRYLVELIYNGHVYIAQPPLYKITTGKQIRYAYSDKELKEITSEGEDKRYTLQRYKGLGEMNPEQLWETTMDPKSRTLLQVTIDDARAADMLFDKLMGDKVDPRREFIEENAEYVKNLDI 637
71 0.000e+00JGI.Meta 7025852908 C3762313__gene_256096 DNA gyrase, B subunit [Human Supragingival plaque microbiome from visit number 1 of subject 159915  ali  52  23..EEKVNIEYGAEQIQVLEGLEPVRKRPGMYIGSTGSKGLHHLVYEVVDNAIDEALAGYCKNIYVSIDVNNGITVIDDGRGIPVEIHPKTGKSTLETVLTVLHAGGKFGAGGYKVSGGLHGVGVSVVNALSKSLTAVVKKDGKIYKQEFERGNPV-SDVHVVGDCPEERGTCISFLPDETVFEETVYSFEVLEHRLRELAFLNKGISITLEDNRTIEKVTRKYHYEGGIIEYVKALNKNREAL-TEVIYFNKIDEEFSYD--------IEIAMQYTDAYVENIYSFANNINTVEGGMHLIGFKSALTRVVNDYARKNNMLKEKDENFTGEDIREGLTAIISVKLPEPQYEGQTKTKLGNPQMRSSVEQITVDQVATFLEENPATARIIMEKCMRSQRARQAAKRARDLTRRKGILESTSLPGKLADCREKDPSKSEIFIVEGDSAGGSAKEGRNSQNQAILPLRGKILNVEKARLDKALQSDTIKNMITAFGCGIGSEFDDSKLRYHKIIIMSDADVDGAHIRTLILTFFFRYMRPLIEKGYVYIAQPPLFSIEKGKKTYYAYSPEELEAKLNEIGRERTVVSRNKGLGEMDAEELGDTTMDPAKRVLLKVNLEDAIAADEIFDILMGDKVEPRREFIQKNAKYVENLDI 661
72 0.000e+00JGI.Meta 7001416134 SRS053214_LANL_scaffold_27222__gene_77380 hypothetical protein [Human Stool microbiome from visit number 2 of subject 15  ali  51  3.NNTNVENEYGADQIQVLEGLEAVRKRPGMYIGSTSSRGLHHLVYEIVDNAVDEALAGYCDIIDVQINKDNSITVRDDGRGIPTDINTKTGKPAVEVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSKWLEVKVCRNGDVHYQRYEYG-HVVEPLKVIDKCDENTGTEVTFLPDDSIFEDTIYDYKVLETRLRETAFLTKNLKIILRDVREEEPIEKTFHYEGGIKEFVTYLNKGKTALYDDVIYCEGTV----------NNVYVEVAMQHNDAYNENTLSFVNNINTPEGGMQVEGFKRALTKTLNNYARNNKILKEKEDNLSGEDFREGLTCIISVKIEDPQFEGQTKQKLGNSEARTAVDGVVSEQLTYYLEQNPVIAKTICEKAVLXXXXXXXXXXXXXTTRRKTALDVAALPGKLADCSDKDPKKCEIFIVEGDSAGGSAKKARVRATQAILPLRGKILNVEKARVDKIMQNAEIRAMITAFGTGIYDEFDISKLRYDKIIIMTDADVDGAHIDTLMLTFFYRFMPELIKEGHVYLAMPPLYQVTRNKKNYYAYSDEELNKILTEIGRDNNKIQRYKGLGEMDASQLWETTMDPKTRILKQVKVNDLTEIDATFNTLMGDEVEPRREFIEANAKFVQNLDI 644
73 0.000e+00gi|503736163|ref|WP_013970239.1| DNA gyrase subunit B [Treponema caldaria]  clstr ali  50  2......DSSYSAQSIQVLKGLEAVRKRPGMYIGSTGIDGLHHLVYEVVDNSVDEAMQGHCTDILVVLEKNDIVRVEDNGRGIPVDIHPSEKVSALELVMTKLHAGGKFDKNSYKVSGGLHGVGVSVVNALSTWCEVFVHRDGKIHYQKYHIGVP-EESVKVIGTT-NKRGTIVRFLADATIFETTTYNFDVLSNRLRELAFLNKGIRISIRDERLTTPKSHEFIFEGGVVSFVEYLNQNKTVLHKECIYIAGT----------RDDIEVECAIQYNDGFNEIMFSFVNDINTREGGTHLVGFKSALTRTLNEYLKKSKLAKKMEESLSGDDVREGLTAVLSVKVPNPQFEGQTKGKLGNSEVKGIVESLVNEQLELFLDQHPDIVNAILEKSVLAAKARIAARQARDATRRKNLMESAGLPGKLADCSEKDPTKCELFIVEGDSAGGSAKMGRNRAFQAILSLWGKMLNVEKTHIEKVITNDKLQPIIASIGAGIGDSFDISKLRYHKIIIMADADVDGSHIRTLLLTFFYRYMTELIERGHVYLAMPPLYKITYEKKVFYAYDDAEKDRILAESGKDKVAIQRYKGLGEMNPDQLWETTMDPERRNIVQVHMDDAVEAERIFSTLMGEQVEPRRIFIEENALAVSYLDV 635
74 0.000e+00gi|546363781|ref|WP_021850274.1| dNA gyrase subunit B [Firmicutes bacterium CAG:791]  clstr ali  50  43..DTKDVGSYTADDIQVLEGLQAVRKRPGMYIGTTSSRGLHHLVYEIVDNSVDEALAGYCTHIEVFINPGNSITVSDNGRGIPVGINHKTGMTAVEVVYTILHAGGKFGGGGYKVSGGLHGVGASVVNALSSWLEVTVRQDGKIHVIRFENGGHVKEKLHVVGTCAEDTGTSVTFQPDPSVFETTVYDYDIIKARLREMAFLTKGLKITLTDLREEEPRKDVFHYEGGIREYVAYLNRSKTPLYSEILYFDGT----------KNNVYVEVSMQHNDAYNVSEYSFVNNINTPEGGMHLTGFHNAMTKTFNDYARKNGILKDSEQNLSGDDIREGLTAIVSVKVEDPQFEGQTKQKLGNIEARGAVDSVVSEKLTYYLEQHPDVAKTICEKALLAQRAREAARKARDLTRRKTALETMSLPGKLADCSDKDPKNCEIFLVEGDSAGGSAKSARNRFTQAILPLRGKILNVEKAREDRIYGNEEIKAMITAFGTGIHEEFDIAKLRYDKIIIMTDADVDGAHIDTLMLTFLYRFMPELIRQGHVYLAMPPLFKLERNKKVWYAYSDEELAGILNEVGRDNNNIQRYKGLGEMDPEQLWETTMDPERRILRRVNIDEESESDLTFTTLMGDQVEPRREFIEQNAKFVQNLDV 691
75 0.000e+00gi|651360694|ref|WP_026473044.1| DNA gyrase subunit B [Alkaliflexus imshenetskii]  clstr ali  48  1MSDNPSNGDYSANSIQVLEGLEAVRKRPAMYIGDISVKGLHHLVYEVVDNSIDEALAGHCDRIEVTINEDDSVTVIDNGRGIPVDIHEKEGRSALEVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTLLVVEVHRDGNVYHQQYERGKPV-ADVKLIGQTDKR-GTSVTFKPDATIFNTTEYKYSILAERMRELAFLNANIEIILTDRREGEFKQERFHSELGLREFVQFIDSNREKLIDNIIYID----------TEKNEVPVEIAILYNNSFNENVHSYVNNINTIEGGTHLTGFRRGLTRTLKTWAEKSGMLSKLKFDINGDDFREGLTAVISVKVAEPQFEGQTKTKLGNSDVSLAVDQAVSIMLQNYLEENPKDARSIVNKVILAATARHAARKARELVQRKSVLSGGGLPGKLADCSDKDPAGCEVFLVEGDSAGGTAKQGRNRQFQAILPLRGKILNVEKALQHKVFENEEIKNIFTALGVTIGTELNLEKLRYHKVIIMTDADVDGSHITTLIMTFFFRYMKDLITNGHLYIATPPLYLLKKGKIEEYCWDDKQRRMFIEKYGNGRIHIQRYKGLGEMNAEQLWGTTMNPETRTLRQVTIESAAEADRIFSMLMGDDVPPRREFIEQNATYAK-IDV 656
76 0.000e+00METAHIT MH0012 GL0208040 [Complete] locus=scaffold1192_2:12808:14883:-  ali  50  43..DTKDVGSYTADDIQVLEGLQAVRKRPGMYIGTTSSRGLHHLVYEIVDNSVDEALAGYCTHIEVFINPGNSITVSDNGRGIPVGINHKTGMTAVEVVYTILHAGGKFGGGGYKVSGGLHGVGASVVNALSSWLEVTVRQDGKIHVIRFENGGHVKEKLHVVGTCAEDTGTSVTFQPDPSVFETTVYDYDIIKARLREMAFLTKGLKITLTDLREEEPRKDVFHYEGGIREYVAYLNRSKTPLYSEILYFDGT----------KNNVYVEVSMQHNDAYNVSEYSFVNNINTPEGGMHLTGFHNAMTKTFNDYARKNGILKDSEQNLSGDDIREGLTAIVSVKVEDPQFEGQTKQKLGNIEARGAVDSVVSEKLTYYLEQHPDVAKTICEKALLAQRAREAARKARDLTRRKTALETMSLPGKLADCSDKDPKNCEIFLVEGDSAGGSAKSARNRFTQAILPLRGKILNVEKAREDRIYGNEEIKAMITAFGTGIHEEFDIAKLRYDKIIIMTDADVDGAHIDTLMLTFLYRFMPELIRQGHVYLAMPPLFKLERNKKVWYAYSDEELAGILNEVGRDNNNIQRYKGLGEMDPEQLWETTMDPERRILRRVNIDEESESDLTFTTLMGDQVEPRREFIEQNAKFVQNLDV 691
77 0.000e+00  ali  50  43..DTKDVGSYTADDIQVLEGLQAVRKRPGMYIGTTSSRGLHHLVYEIVDNSVDEALAGYCTHIEVFINPGNSITVSDNGRGIPVGINHKTGMTAVEVVYTILHAGGKFGGGGYKVSGGLHGVGASVVNALSSWLEVTVRQDGKIHVIRFENGGHVKEKLHVVGTCAEDTGTSVTFQPDPSVFETTVYDYDIIKARLREMAFLTKGLKITLTDLREEEPRKDVFHYEGGIREYVAYLNRSKTPLYSEILYFDGT----------KNNVYVEVSMQHNDAYNVSEYSFVNNINTPEGGMHLTGFHNAMTKTFNDYARKNGILKDSEQNLSGDDIREGLTAIVSVKVEDPQFEGQTKQKLGNIEARGAVDSVVSEKLTYYLEQHPDVAKTICEKALLAQRAREAARKARDLTRRKTALETMSLPGKLADCSDKDPKNCEIFLVEGDSAGGSAKSARNRFTQAILPLRGKILNVEKAREDRIYGNEEIKAMITAFGTGIHEEFDIAKLRYDKIIIMTDADVDGAHIDTLMLTFLYRFMPELIRQGHVYLAMPPLFKLERNKKVWYAYSDEELAGILNEVGRDNNNIQRYKGLGEMDPEQLWETTMDPERRILRRVNIDEESESDLTFTTLMGDQVEPRREFIEQNAKFVQNLDV 691
78 0.000e+00gi|547224423|ref|WP_021961564.1| dNA gyrase subunit B [Mycoplasma sp. CAG:877]  clstr ali  52  1MNEDKVQGSYDSSSIQVLEGLEAVRKRPGMYIGTTSSRGLHHLVWEIVDNAIDEALAGYCTHIEVTIGKDNSITVKDDGRGIPVDIHPKTGKSTVETVYTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSDWLEVKVYKNGNVYYQRFSHGGHPDDSLKIIDKCDDRTGTTVHFLPDDEIFETTVFDYDILMKRLRELAFLNKGLRISLYDDR-EPDKKDSFCYEGGISEYVKMINSNKNPIHETIVDVSGKDK----------DISVEVALQYNETYNSCIYSFVNNITTPEGGTHEDGARRALTRVLNKYGVSANILKQNDDPLTGDDVREGLTMIISVKHPDPQFEGQTKTKLGNSEVRGVVDKIFSEAFERFLMENPDQAKIILDKAMTASRARVAAKKARELTRRKGDLDITNFYGKLSDCKSKDAAVSEIFLVEGDSAGGSAIKGRDSMTQAILPLRGKILNVEKARLDRALSNEEIRTIITAFGTGIGDEFDLNKLRYHKIIIMTDADVDGSHIRVLLLTLFYRFFRPIVEAGHVYAAQPPLFVIKHGKTIKYVLNEQERDEYLATLPNTKYDIARMKGLGEMDAEELNETTMDIHKRVLRQITVEDTIAADDVFSKLMGEDVGPRREFIETNATYVENLDV 642
79 0.000e+00JGI.Meta 7042266262 SRS011586_WUGC_scaffold_3756__gene_8782 DNA gyrase, B subunit [Human Stool microbiome from visit number 1 of subject 159  ali  52  1MNEDKVQGSYDSSSIQVLEGLEAVRKRPGMYIGTTSSRGLHHLVWEIVDNAIDEALAGYCTHIEVTIGKDNSITVKDDGRGIPVDIHPKTGKSTVETVYTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSDWLEVKVYKNGNVYYQRFSHGGHPDDSLKIIDKCDDRTGTTVHFLPDDEIFETTVFDYDILMKRLRELAFLNKGLRISLYDDR-EPDKKDSFCYEGGISEYVKMINSNKNPIHETIVDVSGKDK----------DISVEVALQYNETYNSCIYSFVNNITTPEGGTHEDGARRALTRVLNKYGVSANILKQNDDPLTGDDVREGLTMIISVKHPDPQFEGQTKTKLGNSEVRGVVDKIFSEAFERFLMENPDQAKIILDKAMTASRARVAAKKARELTRRKGDLDITNFYGKLSDCKSKDAAVSEIFLVEGDSAGGSAIKGRDSMTQAILPLRGKILNVEKARLDRALSNEEIRTIITAFGTGIGDEFDLNKLRYHKIIIMTDADVDGSHIRVLLLTLFYRFFRPIVEAGHVYAAQPPLFVIKHGKTIKYVLNEQERDEYLATLPNTKYDIARMKGLGEMDAEELNETTMDIHKRVLRQITVEDTIAADDVFSKLMGEDVGPRREFIETNATYVENLDV 642
80 0.000e+00gi|547209183|ref|WP_021949844.1| dNA gyrase subunit B [Clostridium sp. CAG:678]  clstr ali  49  19..DTSVTEEYSAKDIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNSIDEALAGVCTHIECEILPDNVIGVRDNGRGIPTGINEKTGLPAVTVVLTVLHAGGKFGGSGYKVSGGLHGVGSSVVNALSEWLEVEVTQNGHIYSQRFERGNPV-NDLHIIGDSDG-HGTYIKFKPDGEIFETLVYDFDVLSRRLREQAFLNAGLSITLSDLRPEEQKKEVYHYEGGIKSFVEYINKTRNPVQDEVIHIS----------TTKEDRSAEVALCYTDSYNEILLSFANNINTIDGGTHETGFKTALTRVFNDYGKKFNILKDSDKKLSGDDVREGLTAVISVKLTEAQFEGQTKGKLGNTDITGLVSSMVYEKLMTYFEENPQTAKTILNKALDASRAREAARKARDNARNKSGIENAKLKGKLANCSSNEPELCEIYIVEGDSAGGSAKEGRDRVHQAILPLWGKMLNVEKARLDKVYGNEKLMPIVMALGTGIGEDFDLSKLRYHKIVIMADADVDGAHIRTLLLTFFFRYMKPLVEGGYIYLAQPPLFKITKGKKNAYAFSDEERDSLIQEMGGQ-CDVQRYKGLGEMDPEQLWETTMDPEFRTMLRVTVEDAQQADETFSILMGDNVEPRRDFIEKNAKYVENLDV 659
81 0.000e+00gi|547375660|ref|WP_022064105.1| dNA gyrase subunit B [Alistipes sp. CAG:157]  clstr ali  49  1MSELENHEEYSASSIQVLEGLEAVRKRPAMYIGDIGVRGLHHLVYEIVDNSIDEALAGYCTDIEVTINENNSITVEDNGRGIPVDFHEKEGKSALEVVLTVLHAGGKFSKDSYKVSGGLHGVGMSCVNALSTQFEVEVRRDGKIHRQTYSIGAP-TSEIEIIGTCGN-TGTKITFLPDASIFTTTEYSYDVLSARLRELAYLNKGIRLSITDRREGNFRGEVFYSVEGLKEFVKYLDENRTPLTEDIIYID----------TEKDGIPVEVAMQYNDSFSENVHSYVNNINTIEGGTHLTGFRRALTRTLKKYADDSGLLSKLKFDINGDDFREGLTAVVSVKVSEPQFEGQTKTKLGNSEVAGAVDQAISQALNNYLEENPKDARAIVNKVILAATARNAARHARELVQRKTVLSGSGLPGKLADCSSRDREKTEIFFVEGDSAGGTAKQGRDRLFQAIMPLRGKILNIEKAQEHKMWENEEIKNMFTALGVSIGTELNLEKLRYGKIIIMTDADVDGSHIATLMLTFFFRKMKDLIELGHIYIATPPLYQVRKGTQKRYCWTEEEREQAIADFGTKGVHTQRYKGLGEMNEEQLWETTMNPETRILRQVTIENAAEADRIFSMLMGDDVPPRREFIEKNARYAK.... 649
82 0.000e+00gi|639448062|ref|WP_024626193.1| DNA gyrase subunit B [Lactobacillus fabifermentans]  clstr ali  51  1MTENEKETEYDASQIQVLEGLEAVRKRPGMYIGTTSSQGLHHLVWEIVDNGIDEALAGFADKIHVTVEKDNSITVTDNGRGIPVDIQKKTGKPALETVYTILHAGGKFGGGGYKVSGGLHGVGASVVNALSTELDVKVTRDGKVYYMDFTRG-KVKTPMKVIATPMDAHGTAVHFLPDPDIFETTTYDINVLTTRIRELAFLNKGLQISIRDNRPDEPTEQDFLYEGGIRHYVEFLDKNKSVLFPEPIYVEG----------EQKGITVEVALQYTDDYHSNLMTFTNNIHTYEGGTHEEGFKRALTRVINDYARKNNLLKDSDANLSGEDVREGMTAVVSVKHPDPQFEGQTKTKLGNSDARAAVDRLFSEHFNKYLMENPSIGRKVVDKGMLASKARVAAKRAREVTRKKSGLEISNLPGKLADNSSKDPEISELFIVEGDSAGGSAKQGRSRLTQAILPIRGKILNVEKASIDKILANEEIRSLFTAMGTGFGGDFDLSKANYHKLIIMTDADVDGAHIRTLLLTLFYRYMRPLVDAGFVYIAQPPLYQVRQGKFVRYIDSDEELSEVMGQLPSPKPVVQRYKGLGEMDAEQLWETTMDPERRRLLRVRDEDAADADDVFSMLMGDQVKPRRQFIEDNAKFVQDLDV 649
83 0.000e+00gi|505352171|ref|WP_015539273.1| DNA gyrase subunit B [Gordonibacter pamelaeae]  clstr ali  50  1MSVANKPDHYDGSDIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEVVDNAVDEALAGYCDTIEVWIHPDNSITVDDNGRGIPVDKHPKEKIPTVEVVLTILHAGGKFGGEGYKVSGGLHGVGVSVVNALSSRVEVSVFKEGVQYDISFDHG-KTAEKLREVGKVRRGNGTTVTFWPDPTIFDTTVYDYDTLASRFREMAFLNKGLKIILHDERVNEPRTEVFQYAGGIVDFVKFLNEGKETLN-KPIYFEA----------ENDDGTVEVAMQWSSSYSTNVMAFANNINTHEGGTHLDGFKQAVTRTINEYARAKGILKEKDSNLSGDDTREGCAAIISVKLHDPQFEGQTKTKLGNTEIRPLVQNAVTQGLAEYLEENPKPAKRIIDKATQALKAREAARKAREMTRRKGVLDSFALPGKLADCSSKTPADSEIFIVEGDSAGGSAKQARDRKTQAILPLRGKILNVERAGLHRSLSSDTISSLITAIGTNIGDDFDADQARYHRIIIMTDADVDGAHIRCLLLTFFYRYMPELINRGYIYIAQPPIFGLKKKKIERYIYDESALGSVLAEYDNDKFDVQRYKGLGEMDPDQLWETTMEPETRTLLQVNIDDAAEAERVVSELMGDQVEPRKEFIQKHARDVRFLDI 656
84 0.000e+00METAHIT V1 GL0076080 [Complete] locus=scaffold9105_6:6346:8304:-  ali  49  1MSELENHEEYSASSIQVLEGLEAVRKRPAMYIGDIGVRGLHHLVYEIVDNSIDEALAGYCTDIEVTINENNSITVEDNGRGIPVDFHEKEGKSALEVVLTVLHAGGKFSKDSYKVSGGLHGVGMSCVNALSTQFEVEVRRDGKIHRQTYSIGAP-TSEIEIIGTCGN-TGTKITFLPDASIFTTTEYSYDVLSARLRELAYLNKGIRLSITDRREGNFRGEVFYSVEGLKEFVKYLDENRTPLTEDIIYID----------TEKDGIPVEVAMQYNDSFSENVHSYVNNINTIEGGTHLTGFRRALTRTLKKYADDSGLLSKLKFDINGDDFREGLTAVVSVKVSEPQFEGQTKTKLGNSEVAGAVDQAISQALNNYLEENPKDARAIVNKVILAATARNAARHARELVQRKTVLSGSGLPGKLADCSSRDREKTEIFFVEGDSAGGTAKQGRDRLFQAIMPLRGKILNIEKAQEHKMWENEEIKNMFTALGVSIGTELNLEKLRYGKIIIMTDADVDGSHIATLMLTFFFRKMKDLIELGHIYIATPPLYQVRKGTQKRYCWTEEEREQAIADFGTKGVHTQRYKGLGEMNEEQLWETTMNPETRILRQVTIENAAEADRIFSMLMGDDVPPRREFIEKNARYAK.... 649
85 0.000e+00  ali  49  1MSELENHEEYSASSIQVLEGLEAVRKRPAMYIGDIGVRGLHHLVYEIVDNSIDEALAGYCTDIEVTINENNSITVEDNGRGIPVDFHEKEGKSALEVVLTVLHAGGKFSKDSYKVSGGLHGVGMSCVNALSTQFEVEVRRDGKIHRQTYSIGAP-TSEIEIIGTCGN-TGTKITFLPDASIFTTTEYSYDVLSARLRELAYLNKGIRLSITDRREGNFRGEVFYSVEGLKEFVKYLDENRTPLTEDIIYID----------TEKDGIPVEVAMQYNDSFSENVHSYVNNINTIEGGTHLTGFRRALTRTLKKYADDSGLLSKLKFDINGDDFREGLTAVVSVKVSEPQFEGQTKTKLGNSEVAGAVDQAISQALNNYLEENPKDARAIVNKVILAATARNAARHARELVQRKTVLSGSGLPGKLADCSSRDREKTEIFFVEGDSAGGTAKQGRDRLFQAIMPLRGKILNIEKAQEHKMWENEEIKNMFTALGVSIGTELNLEKLRYGKIIIMTDADVDGSHIATLMLTFFFRKMKDLIELGHIYIATPPLYQVRKGTQKRYCWTEEEREQAIADFGTKGVHTQRYKGLGEMNEEQLWETTMNPETRILRQVTIENAAEADRIFSMLMGDDVPPRREFIEKNARYAK.... 649
86 0.000e+00gi|652829666|ref|WP_027114673.1| DNA gyrase subunit B [Lachnospiraceae bacterium NK4A144]  clstr ali  52  2......SQEYGADQIQILEGLEAVRKRPGMYIGSTSARGLHHLVYEIVDNSVDEALAGFCTNIHVWIKPDNSIVVEDDGRGIPVGINHKSGLPGVEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSTWLTVNVYSEGKIYEEKFARGQK-LSDLTVVGECDEKHGTRVSFLPDPEIFETQVYDFSVLRQRLREMAFLTKNLRIELHDERPGQEKDEKYHYEGGIKEFVKYLNKSTTSLYDDIIYCEGA----------RGNVYVEVAMQHNDSYNESSYSFVNNINTPEGGTHLTGFRNAITKTFNEYARKNKILKDSEDNLSGEDIREGLTSIVSIKIEDPQFEGQTKQKLGNTEARNAVESLFTEQLTYYLEQNPNVAKIICEKSIQSQRAREAARKARDLTRRKSALDGLSLPGKLADCSDKNPKNCEIFIVEGDSAGGSAKTARSRATQAILPLRGKILNVEKARLDRVYGNEEIKAMITAFGTGIHDDFDISKLRYDKIIIMTDADVDGAHIATLMLTFIYRFMPELIKQGHVYLAQPPLYKLEKNKKVWYAYSDEELAKIIDEVGRDNNKIQRYKGLGEMDAEQLWETTMDPAKRVLLRVAMDEESVSDLTFMTLMGDKVEPRREFILENAKYVKNLDI 639
87 0.000e+00  ali  51  3.NNTNVENEYGADQIQVLEGLEAVRKRPGMYIGSTSLRGLHHLVYEIVDNAVDEALAGYCDTIDVQINEDNSITVKDDGRGIPTGINTKTGKSGIELVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVKVCRDGKIHHQKYQRG-HALGGLEIIGDCDPETGTEVKFLPDKTIFEDTVYDYSVLETRLRETAFLTKNLKIILRDVRPEEPIEKTFHYEGGIKEFVTYLNKGKTPLYEDVIYCEGTV----------NNVYVEVAMQHNDAYNENSFSFVNNINTPEGGMQVEGFKRALTKTLNNYARQNKILKEKEDNLSGEDFREGLTSIISVKIEDPQFEGQTKQKLGNSEARTAVDSVVSEQLTYFLEQNPGVAKIICEKAVLXXXXXXXXXXXXXTTRRKTVLDVAALPGKLSDCSDKDPKKCEIFIVEGDSAGGSAKKARVRATQAILPLRGKILNVEKARLDRIMQNEEIRSMITAFGTGIYDEFDISKLRYDKIIIMTDADVDGAHIDTLMLTFFYRFMPELIKDGHVYLAMPPLYQVTRNKKNYYAYSDAELDKILTEIGRDNNKIQRYKGLGEMDASQLWDTTMNPETRILKQVKIEDTLEMDLTFTTLMGDDVEPRREFIQANAKFVQNLDI 644
88 0.000e+00JGI.Meta 7002124091 SRS022725_LANL_scaffold_111409__gene_247631 DNA gyrase, B subunit [Human Supragingival plaque microbiome from visit numb  ali  51  9MVEKKQIQEYNADQIQVLEGLEAVRVRPGMYIGSTSSRGLHHLVWEIVDNSIDEALAGYCNTITVAIEKDNWIRVEDNGRGIPIDIQEQTGKPALEVILTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTNLEAYVHRDGKIHSMKFERGEVVQG-ITVIGETDK-TGTTVRFKADPEIFETTVYEYDILRSRIRELAFLNKGITIVLKDERENQEKEEDFCYEGGLLEYVEMLNENKDTLH-EAIYVHG----------EMEGKEVEISMQYNTGYSSNILSYANNINTHEGGTHESGFKTALTRIINSYGKKNKLIKEKE-TLTGDDVREGLVAIISIKHPNPQFEGQTKTKLGNSEMSTITNKLFSEELDRFLLENPKVAKIIVEKGLQASRARIAAKKARESTRRKNALEFTNLPGKLADCSSKDAAECELFLVEGDSAGGSAKLGRDSKFQAILPLKGKILNVEKVRIDKVLSSDEIRSLITAVGMGIGETLNMDKLRYHKIVIMTDADVDGSHIRTLLLTFFFRYMRELIDAGYVYIARPPLYGLKVGKKEYYCHTEEELKQHIEEFGDKKYAVQRYKGLGEMNAEELWDTTMDPKHRLMYQVSIGDAQRADAAFDTLMGEKVEPRRKFIEENALNVINLDI 646
89 0.000e+00JGI.Meta 7002600055 SRS011255_Baylor_scaffold_75071__gene_109558 DNA gyrase, B subunit [Human Supragingival plaque microbiome from visit num  ali  50  1MSEEASEKEYSASSIQVLEGLEAVRKRPAMYIGDIGEKGLHHLVYEVVDNSIDEALAGYCNDIKVIIHEDNSIEVQDNGRGIPVDIHEKEGKSALEVVLTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTYLKAIVHRDGKIYTEEFSQGVPTT-DLQTIGTTD-RTGTTIIFKPDDTIFSVTEYQFKILSNRLRELAFLNAGITLTLVDEREGKPLTEVYYSQDGLKEFAKYIDRSKEHLVDDVIHI----------VTEKQGIPVEVAMTYNTSYNENIYSYVNNINTIEGGTHLAGFRRGLTRTLKKYATDSKLLDKVKVEITGDDFREGLTAVISIKVAEPQFEGQTKTKLGNNEVMGAVDIAVSEALETYLEEHPKEAKVIVDKVILAATARQAARKAREMVQRKSPLSGGGLPGKLADCSSKDPVLSELFLVEGDSAGGTAKQGRDREFQAILPLRGKILNVEKAMQHKVLESEEIRNIYTALGVTIGKELNLAKLRYHKVIIMTDADVDGSHIATLILTFFFRNMRSLIENGYVYIATPPLYLCTRGKEKEYCWTEQQRQAFIDRVGGKRVHVQRYKGLGEMNDEQLWETTMNPENRTLRKITIENAAEADAIFSMLMGDEVAPRREFIEANATYAR.... 650
90 0.000e+00gi|490769500|ref|WP_004631729.1| DNA gyrase subunit B [Gemella morbillorum]  clstr ali  51  6MVEKKQIQEYNADQIQVLEGLEAVRVRPGMYIGSTSSRGLHHLVWEIVDNSIDEALAGYCNTITVAIEKDNWIRVEDNGRGIPIDIQEQTGKPALEVILTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTNLEAYVHRDGKIHSMKFERGEVVQG-ITVIGETDK-TGTTVRFKADPEIFETTVYEYDILRSRIRELAFLNKGITIVLKDERENQEKEEDFCYEGGLLEYVEMLNENKDALH-EAIYVHG----------EMEGKEVEISMQYNTGYSSNILSYANNINTHEGGTHESGFKTALTRIINAYGKKNKLIKEKE-TLTGDDVREGLVAIISIKHPNPQFEGQTKTKLGNSEMSTITNKLFSEELDRFLLENPKVAKIIVEKGLQASRARIAAKKARESTRRKNALEFTNLPGKLADCSSKDAAECELFLVEGDSAGGSAKLGRDSKFQAILPLKGKILNVEKVRIDKVLSSDEIRSLITAVGMGIGETLNMDKLRYHKIVIMTDADVDGSHIRTLLLTFFFRYMRELIDAGYVYIARPPLYGLKVGKKEYYCHTEEELKQHIEEFGDKKYAVQRYKGLGEMNAEELWDTTMDPKHRLMYQVSIGDAQRADAAFDTLMGEKVEPRRKFIEENALNVINLDI 643
91 0.000e+00gi|546887350|ref|WP_021901572.1| dNA gyrase subunit B [Coprobacillus sp. CAG:698]  clstr ali  53  3.....KDETYSSGNIQILEGLEAVRRRPGMYIGSTGERGLHHLVWEIVDNSIDECLAGVCTHIEVEILPDGFISVQDNGRGVPTAIHKKTGESAAEAVFTILHAGGKFDGSSYKVSGGLHGVGASVVNALSEKLHVIIKRDGQIFEQEYERG-KRLYKLRVIGETE-EHGTKVIFKPDAEIFDTTTFVYETIRSHLQQSAFLNKGLRLTLTDSRPEHIKKVSYCYEGGIIEYVAFLNSNKNPIHNNIFYVDKTL----------DKVEVEISMQYTDDYNSSIYSFINNIYTPEGGTHEEGFRNALTRVLNTYGKANNIFR-KDESLTGDDVREGLTAIISCRHPDPQFEGQTKAKLGNTEVRRITSQVLTDGLDAFLKENPQAAKDIVEKSLLASRARLAAKKAREATRRKSPLESLGMASKLADCRSKDPSKCEIYIVEGDSAGGSAKKGRDAEYQAILPLRGKVLNVEKARMDRALGNKEIISMIQAFGTGIGDEFNIDSARYHKIVIMTDADVDGAHIATLLLTLFYRFMKPLIEKGYVYIAQPPLYKISQSKRVEYAYSDEELQKILDTFPKAKPSIQRYKGLGEMNAEQLWETTMNPANRTLLQVTLSDAIEADTVFSMLMGDDVAPRREFIEENAVYVGNLD. 638
92 0.000e+00JGI.Meta 7023446073 SRS022602_Baylor_scaffold_119310__gene_159301 hypothetical protein [Human Supragingival plaque microbiome from visit num  ali  53  1MTEQKQAQQYDAGQIQVLEGLEAVRKRPGMYIGSTSIVGLHHLVWEIVDNSIDEALAGYCDHIEVTIEANNSITVQDNGRGIPVDIQPQTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELTVQVSRGGKLYQQRYHRGA-VEGDLEVIGQAT-ETGTKVNFLPDPAIFETTVFEYERLKKRIRELAFLNKGLRITIEDKRLDQEEKDSFHYEGGIKSYVQHLNQHKTPIFEEPIYIEG----------EVDDIQVEISMQYTDSYHTTILSFANNIHTHEGGSHEAGFKTGLTRVINDYARKMNLIKDNDENLTGEDVREGLTLVLSIKHPDPQFEGQTKTKLGNSEVRAITDRLFSNGFDVYLMENPKVARIIVDKGILXXXXXXXXXXXXEMTRRKSVMEISNLPGKLADCSSREAELCELFIVEGDSAGGSAKQGRSRMYQAILPIRGKILNVEKASMDKILNNEEIRSLFTAMGTGFGGEFDVAKARYHKLILMTDADVDGAHIRTLLLTLIYRYMRPLLDAGYVYIAKPPLYQVKQGKRAIYLDTDAELKEWQEENPNARYTIQRYKGLGEMNEDQLWETTMNPENRRMLQVTVEDAIEAEAVLEMLMGDDVEPRRAFIEDNAVYVENLDI 640
93 0.000e+00gi|505237944|ref|WP_015425046.1| DNA gyrase subunit B [Candidatus Cloacimonas acidaminovorans]  clstr ali  50  2.....QSSTYTASNIKVLKGLEAVRKRPAMYIGGTSERGLHHLVYEVIDNSIDEALAGYCDEIICTITTEGNIRVEDNGRGIPVDIQKDMGVPAVQVVLTVLHAGGKFDDKSYKVAGGLHGVGVSVVNALSEFLEVNIFKDGKEYFMRFERGLPVT-ELQVLGDT-NKTGTVVTFRPDPLIFETTEFSFDYLTSRLRELAFLNSGLRIILKDERSG--RVHDFKYEGGIKSFVEYLNQNKKPLFPNPIYISSV----------KEGMEFEVALQYNEGYQENIFSFANNINTTEGGTHLSGFKSGLTRAVNTYIKNADLLKNEKVSPSGEDIREGLTAVISLKIANPQFEGQTKTKLQNSEVEGIVNSAVYEKLMEYFEEHPAEAKNITMKSILAARSREAARKARELTRRKTVLESGSLPGKLADCTLSDPEKTELFLVEGDSAGGSAKQGRDRSFQAILPLWGKMLNTEKARVDKVLNNDKIQPIILALGAGIGQEFDISKLRYHKIIIMADADVDGSHIATLLMTFFYRYMRPVIEEGKLYIAMPPLFQVRKGKQKVYVYNEEERDKAIREFGEKGVLVQRYKGLGEMNAEQLWETTLDPKNRKMIAIKMDDAIEADRMFTILMGDEVEPRREFIQENARYVKNLDV 632
94 0.000e+00METAHIT V1 GL0007060 [Complete] locus=scaffold2017_2:2463:4394:-  ali  51  1MSENMEKTEYGADQIQILEGLEAVRKRPGMYIGSTSARGLHHLVYEIVDNSVDEALAGYCKNIDVTINPDNSITVIDDGRGIPVGINHKSGLPAVEVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSNWLEVRVYHDGKVYFQRYERG-KTMNKLEVIDTCPEKTGTEVRFLPDDTMFEETVYDYDVLKTRLRETAFLTKGLRIVLRDLRTDPVVEKAFHYEGGIKEFVSYLNKSKTALYPDIIYCEG----------ERDGVLVEVAMQHNDSYQENTYGFVNNITTPEGGTHIVGFRNALTKTFNEYARANKLLKDSEPNLTGEDIREGMTAIVSIKIEEPQFEGQTKQKLGNSEARGAVDNIVSTQLELFLEQNPAVAKTIVEKSLLSQRAREAARKARDLTRRKSALDGMSLPGKLADCTDKDPKNCEIFLVEGDSAGGSAKSARSRATQAILPLRGKILNVEKARLDKIYANAEIKAMITAFGTGIHDDFDITKLRYDKIIIMTDADVGGAHIDTLTLTFLYLFMPELIKQGHVYLAQPPLFKIEKNKKVWYAYDDDQMNQILNEIGRGDNKIQRYKGLGEMDAEQLWETTMDPERRVLRRVVFDESSEIDLTFNTLMGDKVEPRRDFIEERAKYANNLDI 643
95 0.000e+00JGI.Meta 7037944866 SRS014923_WUGC_scaffold_59820__gene_128617 DNA gyrase, B subunit [Human Stool microbiome from visit number 1 of subject  ali  53  1MAKDEKLQQYGAEQIQVLEGLEAVRKRPGMYIGSTGSRGLHHLVYEIVDNSIDEALAGFCNNINVTIHKDNSITVEDDGRGMPVDNHPKLGIPAVEVIHTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTKMEVEIKRNGKVYKQTYAKG-KTTSPLTDIGNS-RKTGSKSTFWPDPEIFDEIEYDYETLERRLREMAFLNKGIRIILKDEREGKQQEEVFHYEGGLKEFVKHLNTNKEPLHPDVVYFEVADKDR----------EVEVAMQYTDRYSEMMLSYANNINTTEGGFHMVGFKTALTRTINDYAKRSKILKENDDALSGDDVREGLTAIISVKLTEPQFEGQTKTKLGNSEMRGFVETATAENVMAFLEENPTQAKIIIDKCLXXXXXXXXXXXXXXLTRRKSVLDGISMPGKLADCSEKDPSLSEIFLVEGDSAGGSAKQGRDRLRQAVLPLRGKILNVEKARLDRILNSDEIKNMITAFGCNIGPDFDESKLRYHKIIIMTDADVDGAHIRTLLLTFFYRYMTPLIEKGYIYAAQPPLFQVKKGKEVYYTYSEREQEKLMKELADKKADIQRYKGLGEMDFHQLWETTMDYNNRTLIQITIDDATAADEIFTTLMGDKVQPRRHFIEQNAALAT-LDI 639
96 0.000e+00JGI.Meta 7024100134 SRS015578_WUGC_scaffold_43469__gene_86722 DNA gyrase, B subunit [Human Stool microbiome from visit number 1 of subject 7  ali  55  1........................RKRPGMYIGSTGPRGLHHLVYEVVDNSIDEALQGYCSEIYVAINKDGSITVKDNGRGIPVEIHPKTGKSTLETVLTVLHAGGKFGGGGYKVSGGLHGVGVSVVNALSEWVVAEVRRDGKIHKQSYKLGTPTT-DLEIVGEC-NDTGTTISFMPDATIFDEIEFKFDTLEHRLRELSFLNKGIKIVFEDKREGQEKKKEFHYTGGLVEYVKYLNKSRTGIHDEIVYIDKKV----------DDYVVELAMQYTDGYSENIYSFANNINTHEGGTHLAGFKTALTKTINEYAKRNKLLKENEPNLLGEDIREGLTTVVSVKLPEPQFEGQTKTKLGNTVMRGIVDSVTVEELGAFLEENPTTARIIVDKGLRAQRAREAAKRARELTRRKSVLESTSLPGKLADCAEKDPSKSEIFLVEGDSAGGSAKQGRDRHTQAILPLRGKILNVEKSRLDKILSSDEIKNMITAFGCGVGNDFDLEKARYHKIVIMTDADVDGAHIRTLLLTFFFRYMRPLIENGLVYIAQPPLYKVKKQKKEYYVYSDEQLNTLLEEIGRQGVELQRYKGLGEMNAEQLWDTTMDPEKRTLLQVSIEDAVLADEVFSMLMGDKVAPRREFIEENATYVRNLDI 614
97 0.000e+00gi|557370438|ref|WP_023392579.1| DNA gyrase, B subunit [Abiotrophia defectiva]  clstr ali  53  1MTEQQSPQQYDAGQIQVLEGLEAVRKRPGMYIGSTSIVGLHHLVWEIVDNSIDEALAGYCDHIEVTIEANNSITVQDNGRGIPVDIQPQTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELTVQVSRDGKLYQQRYHRGA-VEGDLEVIGQAT-ETGTKVNFLPDPAIFETTVFEYERLKKRIRELAFLNKGLRITIEDKRLDQEEKDSFHYEGGIKSYVQHLNQHKTPIFEEPIYIEG----------EVDDIQVEISMQYTDSYHTTILSFANNIHTHEGGSHEAGFKTGLTRVINDYARKMNLIKENDENLTGEDVREGLTLVLSIKHPDPQFEGQTKTKLGNSEVRAITDRLFSNGFDVYLMENPKVARIIVDKGILXXXXXXXXXXXXEMTRRKSVMEISNLPGKLADCSSREAELCELFIVEGDSAGGSAKQGRSRMYQAILPIRGKILNVEKASMDKILNNEEIRSLFTAMGTGFGGEFDVAKARYHKLILMTDADVDGAHIRTLLLTLIYRYMRPLLDAGYVYIAKPPLYQVKQGKRAIYLDTDAELKEWQEENPNARYTIQRYKGLGEMNEDQLWETTMNPENRRMLQVTVEDAIEAEAVLEMLMGDDVEPRRAFIEDNAVYVENLDI 640
98 0.000e+00gi|502494084|ref|WP_012805789.1| DNA gyrase subunit B [Jonesia denitrificans]  clstr ali  50  19.SPAQHQGAYDANAITVLEGLEAVRKRPGMYIGSTGERGLHHLVYEVVDNSVDEALAGHCDTINVTILEDGALEVSDNGRGIPVAIHPTEGRPTVEVVMTILHAGGKFGGSGYAVSGGLHGVGISVVNALSSRVETVIRRDGYTWHQSFADGGKPVGELRQ-GEPTEEKGTTQTFWPDADIFETVDFDFETLRARFQQMAFLNKGLSITLTDKRPERIKTVTYKYDAGLLDYVHHLNTAKEVIHDEIIDFDAEDTDRK--------ISVEIAMQWTTAYSESVHTYANTISTTEGGTHEEGFRAALTSLINRYARAKNILKEKDDNLTGEDIREGLTAVISVKLGEPQFEGQTKTKLGNTEARTFVQSIMNEKMNDWLDAHPNEAKEIIRKAIQASQARLAARKAREATRRKGLLESGGMPGKLRDCQSNRPEECEIYIVEGDSAGGSAVRGRNPHIQAILPLRGKILNVERARLDKALSNAEVQALITAFGTGIGEDFDMSKLRYHKIVLMADADVDGQHICTLLLTLLFRYMRPLIEHGHVFLAQPPLYRIKWNAEHDYVFSDKQRDDCIREGLAAGNGIQRYKGLGEMDYSELWDTTMDPEHRTLLQVTLEDAAAADEMFAILMGEDVESRRNFIQRNARDVRFLDI 686
99 0.000e+00gi|488917268|ref|WP_002828343.1| DNA gyrase subunit B [Weissella paramesenteroides]  clstr ali  52  1MAEEDVSQDYDASQIQVLEGLEAVRKRPGMYIGSTSSQGLHHLVWEIVDNGIDEALAGFANHITVTIEKDNSITVIDNGRGIPVDIQVKTGKPALETVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSTNLDVLVVRDGKGFAMDFERG-HVKTEMHEIAIDDKSRGTIVHFAPDPDIFETTVFDYKTLMNRVRELAFLNKGLRISITDMRPEEPVVESFHYEGGIKEYVDFLNVNKDVIFNEPIYVEGM----------ENDIDVEVSLQYTDDFHSNLLSFTNNIHTYEGGTHETGFKSALTRVINDYARKNKILKDNDDPLSGDDVREGLTAIVSVKHPDPQFEGQTKTKLGNSDARTAVDRMFSETFARFMMENPTTAKQIVEKGILAGKARMAAKRAREATRKKSGLEIANLPGKLADNTSKDPEISELFIVEGDSAGGSAKQGRERLTQAILPIRGKILNVEKASMEKILGNDEIRSLFTAMGTGFGTDFDVTKAKYHKLIIMTDADVDGAHIRTLLLTLIYRYMRPLLEAGYVYIAQPPLYQVRQGKFIKYLDADSELEALLPTLPAPKPIIQRYKGLGEMDASQLWETTMDPSVRRLLRVEMDDAIEADMIFSMLMGDKVEPRRKFIEENAQYAE-LDV 648
100 0.000e+00gi|496725149|ref|WP_009353984.1| DNA gyrase subunit B [Veillonella sp. oral taxon 780]  clstr ali  52  1MAEQT---NYDAGNIQVLEGLEAVRMRPGMYIGSTSARGLHHLVYEVVDNSVDEALAGYATHIEVTICEDNSIEVIDDGRGIPTGMHE-TGMPAVELVLSKLHAGGKFGGGGYKVSGGLHGVGISVVNALSEWTIVDVYQHGKIQEISFERGNK-TSDLKQIGTTD-RTGTTVRFKPDAQIFETTIFEFDVLKTRLQELAFLNKGLRITLSDKR-GEGRSESFHYEGGLVQFIEYLNEAKEAITPSVISIDNT----------RDDVVVDVALQYNDSYSETILSFVNNINTIDGGTHLSGFRTALTRTLNDYGRKAGILKENESNLTGEDVREGLTAVVSVKVLEPQFEGQTKGKLGNSEVKGITDTIVSDGLRVFLEEHPAEAKKIIEKATNASRAREAARKARELTRRKNALEVGSLPGKLADCSEKDTTMTEIYLVEGDSAGGTAKQGRDRRYQAILPLRGKILNVEKARLDKILANAEIRSMITAFGTGIGQDFDITKSRYNKIIIMTDADVDGAHIRTLLLTFFYRYMRPLIEEGHVFIAQPPLYQIKKGQKQWYAYSDQELSDRLDEIGREGITIQRYKGLGEMNAEQLWDTTMNPEHRTILQVSMEDSIAADKIFSVLMGDKVEPRRKFIEDNAEYVRNLD. 632
101 0.000e+00gi|488622049|ref|WP_002558762.1| MULTISPECIES: DNA-cytosine methyltransferase [Bacteroides]  clstr ali  46  1MSEDQDNGSYSADSIQVLEGLEAVRKRPAMYIGDISVKGLHHLVYEIVDNSIDEALAGYCDHIEVTINEDNSITVQDNGRGIPVDFHEKEQKSALEVAMTVLHAGGKFDKGSYKVSGGLHGVGMSCVNALSTHMISQVYRNGKIYQQEYEIG-KPLYPVKEVGESEH-TGTRQQFWPDNTIFTETVYKYEILAGRMRELAYLNAGIKITLTDRREGKFKQEIFYSEEGLKEFVRYLESSRDHLINDVIYL----------NTEKQGIPIELAIMYNTGFSENVHSYVNNINTIEGGTHLAGFRRALTRTLKKYAEDSKMLEKVKVEISGDDFREGLTAVISVKVAEPQFEGQTKTKLGNNEVMGAVDQAVGEALAYYLEEHPKEAKLIVDKVVLAATARHAARKAREMVQRKSPMSGGGLPGKLADCSDKDPQKCELFLVEGDSAGGTAKQGRNRAFQAILPLRGKILNVEKAMYHKALESEEIRNIYTALGVTIGTEEDIDKLRYHKIIIMTDADVDGSHIDTLIMTFFFRYMPQIIQNGYLYIATPPLYLCKKGKVEEYCWTDAQRQAFIDTYGGGSVHTQRYKGLGEMNAQQLWETTMDPENRMLKQVNIENAAEADFIFSMLMGEDVGPRREFIEENATYA-NID. 654
102 0.000e+00METAHIT MH0081 GL0095079 [Lack 3`-end] locus=scaffold69025_4:1411:3264:+  ali  54  3...EQNKQNYDESQIQVLEGLEAVRKRPGMYIGSTSSRGLHHLVYEIVDNSIDEALAGFCKKIEVTINEDNSIVVKDDGRGMPVGIHPKMHKPTVEVIMTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEKCTVTVKRDGHIYEQSYEKG-KVVTEFKQIGDSD-ETGTQVYFKPDKEIFDETEFDFDVLSQRLRERAFLNKGIHITLRDMRDGN--EEVYHYEGGIKSFVTYLNRNKEALHPEPIYVEGI----------KDGISVEIALQYNDGYNENIFSFANNIDTVEGGTHLVGFKTALTRVFNDYAKKFGHLKENDKNLSGEDIREGLTAVISVKIEEPQFEGQTKTKLGNSEVRGIVDSILGEGLSIYLEENPNVSKTIIEKALMASRARDAARKARELT-RKSVLERTSLPGKLADCSSKDPRECEIYIVEGDSAGGSAKQGRDRKFQAILPLRGKILNVEKQRLDRILNSDSIRSMITAFGAGIGPDFDIEKIRYNRIIIMTDADVDGAHIRTLLLTFFYRYMRDLLDDGHVYIAQPPLYKVSKAKKEAYAYTDQELEAILEEFGGKDNSIQRYKGLGEMNAEQLWDTTMDPEKRILLKATVEDAMKADEIFTILMGDKVE.................. 618
103 0.000e+00gi|492559440|ref|WP_005886034.1| DNA gyrase subunit B [Fusobacterium mortiferum]  clstr ali  52  2......SNNYQAEDITVLEGLEAVRKRPGMYIGTTSERGLHHLVWEIVDNSVDEALAGYCTHIEVSILPDNVIEVVDNGRGIPVDIHPKYGKSALEIVLTVLHAGGKFENDNYKVSGGLHGVGVSVVNALSLWTEVEVRKNGKVWYQKYNRGIP-EEAVKEIGITE-EHGTTVRFKADHEIFETLVYDYNTLKNRLKELAYLNKGLVITLTDSRKEPFKKEIFEFEGGIADFLREITEDTEKLIKEPIYMTG----------EVDNIGVEIAFLYTVNQSEIIYSFVNNINTHEGGTHVQGFRTALTRIINDVGKAQGLLKDKDGKLQGTDIREGVTAIVSVKVPQPQFEGQTKTKLGNSEVTGIVSTVVGGQLKMILEDNPNDTKVIIEKILNSKKAREAAQRARELVLRKSALEVGSLPGKLADCSSKNPEECEIYIVEGDSAGGSAKQGRDRYHQAILPLRGKILNVEKAGLHKALENNEVRAMITAFGTGIGDNFNIEKLRYGKIILMTDADVDGAHIRTLLLTFIYRYMIELIYNGNVFIAQPPLYKISYGKQIKYAYSDRELKEITEEGEDKKYTLQRYKGLGEMNPEQLWETTMDPQNRTLLKVTIDDARAADMLFDKLMGDKVDPRREFIEENAEYVKNLDI 635
104 0.000e+00  ali  51  1MSDEKTNGQYDAAQIQVLEGLEAVRKRPGMYIGSTGARGLHHLVYEIVDNSVDEALAGYCTTIKVTICKDNSITVEDDGRGMPVDKHPKLKIPAVEVIHTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTHMEVEIRRNGKIYKQCYERG-KTVTPLEVIGDS-KKTGSKTSFWPDPEIFETTIFDFDTLEHRLREMAFLNKGIKIIFKDEREGKKRSETYHYEGGIKEFVKFQNQNKDAIHPDVIYFE----------VVRDTCEVEIAMQYTESYNELVLGYANNINTTDGGTHIVGFKSALTRIFNDYGKKAKILKEND-TLSGEDVREGLTAIVSVKLAEPQFEGQTKAKLGNPDMRGFVETTTNENLTAFLEENPAQAKIILEKCIXXXXXXXXXXXXXDLTRRKGALDSFSLPGKLADCSDKDPSQCEIFLVEGDSAGGSAKDGRDRKRQAILPLKGKILNVEKARLDRILNSDEIKNMITAFGCGIGDDFNVEKLRYHKIIIMTDADVDGAHIRTLLLTFFYRYMRPLIEGGFVYAAQPPLYQVKKGKDVYYTYGEDEQTELMKEGKAGKADIQRYKGLGEMDAEQLWDTTMDYEHRTLIQITIEDSAAADQTFSTLMGDKVPPRKKFIEDNAHYAT-LDI 640
105 0.000e+00  ali  47  15MSEEQNNGSYSADSIQVLEGLEAVRKRPAMYIGDISVKGLHHLVYEIVDNSIDEALAGYCDHIEVTINEDNSITVQDNGRGIPVDYHEKEKKSALEVAMTVLHAGGKFDKGSYKVSGGLHGVGMSCVNALSTHMTTQVFRDGKIYQQEYEIG-KPLYSVKEVGTADI-TGTRQQFWPDNTIFTETVYDYKILASRLRELAYLNAGLRITLTDRRDGSFKGEQFYSEEGLREFVRFIESSREHLINDVIYL----------NSEKQGIPIEVAIMYNTGFSENVHSYVNNINTIEGGTHLAGFRRALTRTLKKYAEDSKMLEKVKVEISGDDFREGLTAVISVKVAEPQFEGQTKTKLGNNEVMGAVDQAVGEVLAYYLEEHPKEAKTIVDKVILAATARHAARKAREMVQRKSPMSGGGLPGKLADCSDKDPSKCELFLVEGDSAGGTAKQGRNRMFQAILPLRGKILNVEKAMYHKALESDEIRNIYTALGVTIGTDEDIQKLRYHKIIIMTDADVDGSHIDTLIMTFFFRYMPQIIQNGYLYIATPPLYLCKKGKVEEYCWTDAQRQKFIDTYGGGSIHTQRYKGLGEMNAQQLWETTMDPENRMLKQVNIDNAAEADYIFSMLMGEDVGPRREFIEENATYA-NID. 665
106 0.000e+00gi|502637510|ref|WP_012874009.1| DNA gyrase subunit B [Thermobaculum terrenum]  clstr ali  49  5..EEKVISNYNAESIQVLEGLEAVRKRPGMYIGSTDVRGLHHLIYEIVDNSVDESMAGYCDFIEVHIHKDKSVTVRDNGRGIPVGIHPKLKKSALEVVMTVLHAGGKFGSGGYKVSGGLHGVGASVVNALSEYLIAEVHREGKIWRQSYERGVPKT-PVEAIGDTD-RTGTIITFKPDADLFSTLEYQFDTLAQRFREIAYLNKGLKITFIDDRDD--KELTLYFEGGIASFVRHLNKNRNVLTEKPIYIHKQL----------NGIDVEVAIQYTDGFNESLHTFTNNINTVDGGTHLTGFRTALTRTLNDYAVKNGLLKDSDTKLTGEDVREGLTAVVSVKLPDPQFEGQTKSKLGSSEAERVVASVVRDGLLSYFDENPSDAKRIIEKAITXXXXXXXXXXXXDLVVRKGALDGMTLPGKLADCSERDPRHSELYIVEGDSAGGSAKQGRDRRFQAILPLRGKILNVEKARLDKMLSSAEIKALITALGTGIGDSFDISKLRYHRIFLMTDADVDGAHIRTLLLTFFFRHMPDIIKNGHLYIAMPPLYKIQVGKEKYFVYSDEERDRVLAGLNRSKAIIQRYKGLGEMNPEQLWETTMDPSTRTIMQVTIEDAVKADELFDMLMGSNVAPRKKFIQSHAKSVRNLDI 640
107 0.000e+00  ali  52  3....NNYEEYDADQIQILEGLEAVRKRPGMYIGSTSERGLHHLVYEIVDNSVDEALAGFCTHIEVFINKDNSITVIDDGRGIPIGIQKKTGIPAVEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSNWLEVEVTRDGKVYKQRYERG-KVMYKLKEIGEAPDKSGTKVTFLPDDTIFEQTVYDFDTLRNRLREIAFLTKGLRITLTDLREEPAKVRSFHYEGGIKEFVQYLNRHKTPLYEKVIYCEGM----------KNDVMVEVALQHNDSYNESTYSFVNNIVTPEGGTHLTGFKAAITKVFNDYARKNGILKDKDDNLSGDDLREGLTAVISVKIGNPQFEGQTKQKLGNSEARPAVEGIVTEQITYFLEQNPDVAKIIVNKATLAQRARIAARKARDVARKANLGDNMALPGKLADCSDKDPKNCEIYIVEGDSAGGSAKTARSRSTQAILPLRGKILNVEKARIDRILGNEEIKAMITAFGTGIHENFDISKLRYNKIIIMTDADVDGAHIATLLLTFFYRFMPDLIRKGHVYLAQPPLYKLEKNKKIWYAYSDDELNRILNEVGRDNNKIQRYKGLGEMDPEQLWETTMDPERRILLKVDDDDESEIDMTFNVLMGDKVEPRREFIEKNAKYVKNLDI 641
108 0.000e+00JGI.Meta 7053520360 C2698736__gene_203079 DNA gyrase, B subunit [Human Supragingival plaque microbiome from visit number 2 of subject 158479  ali  52  1MAEQT---NYDAGNIQVLEGLEAVRMRPGMYIGSTSARGLHHLVYEVVDNSVDEALAGYATHIEVTICEDNSIEVIDDGRGIPTGMHE-TGMPAVELVLSKLHAGGKFGGGGYKVSGGLHGVGISVVNALSEWTIVDVYQHGKIQEISFERGNK-TSDLKEIGTTD-RTGTTVRFKPDAQIFETTIFEFDVLKTRLQELAFLNKGLRITLSDKR-GEGRSESFHYEGGLVQFIEYLNEAKEAITPSVISIDNT----------RDDVVVDVALQYNDSYSETILSFVNNINTIDGGTHLSGFRTALTRTLNDYGRKAGILKENESNLTGEDVREGLTAVVSVKVLEPQFEGQTKGKLGNSEVKGITDTIVSDGLRVFLEEHPAEAKKIIEKATNASRAREAARKARELTRRKNALEVSSLPGKLADCSEKDTTMTEIYLVEGDSAGGTAKQGRDRRYQAILPLRGKILNVEKARLDKILANAEIRSMITAFGTGIGQDFDITKSRYNKIIIMTDADVDGAHIRTLLLTFFYRYMRPLIEEGHVFIAQPPLYQIKKGQKQWYAYSDQELSDRLDEIGREGITIQRYKGLGEMNAEQLWDTTMNPEHRTILQVSMEDSIAADKIFSVLMGDKVEPRRKFIEDNAEYVRNLD. 632
109 0.000e+00gi|547196535|ref|WP_021937858.1| dNA gyrase subunit B [Coprococcus sp. CAG:782]  clstr ali  52  3....NNYEEYDADQIQILEGLEAVRKRPGMYIGSTSERGLHHLVYEIVDNSVDEALAGFCTHIEVFINKDNSITVIDDGRGIPIGIQKKTGIPAVEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSNWLEVEVTRDGKVYKQRYERG-KVMYKLKEIGEAPDKSGTKVTFLPDDTIFEQTVYDFDTLRNRLREIAFLTKGLRITLTDLREEPAKVRSFHYEGGIKEFVQYLNRHKTPLYEKVIYCEGM----------KNDVMVEVALQHNDSYNESTYSFVNNIVTPEGGTHLTGFKAAITKVFNDYARKNGILKDKDDNLSGDDLREGLTAVISVKIGNPQFEGQTKQKLGNSEARPAVEGIVTEQITYFLEQNPDVAKIIVNKATLAQRARIAARKARDVARKANLGDNMALPGKLADCSDKDPKNCEIYIVEGDSAGGSAKTARSRATQAILPLRGKILNVEKARIDRILGNEEIKAMITAFGTGIHENFDISKLRYNKIIIMTDADVDGAHIATLLLTFFYRFMPDLIRKGHVYLAQPPLYKLEKNKKIWYAYSDDELNRILNEVGRDNNKIQRYKGLGEMDPEQLWETTMDPERRILLKVDDDDESEIDMTFNVLMGDKVEPRREFIEKNAKYVKNLDI 641
110 0.000e+00  ali  52  1MTEENKNKEYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFATHIEVFIEKDDSITVVDDGRGIPVDIQEKTGRPAVETVFTILHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVSVHRNGKIHYQEYRRG-HVVSDLAVIGDTD-RHGTTVHFTPDPEIFETTVFDFDKLAKRIQELAFLNRGLRISITDKREGIEQEKHYHYEGGISSYVEFINENKEAIFENPIYTDG----------ELDGVSVEVAMQYTTSYHETVMSFANNIHTHEGGTHEQGFRTALTRVINDYARQNKLLKEKDDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFSRFLLENPQIAKKIVEKGILASKARIAAKRAREVTRKKSGLEISNLPGKLADCSSNDATMNELFIVEGDSAGGSAKSGRDREHQAILPIRGKILNVEKASMDKILANEEIRSLFTAMGTGFGAEFDVSKARYHKLVIMTDADVDGAHIRTLLLTLIYRFMRPVLEAGYVYIAQPPIYGVKVGSEIEYANQEIELQEAMARVGRSKPTVQRYKGLGEMDDHQLWETTMDPENRLMARVSVDDAAEADKIFDMLMGDRVEPRREFIEENAVYST-LDI 650
111 0.000e+00gi|496681499|ref|WP_009323697.1| DNA gyrase subunit B [Subdoligranulum sp. 4_3_54A2FAA]  clstr ali  49  1MSEQQPQHEYDGSQIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNAIDEALAGFCDHIEVNIREGNIIRVTDNGRGIPVDIQPKLGIPAVTVVFTILHAGGKFGGDGYKVAGGLHGVGASVVNALSEWLNVVVRKDGVAYKQSFKRGV-ADADLQNLGPTDEPDGTTVTFKPDPEMFEVLDYDYDTLNTRLREEAFLNAGVRITLTDERAGQEKQESMCYEGGIRSFVDHIHQKREVLHPDVIYLKGQL----------NDSIAEVALQYNNSYNELILSFANNVNTPDGGTHEEGFKSALTRVFNDFGREKGYIKEKDDNLSGSDVREGLTAVISVKLTEAQFEGQTKAKLGNTEIRGLVSGIVYDKLKEFFEENPAVAKAIYEKAMQXXXXXXXXXXXXXLVRRKSALENSRMPGKLADCREKDPTKTEIYIVEGDSAGGSAKMGRDSKIQAILPLWGKMLNVEKARIDKIYGNDKLTPVVTALGCGLGEEFDVSKLRYHKVFIMADADVDGSHICTLLLTFFFRYMRPLIEGGYVYIAQPPLFKLQKGKQVRYAYNEPEMSQISAEMG-QGTKVSRYKGLGEMNPEQLWETTMDPEHRVIVQITIEDAMAADEAFTILMGDKVEPRKEFIERNAQYA-NLDV 642
112 0.000e+00gi|489873886|ref|WP_003777406.1| DNA gyrase subunit B [Alloiococcus otitis]  clstr ali  53  14....ELKKTYDASQIQVLEGLEAVRVRPGMYIGSTSKEGLHHLVWEIVDNAIDEAMAGYADKISVSILEGDVIQVADNGRGIPVDIQEKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSEYLQVQVHRDGKIYQQVYKRGL-VDSDLEVVGETDH-TGTIVTFKADSLIFDTTSYDFDTLATRIRELAFLNRGLNISIEDKRQADGQSLNYHFEGGISSYVDHLNSKREVLYETPIFLEG----------EEEGISVEIALQHTDSFHTNLMSFANNIHTYEGGMHISGFKTALTRAVNDYARKNNLLRESEDNFTGDDVREGLTVVLSIKHPDPQFEGQTKTKLGNSEVRGIIDRLFSQHFERYLMENPKVGKRIVDKALLASKARQAAKRAREVTRKKSGLEISNLPGKLADCSSKDPEESELFIVEGDSAGGSAKQGRSRIFQAILPIRGKILNVEKASIDRILANEEIRSLFTAMGTGFGEEFNVEEARYNKLIIMTDADVDGAHIRTLVLTLLYRYMRPLIEAGFVYIAQPPLYQVKQGKKVKYLDSDRELDSYLKEIPDPKPSVQRYKGLGEMDAEQLWETTMNPEHRRLLRVDVDDAIEADTIFDMLMGEDVKPRRDFIKENARYVENIDI 649
113 0.000e+00gi|547770633|ref|WP_022182171.1| dNA gyrase subunit B [Clostridium sp. CAG:575]  clstr ali  52  2...EKYNHKYGAEQIQVLEGLEAVRKRPGMYIGSTSVRGLHHMVYEIVDNGVDEALAGYCTEINVNIEPGNIISVQDNGRGIPVEIHPKTHISTAETVYTVLHAGGKFGGDGYKVSGGLHGVGASVVNALSSWTEVTIERDGGIYNMKFEKG-KTVKKLEKIGES-KKTGTLVRFLADNTIFESLEYEYDVLEKRLREIAFLTKGLKITLEDKRDEEIKKAEFCYEGGLISFVEFLNKNKEKIHPTPIYIEKA-----------GEVPVEIAIQYTTSYSENIYTFVNNINTVEGGTHLEGFKRALTKVFNDYARSHNILKEKDNNLQGEDIREGITAVVSVKVKEPQFEGQTKTKLGNSEVTGVVQSMVNDALATFLEENPQIAKAILEKCVSASRAREAARKARELVRKKNSMETSTLPGKLADCSSKNPEECEVYIVEGDSAGGSAKQGRDRKFQAILPLWGKMLNVEKARADKIYGNDKLNPVILAVGAGIGADFDITKIRYGKVIIMADADVDGAHIRTLLLTFFFRYMRPLIENGNVFLAQPPLYKLKKGMEDLYCYTDEDLAKAYEDLEQKGIALQRYKGLGEMNPEQLWETTMNPETRILVKVTMDDAIKADETFTLLMGDEVEPRREFIEQNAKYVQNLDI 643
114 0.000e+00  ali  49  1MSEENTATEYSADSIQVLEGLEAVRKRPSMYIGDTGEKGLHHLVYEVVDNSIDEALAGFCSHVDVVINEDNSINVTDDGRGIPVDIHEKEGKSALEVVLTVLHAGGKFDKGTYKVSGGLHGVGVSCVNALSTYLRAEVRRNGKIHMQEFSCG-KPLHDVQIIGDTE-TTGTTISFKPDGSIFTVTEYKYDILATRLRELAFLNAGITLTLTDKRDGSYKSETFHSKDGLMEFVRYIDRSKEKLIPDVIHI----------VTEKQGIPVEVAMTYNTSYNESVFSYVNDINTIEGGTHLAGFRRGLTRTLKKYAEDSKLLEKAKVEIQGDDFREGLTAVISIKVAEPQFEGQTKTKLGNSEVTGAVDMAVGEALGYYLEEHPKEAKIIVDKVILAAQARHAARKARELVQRKSPMTGGGLPGKLADCSSKDASICELFLVEGDSAGGTAKQGRDRNFQAILPLRGKILNVEKAMDHKIFESEEIQNIYRAMGVTVGTELNLEKLRYHKVIIMTDADVDGSHIATLILTFFFRRMRALIENGYVYLATPPLYLCKKGKVEEYCWTDQQRQMFINKYGGGNIHTQRYKGLGEMNDHQLWDTTMNPANRTLKQITIDNAAEADQIFAMLMGEDVGPRREFIEENATYA-NID. 650
115 0.000e+00JGI.Meta 7036458669 SRS015217_WUGC_scaffold_9203__gene_15534 DNA gyrase, B subunit [Human Stool microbiome from visit number 1 of subject 76  ali  49  1MSEQQPQHEYDGSQIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNAIDEALAGFCDHIEVNIREGNIIRVTDNGRGIPVDIQPKLGIPAVTVVFTILHAGGKFGGDGYKVAGGLHGVGASVVNALSEWLNVVVRKDGVAYKQSFKRGV-ADADLQNLGPTDEPDGTTVTFKPDPEMFEVLDYDYDTLNTRLREEAFLNAGVRITLTDERAGQEKQESMCYEGGIRSFVDHIHQKREVLHPDVIYLKGQL----------NDSIAEVALQYNNSYNELILSFANNVNTPDGGTHEEGFKSALTRVFNDFGREKGYIKEKDDNLSGSDVREGLTAVISVKLTEAQFEGQTKAKLGNTEIRGLVSGIVYDKLKEFFEENPAVAKAIYEKAMQXXXXXXXXXXXXXLVRRKSALENSRMPGKLADCREKDPTKTEIYIVEGDSAGGSAKMGRDSKIQAILPLWGKMLNVEKARIDKIYGNDKLTPVVTALGCGLGEEFDVSKLRYHKVFIMADADVDGSHICTLLLTFFFRYMRPLIEGGYVYIAQPPLFKLQKGKQVRYAYNEPEMSQISAEMG-QGTKVSRYKGLGEMNPEQLWETTMDPEHRVIVQITIEDAMAADEAFTILMGDKVEPRKEFIERNAQYA-NLDV 642
116 0.000e+00JGI.Meta 7010321462 C937608__gene_91996 DNA gyrase, B subunit [Human Stool microbiome from visit number 2 of subject 158924089]  ali  52  1.....VSNNYQAEDITVLEGLEAVRKRPGMYIGTTSERGLHHLVWEIVDNSVDEALAGYCTHIEVSILPDNVIEVVDNGRGIPVDIHPKYGKSALEIVLTVLHAGGKFENDNYKVSGGLHGVGVSVVNALSLWTEVEVRKNGKVWYQKYNRGIP-EEAVKEIGVTE-EHGTTVRFKADHEIFETLVYDYNTLKNRLKELAYLNKGLVITLTDSRKEPFKKEIFEFEGGIADFLREITEDTEKLIKEPIYMTG----------EVDNIGVEIAFLYTVNQSEIIYSFVNNINTHEGGTHVQGFRTALTRIINDVGKAQGLLKDKDGKLQGTDIREGVTAIVSVKVPQPQFEGQTKTKLGNSEVTGIVSTVVGGQLKMILEDNPNDTKVIIEKILNSKKAREAAQRARELVLRKSALEVGSLPGKLADCSSKNPEECEIYIVEGDSAGGSAKQGRDRYHQAILPLRGKILNVEKAGLHKALENNEVRAMITAFGTGIGDNFNIEKLRYGKIILMTDADVDGAHIRTLLLTFIYRYMIELIYNGNVFIAQPPLYKISYGKQIKYAYSDRELKEITEEGEDKKYTLQRYKGLGEMNPEQLWETTMDPQNRTLLKVTIDDARAADMLFDKLMGDKVDPRREFIEENAEYVKNLDI 635
117 0.000e+00  ali  48  2..EQNNHTNYNANEIQVLEGLEAVKRRPGMYIGSTDVRGLHHLVKELVDNAIDEAMGGYCTHIEVTIHPDNSVSVRDNGRGIPVGYHEKMHKSALEVALTVLHAGGKFGGSGYKVSGGLHGVGLSVVNALSSRLTAEVRRDGIIYRQEYVNGDPVTG-VEQAGTYGDDTGTTITFLANDQIFDTLDYNYDTLRGRMRELAFLNKGVAITVTDQRTDPVQSKKYCYEGGIISFVEHLNKSKDVLHEDVMYFEGSKDDPAKQQVA----SVEVAMQYNTDYNESVFTFANNINTVEGGTHLQGFRSALARSINDYARKYKLLKDNEANLSGDDVREGLTAIVSVKLVEPQFEGQTKTKLGNSYMKSLVDNVVGNGLGFYLEEHPQTARLIIDKCITXXXXXXXXXXXXDLTRKKTGLENISLPGKLADCNSNEPEKCEIFLVEGDSAGGSAKMGRNPEFQAILPLRGKILNVEKTRLDKMLANNEIRSMITAFGTGIDTEFDESKLRYHKIVCMTDADVDGAHIRILLLTFFYRHMRPLIEHGHIYAAQPPLYRITRGKNIWYAYDDEQLGRILNEIGRDKPLINRYKGLGEMNPDQLWETTMDPDNRMMYRVHLEDAIRADEIFSTLMGDKVEPRKEFIEQNSKLVVDLDV 647
118 0.000e+00JGI.Meta 7047907711 SRS063985_LANL_scaffold_21558__gene_35517 DNA gyrase, B subunit [Human Stool microbiome from visit number 2 of subject 7  ali  51  2...EKYNHKYGAEQIQVLEGLEAVRKRPGMYIGSTSVRGLHHMVYEIVDNGVDEALAGYCTEINVEIEPGNIISVQDNGRGIPVEIHPKTHISTAETVYTVLHAGGKFGGDGYKVSGGLHGVGASVVNALSAWTEVTIERDGGIYQMSFEKG-KTVKKLEKIGES-KKTGTKVRFLADDTIFESLDYEYEVLEKRLREIAFLTKGLKITLEDKRDENIKKADFCYEGGLISFVEFLNKNKEKIHPTPIYIERA-----------GEVPVEIAIQYTTSYSENIYTFVNNINTIEGGTHLEGFKRALTKVFNDYARSHNIIKEKEANLQGEDIREGITAVVSVKVKEPQFEGQTKTKLGNSEVTGVVQSMVNDALATFLEENPQVAKAILEKCVSASRAREAARKARELVRKKSSLETSTLPGKLADCSSKNPEECEVYIVEGDSAGGSAKQGRDRKFQAILPLWGKMLNVEKARADKIYGNDKLNPVILAVGAGIGNDFDITKIRYGKVIIMADADVDGAHIRTLLLTFFFRYMRPLIENGNVFLAQPPLYKLKKGMEDIYCYTDEDLAKSYSDLEKKGISLQRYKGLGEMNPEQLWETTMNPETRILVKVTMDDAIKADETFTLLMGDEVEPRREFIQQNAKYVQNLD. 642
119 0.000e+00JGI.Meta 7004321701 SRS013164_Baylor_scaffold_7075__gene_8657 DNA gyrase, B subunit [Human Tongue dorsum microbiome from visit number 1 of s  ali  53  9...EEKAQEYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFATHIQVFIEPDNSITVVDDGRGIPVDIQEKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVKVYKNGHIHFQEYKRGV-VVADLAVIGETEK-HGTTVHFTPDPEIFETTEFDFGKLAKRIQELAFLNKGLRISITDKREGLEQEKHYHYEGGITSYVKYINENKDVIFDEPIYTDG----------EMDGISVEVAMQYTTGYHETVMSFANNIHTHEGGTHEQGFRTALTRVINDYARQNKILKEKDDNLTGDDVREGLTAIISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEALSRFLLENPAIAKKIVEKGILASKARIAAKRAREVTRKKSGLEISNLPGKLADCSSNNAEMNELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKASMDKILANEEIRSLFTAMGTGFGAEFDVSKARYHKLVIMTDADVDGAHIRTLLLTLIYRFMRPVLEAGYVYIAQPPIYGVKVGSEIEYADQEDKLRAALEKYGRSKPTVQRYKGLGEMDDHQLWETTMDPENRLMARVSVDDAAEADKIFDMLMGDKVEPRREFIEENAVYST-LDI 650
120 0.000e+00gi|547742355|ref|WP_022155807.1| dNA gyrase subunit B [Firmicutes bacterium CAG:145]  clstr ali  52  1MSDEKTNGQYDAAQIQVLEGLEAVRKRPGMYIGSTGARGLHHLVYEIVDNSVDEALAGYCTTIKVTINKDNSITVEDDGRGMPVDKHPKLKIPAVEVIHTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTHMEVEIRRNGKIYKQCYERG-KTVTPLEVIGDS-KKTGSKTSFWPDPEIFETTIFDFDTLEHRLREMAFLNKGIKIIFKDEREGKKRSETYHYEGGIKEFVKFQNQNKDAIHPDIIYFE----------VVRDTCEVEIAMQYTESYNELVLGYANNINTTDGGTHIVGFKSALTRIFNDYGKKAKILKEND-TLSGEDVREGLTAIVSVKLAEPQFEGQTKAKLGNPDMRGFVETTTNENLTAFLEENPAQAKIILEKCIXXXXXXXXXXXXXDLTRRKGALDSFSLPGKLADCSDKDPSQCEIFLVEGDSAGGSAKDGRDRKRQAILPLRGKILNVEKARLDRILNSDEIKNMITAFGCGIGDDFNVEKLRYHKIIIMTDADVDGAHIRTLLLTFFYRYMRPLIEGGFVYAAQPPLYQVKKGKDVYYTYGEDEQTELMKEGKAGKADIQRYKGLGEMDAEQLWDTTMDYEHRTLIQITIEDSAAADQTFSTLMGDKVPPRKKFIEDNAHYAT-IDI 640
121 0.000e+00METAHIT O2 GL0077580 [Complete] locus=scaffold4857_6:6506:8428:+  ali  52  1MSDEKTNGQYDAAQIQVLEGLEAVRKRPGMYIGSTGARGLHHLVYEIVDNSVDEALAGYCTTIKVTINKDNSITVEDDGRGMPVDKHPKLKIPAVEVIHTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTHMEVEIRRNGKIYKQCYERG-KTVTPLEVIGDS-KKTGSKTSFWPDPEIFETTIFDFDTLEHRLREMAFLNKGIKIIFKDEREGKKRSETYHYEGGIKEFVKFQNQNKDAIHPDIIYFE----------VVRDTCEVEIAMQYTESYNELVLGYANNINTTDGGTHIVGFKSALTRIFNDYGKKAKILKEND-TLSGEDVREGLTAIVSVKLAEPQFEGQTKAKLGNPDMRGFVETTTNENLTAFLEENPAQAKIILEKCIXXXXXXXXXXXXXDLTRRKGALDSFSLPGKLADCSDKDPSQCEIFLVEGDSAGGSAKDGRDRKRQAILPLRGKILNVEKARLDRILNSDEIKNMITAFGCGIGDDFNVEKLRYHKIIIMTDADVDGAHIRTLLLTFFYRYMRPLIEGGFVYAAQPPLYQVKKGKDVYYTYGEDEQTELMKEGKAGKADIQRYKGLGEMDAEQLWDTTMDYEHRTLIQITIEDSAAADQTFSTLMGDKVPPRKKFIEDNAHYAT-IDI 640
122 0.000e+00JGI.Meta 7050368483 SRS063603_LANL_scaffold_35986__gene_36759 DNA gyrase, B subunit [Human Supragingival plaque microbiome from visit number  ali  48  25MSDTTNNSEYGASSIQVLEGLEAVRKRPAMYIGDVGEKGLHHLVYEVVDNSIDEALAGYCKNISVTINKDNSITVKDDGRGIPVDIHEKEGKSALEVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSDHLRAEVCRNGKRYVQEYSRGVP-LGDVKEVG-TSSETGTTITFHPDKEIFNDINYKYSILVKRMRELAFLNAGIRLSITDLRTEEEKTEEFYSENGLREFVKYIDSTREPLINEVIYID----------TNKYGTPVEVAMMYNTSYTENLHSYVNNINTIEGGTHVTGFRSALTRTLKKYADDNKLLEKAKVEIASDDFREGLTAVISVKVAEPQFEGQTKTKLGNDDVKGMVDRAVAEALNTFLEEHPKEAKTIVEKIILAATARNAARKAREMVQRKSPLSGGGLPGKLADCSSRDASQCEIFLVEGDSAGGSAKQGRDRNFQAILPLRGKILNVEKAMRHKAFESEEVRNIYTALGVTIGTELNLDKLRYNKVVIMTDADVDGSHIATLILTFFFRYMKELIENGHVYIATPPLYLCKKGKVQEYCWNEEQRMRFIEKYGDGKITQQRYKGLGEMNAEQLWETTMDPTNRTLRQITIENAAEADYTFSMLMGDDVAPRRQFIEENATYA-NID. 676
123 0.000e+00METAHIT MH0075 GL0011272 [Complete] locus=scaffold30693_7:96:2039:-  ali  49  2..EQNNHTNYNANEIQVLEGLEAVKRRPGMYIGSTDVRGLHHLVKELVDNAIDEAMGGYCTHIEVTIHPDNSVSVRDNGRGIPVGYHEKMHKSALEVALTVLHAGGKFGGSGYKVSGGLHGVGLSVVNALSSRLTAEVRRDGIIYRQEYVNGDPVTG-VEQVGTYGDDTGTTITFLANDQIFDTLDYNYDTLRGRMRELAFLNKGVAITVTDERTDPVQSKKYCYEGGIISFVEHLNKSKDVLHEDVMYFEGSKDDPARQQVA----SVEVAMQYNTDYNESVFTFANNINTVEGGTHLQGFRSALARSINDYARKYKLLKDNEANLSGDDVREGLTAIVSVKLVEPQFEGQTKTKLGNSYMKSLVDNVVGNGMGFYLEEHPQTARLIIDKCITXXXXXXXXXXXXDLTRKKTGLENISLPGKLADCNSNEPEKCEIFLVEGDSAGGSAKMGRNPEFQAILPLRGKILNVEKTRLDKMLANNEIRSMITAFGTGIDTEFDESKLRYHKIVCMTDADVDGAHIRILLLTFFYRHMRPLIEHGHIYAAQPPLYRITRGKNIWYAYDDEQLGRILNEIGRDKPLINRYKGLGEMNPDQLWETTMDPDNRMMYRVHLEDAIRADEIFSTLMGDKVEPRKEFIEQNSKLVVDLDV 647
124 0.000e+00METAHIT V1 GL0008743 [Complete] locus=scaffold3048_2:4813:6870:+  ali  50  47..DTTVSEKYDADQIQVLEGLEAVRKRPGMYIGSTGPKGLHHLVYEIVDNSIDEALAGFCTHIEVEILPNDIITVRDNGRGIPVGINEKSGIPAVTLVLTVLHAGGKFGGSGYKVSGGLHGVGSSVVNALSEWMEIEVSQDGHIHYQRFERGN-IASKLTVIGDTD-ETGTFIKFKADPEIFETTVYEYEVLQRRLREQAFLNAGLSITLTDSRDENIVSEKFCYEGGISSFVEYINESRTPLHEKPIHL----------ITVAGDRSAEVAMMYNDSYNETILSFANNVHTIDGGTHETGFKTALTRVFNDYGRKYGILKENDKNLSGDDVREGLVAVVSVKLTDAQFEGQTKGKLGNTDMGQMVSQMIYEKLMTFFEENPAVIKAIYAKXXXXXXXXXXXXXXXXXXXXKSALEGNSLPGKLADCTDRNPENTEIYIVEGDSAGGSAKEGRDRTFQAILPLWGKMLNVEKSRLDKVIGNEKLMPVVTALGTGIGDEFDITKLRYHKVVIMADADVDGAHIRTLMLTFFFRYMRPLIDSGYIYIAQPPLFKVSKGKKVKYAFSDEERDEFIAEFGG-NCDVQRYKGLGEMDPQQLWETTMDPEFRTMLRVTLEDAMQADETFSILMGDKVEPRREFIEKNAKYVQNLDI 685
125 0.000e+00  ali  50  47..DTTVSEKYDADQIQVLEGLEAVRKRPGMYIGSTGPKGLHHLVYEIVDNSIDEALAGFCTHIEVEILPNDIITVRDNGRGIPVGINEKSGIPAVTLVLTVLHAGGKFGGSGYKVSGGLHGVGSSVVNALSEWMEIEVSQDGHIHYQRFERGN-IASKLTVIGDTD-ETGTFIKFKADPEIFETTVYEYEVLQRRLREQAFLNAGLSITLTDSRDENIVSEKFCYEGGISSFVEYINESRTPLHEKPIHL----------ITVAGDRSAEVAMMYNDSYNETILSFANNVHTIDGGTHETGFKTALTRVFNDYGRKYGILKENDKNLSGDDVREGLVAVVSVKLTDAQFEGQTKGKLGNTDMGQMVSQMIYEKLMTFFEENPAVIKAIYAKXXXXXXXXXXXXXXXXXXXXKSALEGNSLPGKLADCTDRNPENTEIYIVEGDSAGGSAKEGRDRTFQAILPLWGKMLNVEKSRLDKVIGNEKLMPVVTALGTGIGDEFDITKLRYHKVVIMADADVDGAHIRTLMLTFFFRYMRPLIDSGYIYIAQPPLFKVSKGKKVKYAFSDEERDEFIAEFGG-NCDVQRYKGLGEMDPQQLWETTMDPEFRTMLRVTLEDAMQADETFSILMGDKVEPRREFIEKNAKYVQNLDI 685
126 0.000e+00JGI.Meta 7042342768 SRS011586_WUGC_scaffold_33837__gene_85288 DNA gyrase, B subunit [Human Stool microbiome from visit number 1 of subject 1  ali  50  47..DTTVSEKYDADQIQVLEGLEAVRKRPGMYIGSTGPKGLHHLVYEIVDNSIDEALAGFCTHIEVEILPNDIITVRDNGRGIPVGINEKSGIPAVTLVLTVLHAGGKFGGSGYKVSGGLHGVGSSVVNALSEWMEIEVSQDGHIHYQRFERGN-IASKLTVIGDTD-ETGTFIKFKADPEIFETTVYEYEVLQRRLREQAFLNAGLSITLTDSRDENIVSEKFCYEGGISSFVEYINESRTPLHEKPIHL----------ITVAGDRSAEVAMMYNDSYNETILSFANNVHTIDGGTHETGFKTALTRVFNDYGRKYGILKENDKNLSGDDVREGLVAVVSVKLTDAQFEGQTKGKLGNTDMGQMVSQMIYEKLMTFFEENPAVIKAIYAKXXXXXXXXXXXXXXXXXXXXKSALEGNSLPGKLADCTDRNPENTEIYIVEGDSAGGSAKEGRDRTFQAILPLWGKMLNVEKSRLDKVIGNEKLMPVVTALGTGIGDEFDITKLRYHKVVIMADADVDGAHIRTLMLTFFFRYMRPLIDSGYIYIAQPPLFKVSKGKKVKYAFSDEERDEFIAEFGG-NCDVQRYKGLGEMDPQQLWETTMDPEFRTMLRVTLEDAMQADETFSILMGDKVEPRREFIEKNAKYVQNLDI 685
127 0.000e+00gi|502482587|ref|WP_012802431.1| DNA-cytosine methyltransferase [Cryptobacterium curtum]  clstr ali  49  1MADNK-PSHYDGKDIQVLEGLEPVRKRPGMYIGSTSERGLHHLVYEVVDNSVDEALAGYCTDIQVWICDDGSIKVQDNGRGIPVDKHPKEHIPTVEVVLTILHAGGKFGGEGYKVSGGLHGVGVSVVNALSTQMKVQVCRDGKRYEITFSRG-KTVEKLHVVGDS-KHTGTTVRFWPDPEIFETTVFNYNTLAERFREMAFLNKGLKITLYDEREGVAKHETFQFQDGIKDFVKFLTTGKEVLNTKPIYFEAEGPAG----------EVEVAMQWTSSFSTNVFSFANNINTIEGGTHLDGFKQAVTRTINDYAREKGILKEKDSNLTGDDCREGLSAVISVKLHDPQFEGQTKTKLGNSEMRQLVSSAVNQGLGEYLEENPTPAKRIINKASQALKAREAARKAREMTRRKNVLDSFALPGKLADCSSKNAADCEMFIVEGDSAGGSAKQARDRKYQAILPLRGKILNVERAGLHRALSSDTISSLITAVGTNIGDDFDAEKARYHRIIIMTDADVDGAHIQILLLTFFYRYMPELINRGYIYIAMPPLYGIKEGKKIRYVYNDNALAEAMKDYPDKKPSVQRYKGLGEMDPDQLWETTMEPETRILMQVGIEDAAAAERAVSELMGDQVEPRKEYIQKHAKDVRFLDI 645
128 0.000e+00gi|493572035|ref|WP_006525265.1| DNA gyrase subunit B [Solobacterium moorei]  clstr ali  56  24..DMKVTHTYNDSDIQVLDGLEAVRKRPGMYIASTSSKGLHHLVWEIVDNGIDEAMAGYASTVTVTVDKDNIITVEDDGRGMPTGIHEKTGKSTIETIFTVLHAGGKFGGGAYKVSGGLHGVGASVVNALSSWLEVTVFHDGKEYYIRFENGGHPVGTLIEKGTCPDKHGSTVRFKADPTIFTETVYEHDILRDRLRQLAFLNKSICLKFNDLREEDERHYVFKFDGGLKQYTEFLNRNRDVVNHEIIYSEGYES----------NIQVEVACQYNDGYNPNIYTFCNNINTAEGGTHEEGFRLALNRVINKYARDTGFLKEKDDNLTTDDCREGLTAVISVKHPDPQYEGQTKTKLGNSEVRKIVSDIFGTQLERYLMENPDEAKVILEKVALASQARMAAKKARELTRRKSALEVSPLPGKLADCSSKDASICEIYIVEGQSAGGSAKQGRDSHFQAILPLRGKILNVEKARQSRIYENAEIRSMITAFGCGVSDEIDLEKLRYHKIVIMTDADVDGAHIRTLLLTFFYRYLRPLLEQGYIYIAQPPLYKVQKGQTVRYAYTDNQLEEVKRELG-DRLSIQRYKGLGEMNPEQLWETTMDPKNRTLIRVAVGDAEAADYNFTMLMGEEVEPRKNFIVENAHFAENLD. 663
129 0.000e+00gi|497001487|ref|WP_009433477.1| DNA-cytosine methyltransferase [Porphyromonas sp. oral taxon 279]  clstr ali  50  1MSEETNEKEYSASSIQVLEGLEAVRKRPAMYIGDIGEKGLHHLVYEVVDNSIDEALAGYCNDIKVTIHEDNSIEVQDNGRGIPVDIHEKEGKSALEVVLTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTLLKATVQRDGKIYTQEFSRGVPTT-ELQTIGTTDK-TGTTVLFKPDDTIFTSTEYQFKILATRLRELAFLNAGITLTLTDERQGVALTETYYSEKGLEEFVKYIDRSKEHLIEDVIHI----------ITEKQGIPVEVAMTYNTSYNENVYSYVNNINTIEGGTHLAGFRRGLTRTLKKYATDSKLLDKVKVEITGDDFREGLTAVVSIKVAEPQFEGQTKTKLGNNEVMGAVDVAVSEALEIYLEEHPKEAKIIVDKVILAATARQAARKAREMVQRKSPLSGGGLPGKLADCSSKDPILSELFLVEGDSAGGTAKQGRDREFQAILPLRGKILNVEKAMQHKVLESEEIRNIYTALGVTIGTELNLSKLRYHKVIIMTDADVDGSHIATLILTFFFRNMRSLIENGYVYIATPPLYLCTRGKEREYCWTEQQRQAFIDRVGGGRVRVQRYKGLGEMNEEQLWETTMNPENRTLRKITIENAAEADAIFSMLMGDDVAPRREFIEANATYAR.... 652
130 0.000e+00gi|496138399|ref|WP_008862906.1| DNA-cytosine methyltransferase [Barnesiella intestinihominis]  clstr ali  48  1MSEETENKSYSADSIQVLEGLEAVRKRPAMYIGDIGVKGLHHLVYEVVDNSIDEALAGYATHIEVYINEDNSIRVVDNGRGIPVDMHEKEHKSALEVVLTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTYLRAEIRRNGKIYMQEYSCG-KPLHDVEIIGETE-ETGTTIIFRPDDSIFSVTVYDYNILANRLRDLAYLNAGITLSLTDKRTGEYRKEVFYSKEGLKEFVRYIDSNKEHLIDDVIHI----------ATERQGVPVEVAMTYNTTYNENVYSYVNNINTIEGGTHLTGFRRGLTRTLKKYAEDSKMLEKVKVEISSDDFREGLTAVISVKVMEPQFEGQTKTKLGNSEVIGAVDTAVSEALANYLEEHPAQAKTIVEKVIIAATARHAARKAREMVQRKSPLSGGGLPGKLADCSSRNPEDCEIFLVEGDSAGGSAKQGRDRMFQAILPLRGKILNVEKAMDHKVFESQEISNMFKALGVTIGTEEDIEKLRYHKIIIMTDADVDGAHIATLLLTFFFRRMRPLLEQGYVYLATPPLYKCKRGKTEEYCWTDQQKDQFCLKYCEGNMETQRYKGLGEMNPHQLWETTMDPENRILKQVTIDNAAEADRVFSMLMGEDVGPRREFIESNATYA-NID. 650
131 0.000e+00gi|547854569|ref|WP_022261483.1| dNA gyrase subunit B [Butyrivibrio sp. CAG:318]  clstr ali  52  1MS---KSNDYTADQIQILEGLEAVRKRPGMYIGSTSSKGLHHLVYEIVDNAVDEALAGYCTEIFVQINEDNSITVIDNGRGIPVGINTKSGLTGVEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVKVFQDGKVYEQRYERG-KVMFPLKVVDECPDKTGTEVKFLPDKEIFEETVYDYNILKQRLREMAFLTKNIKITLKDVRDDNHKEKVFHYEGGIKEYVKYLNKGNDALYDNIIYCEGT----------KDDVYVEVAFQHNNGYSDNVYGFVNNITTPEGGTHVTGFRNAVTKTFNDYARTNKILKDKDQNLSGEDIREGLTAIISIKIQDPQFEGQTKQKLGNTEARGAVESVVTEQLTYFLEQNPSVAKVICEKSILAQRAREAARHARDLTRRKTALDGFKLPGKLADCSDKDPSHCEIFIVEGDSAGGSAKSARKRETQAILPLRGKILNVEKARLDRILGNAEIRAMITAFGTGIHEDFDISKLRYDKIIIMTDADVDGAHISTLLLTFFYRFMPDLIKDGHVYLAQPPLFKLEKNKKVWYAYSDEELADILKEVGRDNNKIQRYKGLGEMDASQLWETTMDPEKRILKKVIYDDASEIDVTFSTLMGDKVEPRREFIEENAKFVKNID. 639
132 0.000e+00gi|651266905|ref|WP_026400121.1| DNA gyrase subunit B [Acholeplasma equifetale]  clstr ali  54  2..DNHQNNHYTADNIQILEGLEAVRKRPGMYIGSTGERGLHHLVWEIVDNSIDEALAGYADHIEIEVLKDNVIRVSDNGRGIPVDIHPKTGRPAVETILTTLHAGGKFDKGSYKVSGGLHGVGASVVNGLSVWYVVEIHKDGKIYEQKYERGIPA-YDLKELGET-NRTGTITTFKADPLIFETTVYDIETLRTRIQQLAFLNRGITISLSDSRDENHIQETFKYDGGIIEYVKFLNQNKKTIHPDIIYFEK----------EQDGVTVEVAMQYVDTYTPNIHSFTNNISTTEGGMHEDGYKMALTRVISRYADDMKA--KKDDAIIGEDTREGLTAIISVKHPEPQFEGQTKTKLGNPEVRAITSQVTQEALERFLLENPQQAKSIVEKVIEATRARVASRKAKELARRKSPLDQLDFASKLADCRSKDPEKSELFIVEGDSAGGSAKQGRDSEFQAILPLRGKVLNVEKARIDTMLKNKEIINIIQAIGTGISEEFDISKLRYHKIVIMTDADVDGAHIRTLLLTFFFRHMRPLIENGHIYAAQPPLYKVSYGRNVKYAYSDEELNEITSKL-ETKPTLQRYKGLGEMNYEQLWDTTMNPETRTLLQIQLDDAIEADQIFTMLMGEEVEPRKEFIQKNAQYVTDID. 635
133 0.000e+00METAHIT MH0003 GL0066643 [Complete] locus=scaffold34773_1:6398:8365:+  ali  52  8MAEEDVTQDYDASQIQVLEGLEAVRKRPGMYIGTTTSQGLHHLVWEIVDNGIDEALAGFADHITVAIEKDNSITVTDNGRGIPVDIQEKTGKPALETVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELDVMVVRDGQGYAMDFERGVKTTMHSAPVDNAPVSRGTIVHFLPDPDIFETTTYDYKILMNRVRELAFLNKGLRISITDNRADESETESFHYEGGIKEYVRFLNVNKDVIFDDPIYVEGM----------ENGIEVEVSLQYTDDYHSNMLSFTNNIHTYEGGTHETGFKAALTRVINDYARKNGQLKENDDALSGDDVREGLTAIVSVKHPNPQFEGQTKTKLGNSDARTAVDRMFSETFNRFMMENPAVAKQIVEKGILAGKARMAAKRAREATRKKSGLEIANLPGKLADNTSKDPEISELFIVEGDSAGGSAKQGRERLTQAILPIRGKILNVEKASLDKILANEEIRSLFTAMGTGFGNEFDVTKAKYHKLIIMTDADVDGAHIRTLLLTLIYRYMRPLLDAGYIYIAQPPLYQVRQGKFVQYLDSDEELEALLPTLPAPKPVIQRYKGLGEMDAEQLWETTMDPSVRRLLRVEMDDAVDADQVFSMLMGDKVEPRREFIEENAQYAE-LDV 655
134 0.000e+00METAHIT O2 GL0049831 [Complete] locus=scaffold9801_1:4102:6024:-  ali  52  1MS---KSNDYTADQIQILEGLEAVRKRPGMYIGSTSSKGLHHLVYEIVDNAVDEALAGYCTEIFVQINEDNSITVIDNGRGIPVGINTKSGLTGVEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVKVFQDGKVYEQRYERG-KVMFPLKVVDECPDKTGTEVKFLPDKEIFEETVYDYNILKQRLREMAFLTKNIKITLKDVRDDNHKEKVFHYEGGIKEYVKYLNKGNDALYDNIIYCEGT----------KDDVYVEVAFQHNNGYSDNVYGFVNNITTPEGGTHVTGFRNAVTKTFNDYARTNKILKDKDQNLSGEDIREGLTAIISIKIQDPQFEGQTKQKLGNTEARGAVESVVTEQLTYFLEQNPSVAKVICEKSILAQRAREAARHARDLTRRKTALDGFKLPGKLADCSDKDPSHCEIFIVEGDSAGGSAKSARKRETQAILPLRGKILNVEKARLDRILGNAEIRAMITAFGTGIHEDFDISKLRYDKIIIMTDADVDGAHISTLLLTFFYRFMPDLIKDGHVYLAQPPLFKLEKNKKVWYAYSDEELADILKEVGRDNNKIQRYKGLGEMDASQLWETTMDPEKRILKKVIYDDASEIDVTFSTLMGDKVEPRREFIEENAKFVKNID. 639
135 0.000e+00  ali  52  8MAEEDVTQDYDASQIQVLEGLEAVRKRPGMYIGTTTSQGLHHLVWEIVDNGIDEALAGFADHITVAIEKDNSITVTDNGRGIPVDIQEKTGKPALETVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELDVMVVRDGQGYAMDFERGVKTTMHSAPVDNAPVSRGTIVHFLPDPDIFETTTYDYKILMNRVRELAFLNKGLRISITDNRADESETESFHYEGGIKEYVRFLNVNKDVIFDDPIYVEGM----------ENGIEVEVSLQYTDDYHSNMLSFTNNIHTYEGGTHETGFKAALTRVINDYARKNGQLKENDDALSGDDVREGLTAIVSVKHPNPQFEGQTKTKLGNSDARTAVDRMFSETFNRFMMENPAVAKQIVEKGILAGKARMAAKRAREATRKKSGLEIANLPGKLADNTSKDPEISELFIVEGDSAGGSAKQGRERLTQAILPIRGKILNVEKASLDKILANEEIRSLFTAMGTGFGNEFDVTKAKYHKLIIMTDADVDGAHIRTLLLTLIYRYMRPLLDAGYIYIAQPPLYQVRQGKFVQYLDSDEELEALLPTLPAPKPVIQRYKGLGEMDAEQLWETTMDPSVRRLLRVEMDDAVDADQVFSMLMGDKVEPRREFIEENAQYAE-LDV 655
136 0.000e+00  ali  52  1MS---KSNDYTADQIQILEGLEAVRKRPGMYIGSTSSKGLHHLVYEIVDNAVDEALAGYCTEIFVQINEDNSITVIDNGRGIPVGINTKSGLTGVEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVKVFQDGKVYEQRYERG-KVMFPLKVVDECPDKTGTEVKFLPDKEIFEETVYDYNILKQRLREMAFLTKNIKITLKDVRDDNHKEKVFHYEGGIKEYVKYLNKGNDALYDNIIYCEGT----------KDDVYVEVAFQHNNGYSDNVYGFVNNITTPEGGTHVTGFRNAVTKTFNDYARTNKILKDKDQNLSGEDIREGLTAIISIKIQDPQFEGQTKQKLGNTEARGAVESVVTEQLTYFLEQNPSVAKVICEKSILAQRAREAARHARDLTRRKTALDGFKLPGKLADCSDKDPSHCEIFIVEGDSAGGSAKSARKRETQAILPLRGKILNVEKARLDRILGNAEIRAMITAFGTGIHEDFDISKLRYDKIIIMTDADVDGAHISTLLLTFFYRFMPDLIKDGHVYLAQPPLFKLEKNKKVWYAYSDEELADILKEVGRDNNKIQRYKGLGEMDASQLWETTMDPEKRILKKVIYDDASEIDVTFSTLMGDKVEPRREFIEENAKFVKNID. 639
137 0.000e+00JGI.Meta 7003317097 SRS024132_Baylor_scaffold_35105__gene_78684 DNA gyrase, B subunit [Human Stool microbiome from visit number 2 of subject  ali  48  1MSEETENKSYSADSIQVLEGLEAVRKRPAMYIGDIGVKGLHHLVYEVVDNSIDEALAGYATHIEVYINEDNSIRVVDNGRGIPVDMHEKEHKSALEVVLTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTYLRAEIRRNGKIYMQEYSCG-KPLHDVEIIGETE-ETGTTIIFRPDDSIFSVTVYDYNILANRLRDLAYLNAGITLSLTDKRTGEYRKEVFYSKEGLKEFVRYIDSNKEHLIDDVIHI----------ATERQGVPVEVAMTYNTTYNENVYSYVNNINTIEGGTHLTGFRRGLTRTLKKYAEDSKMLEKVKVEISSDDFREGLTAVISVKVMEPQFEGQTKTKLGNSEVIGAVDTAVSEALANYLEEHPAQAKTIVEKVIIAATARHAARKAREMVQRKSPLSGGGLPGKLADCSSRNPEDCEIFLVEGDSAGGSAKQGRDRMFQAILPLRGKILNVEKAMDHKVFESQEISNMFKALGVTIGTEEDIEKLRYHKIIIMTDADVDGAHIATLLLTFFFRRMRPLLEQGYVYLATPPLYKCKRGKAEEYCWTDQQKDQFCLKYCEGNMETQRYKGLGEMNPHQLWETTMDPENRILKQVTIDNAAEADRVFSMLMGEDVGPRREFIESNATYA-NID. 650
138 0.000e+00JGI.Meta 7038115177 C3373548__gene_298928 DNA gyrase, B subunit [Human Stool microbiome from visit number 1 of subject 763860675]  ali  51  1MSDEKTNGQYDAAQIQVLEGLEAVRKRPGMYIGSTGARGLHHLVYEIVDNSVDEALAGYCTTIKVTICKDNSITVEDDGRGMPVDKHPKLKIPAVEVIHTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTHMEVEIRRNGKIYKQCYERG-KTVTPLEVIGDS-KKTGSKTSFWPDPEIFETTIFDFDTLEHRLREMAFLNKGIKIIFKDEREGKKRSETYHYEGGIKEFVKFQNQNKDAIHPDVIYFE----------VVRDTCEVEIAMQYTESYNELVLGYANNINTTDGGTHIVGFKSALTRIFNDYGKKAKILKEND-TLSGEDVREGLTAIVSVKLAEPQFEGQTKAKLGNPDMRGFVETTTNENLTAFLEENPAQAKIILEKCIXXXXXXXXXXXXXDLTRRKGALDSFSLPGKLADCSDKDPSQCEIFLVEGDSAGGSAKDGRDRKRQAILPLRGKILNVEKARLDRILNSDEIKNMITAFGCGIGDDFNVEKLRYHKIIIMTDADVDGAHIRTLLLTFFYRYMRPLIEGGFVYAAQPPLYQVKKGKDVYYTYGEDEQTELMKEGKAGKADIQRYKGLGEMDAEQLWDTTMDYEHRTLIQITIEDSAAADQTFSTLMGDKVPPRKKFIEDNAHYAT-LDI 640
139 0.000e+00METAHIT V1 GL0057022 [Complete] locus=scaffold19499_1:166:2073:+  ali  52  1.....VSNNYQAEDITVLEGLEAVRKRPGMYIGTTSERGLHHLVWEIVDNSVDEALAGYCTHIEVSILPDNVIEVVDNGRGIPVDIHPKYGKSALEIVLTVLHAGGKFENDNYKVSGGLHGVGVSVVNALSLWTEVEVRKNGKVWYQKYNRGIP-EEAVKEIGITE-EHGTTVRFKADHEIFETLVYDYNTLKNRLKELAYLNKGLVITLTDSRKEPFKKEIFEFEGGIADFLREITEDTEKLIKEPIYMTG----------EVDNIGVEIAFLYTVNQSEIIYSFVNNINTHEGGTHVQGFRTALTRIINDVGKAQGLLKDKDGKLQGTDIREGVTAIVSVKVPQPQFEGQTKTKLGNSEVTGIVSTVVGGQLKMILEDNPNDTKVIIEKILNSKKAREAAQRARELVLRKSALEVGSLPGKLADCSSKNPEECEIYIVEGDSAGGSAKQGRDRYHQAILPLRGKILNVEKAGLHKALENNEVRAMITAFGTGIGDNFNIEKLRYGKIILMTDADVDGAHIRTLLLTFIYRYMIELIYNGNVFIAQPPLYKISYGKQIKYAYSDRELKEITEEGEDKKYTLQRYKGLGEMNPEQLWETTMDPQNRTLLKVTIDDARAADMLFDKLMGDKVEPRREFIEENAEYVKNLDI 635
140 0.000e+00METAHIT V1 GL0103184 [Lack 5`-end] locus=scaffold58683_3:2:1978:+  ali  48  8MSEETENKSYSADSIQVLEGLEAVRKRPAMYIGDIGVKGLHHLVYEVVDNSIDEALAGYATHIEVYINEDNSIRVVDNGRGIPVDMHEKEHKSALEVVLTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTYLRAEIRRNGKIYMQEYSCG-KPLHDVEIIGETE-ETGTTIIFRPDDSIFTVTVYDYNILANRLRDLAYLNAGITLSLTDKRTGEYRKEVFYSKEGLKEFVRYIDSNKEHLIDDVIHI----------ATERQGVPVEVAMTYNTTYNENVYSYVNNINTIEGGTHLTGFRRGLTRTLKKYAEDSKMLEKVKVEISSDDFREGLTAVISVKVMEPQFEGQTKTKLGNSEVIGAVDTAVSEALANYLEEHPAQAKAIVEKVIIAATARHAARKAREMVQRKSPLSGGGLPGKLADCSSRNPEDCEIFLVEGDSAGGSAKQGRDRMFQAILPLRGKILNVEKAMDHKVFESQEISNMFKALGVTIGTEEDIEKLRYHKIIIMTDADVDGAHIATLLLTFFFRRMRPLLEQGYVYLATPPLYKCKRGKAEEYCWTDQQKDQFCLKYCEGNMETQRYKGLGEMNPHQLWETTMDPENRILKQVTIDNAAEADRVFSMLMGEDVGPRREFIESNATYA-NID. 657
141 0.000e+00  ali  48  8MSEETENKSYSADSIQVLEGLEAVRKRPAMYIGDIGVKGLHHLVYEVVDNSIDEALAGYATHIEVYINEDNSIRVVDNGRGIPVDMHEKEHKSALEVVLTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTYLRAEIRRNGKIYMQEYSCG-KPLHDVEIIGETE-ETGTTIIFRPDDSIFTVTVYDYNILANRLRDLAYLNAGITLSLTDKRTGEYRKEVFYSKEGLKEFVRYIDSNKEHLIDDVIHI----------ATERQGVPVEVAMTYNTTYNENVYSYVNNINTIEGGTHLTGFRRGLTRTLKKYAEDSKMLEKVKVEISSDDFREGLTAVISVKVMEPQFEGQTKTKLGNSEVIGAVDTAVSEALANYLEEHPAQAKAIVEKVIIAATARHAARKAREMVQRKSPLSGGGLPGKLADCSSRNPEDCEIFLVEGDSAGGSAKQGRDRMFQAILPLRGKILNVEKAMDHKVFESQEISNMFKALGVTIGTEEDIEKLRYHKIIIMTDADVDGAHIATLLLTFFFRRMRPLLEQGYVYLATPPLYKCKRGKAEEYCWTDQQKDQFCLKYCEGNMETQRYKGLGEMNPHQLWETTMDPENRILKQVTIDNAAEADRVFSMLMGEDVGPRREFIESNATYA-NID. 657
142 0.000e+00gi|501198962|ref|WP_012241980.1| DNA gyrase subunit B [Acholeplasma laidlawii]  clstr ali  54  3...NNNNSHYTADNIQILEGLEAVKKRPGMYIGSTGERGLHHLVWEIVDNSIDEALGGYADEITIEILKGEVIRVTDNGRGIPVDIHPKTKRPAVETILTTLHAGGKFDKGSYKVSGGLHGVGASVVNGLSEWFVVEIHKDGTIYEQKYERGIPA-YDLKVKGSTDKS-GTIISFQADPLIFETVIYNYETLRTRIQQLAFLNKGLKLNLIDDRFEENKSESFHYEGGITEYVKFLNQSKSKIHNDIIYIDK----------EQDGITVELAMQFVDSYSPNLHSFTNNISTTEGGMHEDGFKMALTRVISKYADDLKM--KKDDSISGEDTREGLTAIISVKHPEPQFEGQTKTKLGNPEVRAITSQITSEAIERFLMENPAQAKAIVEKVLLATRARVAARKAKDLTRRKSPLDALGFASKLADCRSKDPEKSEIYIVEGDSAGGSAKQGRDSEFQAIMPLRGKVLNVEKARLDKMLSNKEIVNLIQAMGTGISDEFDITKARYHKIVIMTDADVDGAHIRTLLLTFLFRHMRPLIDAGYVYAAQPPLYKISWGRNFQYAYNEQELNELLKTI-ETKPSIQRYKGLGEMDAEQLWDTTMDPAKRTLLQIKLEDAIEADQVFSMLMGEEVEPRKEFIQNNAQYATDID. 634
143 0.000e+00JGI.Meta 7030274229 SRS024081_LANL_scaffold_12712__gene_18252 DNA gyrase, B subunit [Human Tongue dorsum microbiome from visit number 2 of s  ali  57  24..DMKVTHTYNDSDIQVLDGLEAVRKRPGMYIASTSSKGLHHLVWEIVDNGIDEAMAGYASTVTVTVDKDNIITVEDDGRGMPTGIHEKTGKSTIETIFTVLHAGGKFGGGAYKVSGGLHGVGASVVNALSSWLEVTVFHDGKEYYIRFENGGHPVGTLVEKGTCSDKHGSTVRFKANPTIFETVEYEHDILRDRLRQLAFLNKSICLKFNDLREEDERHYVFKFDGGLKQYTEFLNRNRDVVNHEIIYSEGY----------ENNIQVEVACQYNDGYNPNIYTFCNNINTAEGGTHEEGFRLALNRVINKYAREIGFLKDKDDNLTTDDCREGLTAVISVKHPDPQYEGQTKTKLGNSEVRKIVSDIFGTQLERYLMENPDEAKAILEKVALASQARMAAKKARELTRRKSALEVSPLPGKLADCSSKDASICEIYIVEGQSAGGSAKQGRDSHFQAILPLRGKILNVEKARQSRIYENAEIRSMITAFGCGVSDEIDLEKLRYHKIVIMTDADVDGAHIRTLLLTFFYRYLRPLLEQGYIYIAQPPLYKVQKGQTVRYAYTDTQLEDVKRELG-DRLSIQRYKGLGEMNPEQLWETTMDPKNRTLIRVAVGDAEAADYNFTMLMGEEVEPRKNFIVENAHFAENLDI 664
144 0.000e+00JGI.Meta 7010947879 SRS042628_WUGC_scaffold_36692__gene_83661 DNA gyrase, B subunit [Human Stool microbiome from visit number 2 of subject 7  ali  52  1.............................MYIGSTSIRGLHHLVYEIVDNSIDEALAGYCTHIEVTINKDNSVTVSDNGRGIPVGIQEKTGKPAVEVVFTILHAGGKFGGDGYKVSGGLHGVGASVVNALSTYLEVTVYDGQHIHHQRYERGN-ATGPLEVIGDTEK-TGTTVTFMADPEIFEDIHYEYDTLLARLREQAFLNKGIRITFTDLREEEPVVNTMKYDGGIIEYVKYINHSKTPLHPDVIYVE----------YEKDSTYVEIAMQYTDSYTENIISFANNIHTTEGGMHETGFKAALTRTLNDYAKKSGILKENDKALSGDDTREGISAIISVKVIEAQFEGQTKTKLGNSEVRGVVETMISEKFGDFLQENPQVARIIIDKAMTASRAREAARKARELTRRKSALESSTLPGKLADCSSKDTTMTEIYIVEGDSAGGSAKQGRNREYQAILPLWGKMLNVEKARIDRVIGNDKLMPVITALGAGIGDDFNLDKLRYGKIIIMADADVDGSHIRTLLLTFFFRYMRPLVEKGHVYIAQPPLFKVTKNKKEYYAYTDADLQRILEEVGKDNVPIQRYKGLGEMNPEQLWETTMNPETRIILKVELEDAVEADRIFTILMGEEVEPRREFIVTNAKYVKNLDV 610
145 0.000e+00JGI.Meta 7014600723 SRS045715_LANL_scaffold_63874__gene_89272 DNA gyrase, B subunit [Human Tongue dorsum microbiome from visit number 2 of s  ali  52  17..EEKYNHEYGANQIQVLEGLEAVRKRPGMYIGSVSARGLHHLVYEIVDNSVDESLAGYCTKIQVKIEPGNVISVEDNGRGIPVDIHAKTHISAAETVYTVLHAGGKFGGDGYKVSGGLHGVGASVVNALSEWTEVTIQRDGGIYQMKFERG-KTVEPLRRIGDSDK-TGTKVRFLADSQIFETTEYTYEVLQNRLREMAFLTKGLYISLEDLRGEEPKKEEFCFEGGLRSFVEFLNKNKEKIDIDPIYIEKKDI----------DVPVEIAMQYTTSYNESVQSFVNNINTIEGGTHLEGFRRGLTKVFNDYARSHNILKDKDTNLQGEDIREGLTAVISVRVKDPQFEGQTKTKLGNSNVTGIVQSVVVESLSAFLEENPTISKTIIEKCISXXXXXXXXXXXXDLARKKNSLDVTTLPGKLADCSSKNPEETEVYIVEGDSAGGSAKQGRNRRNQAILALWGKMLNVEKSRPDKIYNNEKLKPVIQAIGAGIGDNFDINKIRYGKVIIMADADVDGAHIRTLLLTFFFRYMRPLIEQGHVFLAQPPLYKIKKGIKDIYCYSDEQLDNELMIVGRENTSIQRYKGLGEMDPVQLWETTMDPENRILIKVTMEDAEKADEIFKILMGDEIPPRRKFIEDNAKYVKNLD. 653
146 0.000e+00gi|497700160|ref|WP_010014344.1| DNA gyrase subunit B [Lactobacillus coryniformis]  clstr ali  53  2......AKSYDASQIQVLEGLEAVRKRPGMYIGTTTSQGLHHLVWEIVDNGIDEALAGFADEINVTVEKDNSIRVTDNGRGIPVDIQQKTGRPAVETIFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSSKLTVEVIKEGHRYYMDFKRG-KVATQLKEIGTPEHEHGTIVRFWPDPDIFETTVYDIKILTTRIRELAFLNKGLRITIEDLRGEEPSKQEFHYEGGIKSYVEFLDNGKQDLFPEPIYVEGVEK----------GITVEVALQYTEDYHTNLMTFTNNIHTYEGGTHEAGFKTALTRVINDYAHKNGLMKENEGNLSGEDVREGMTAVVSIKHPDPQFEGQTKTKLGNSDARTVTDHTFAETFSRYLMENPKIAKQVVDKGLLASKARLAAKRAREVTRKKSGLEISNLPGKLADNSSKDPEISELFIVEGDSAGGSAKQGRSRLTQAILPIRGKILNVEKASIDRILANEEIRTLFTAMGTGFGDEFDLAKARYHKLIIMTDADVDGAHIRTLLLTLFYRFMRPVVEAGYVYIAQPPLYQVRQGKMQRYIDSDEELEQILGTLPSPKPVIQRYKGLGEMDASQLWETTMDPDYRRLLRVDVTDAKEADEVFSMLMGDKVDPRRKFIEENAHYVENLDV 637
147 0.000e+00gi|503928481|ref|WP_014162475.1| DNA gyrase subunit B [Thermovirga lienii]  clstr ali  48  2...TASAKQYTAQDIQILEGLEAVRRRPGMYIGDTTTRGLHHLVYEVVDNSVDEALAGWCNRIEVIIHEDGHVSVEDNGRGIPIDPHPITGKPAAEVVLTTLHAGGKFDKKAYQVSGGLHGVGVSVVNALSEWLNLTVWRDGREWRQSYRRGKPVSEL--CCGESTNKRGTLIEFKPDGEIFEETTFSWDILSSRFREMAFLNPGLTIILKDRISG--KEKTFHYEGGISSFVEYLNKGKNPLFTPPVVVKG----------EKDGVSVEIGLQYNDSYLERVFAFANLIHTVEGGTHVSGFRTALTRAINEMARRNKLLKDKDPNLSGDDLKEGLTAVISVKLPEPQFEGQTKTKLGNGEIKGIVDSIFYDGLMVEIDERPEILKPVVEKAIKARLAREAAKKARELVRRKTALAGLDLPGKLADCSSRNPEESELFIVEGDSAGGSAKQGRDRHFQAILPLRGKILNVEKARMDKVLDNNEVRTIIQALGTGIGEDFDISKLRYHRIFLMTDADVDGSHIRTLLLTLFYRFMPELIERGHLYIAQPPLYRVQIGKEIHYCFSDKELNNLRQKVGGKKLNIQRYKGLGEMNPSQLWETTMDPATRVCKRIEIEDAVAADEYFSILMGDKVEPRREFIEAHAREVRNLDI 635
148 0.000e+00gi|490761136|ref|WP_004623410.1| DNA gyrase, B subunit [Clostridium termitidis]  clstr ali  50  1MSDINNVNSYDESQIQVLEGLEAVRKRPGMYIGSTSLRGLHHLVYEIVANSVDEALAGRCDEIRVIVHKDNSVTVIDNGTGIPVGAHPKMGISTLEVVHTILHAGGKFGTGAYSVSGGLHGVGASVVNALSESMEVEVKREGHIYRQKYSRGAPVT-PVEIIGETED-HGTKSTFKPDTQIFEDICFDFESMITRYREMAFLNRGIKINLIDERPEEPIIKNLHYEGGIISFVEYLNKTKDTIHDKVIFVEGS----------KDANIVEVAMQYNDGYNENVFSYANNIATTEGGTHLTGFRTAITKVFNDYARKYNFIKESDKNLSGEDVREGLTAVISIKLPEPQFEGQTKTKLGNSEIRTLVENVLTEELSSFLEENPSVGKIILEKCLTXXXXXXXXXXXXXLTRRKSALDTSTLPGKLADCSEKDPSVTEIFIVEGDSAGGSAKQGRDRRIQAILPLWGKMLNVEKSRIDRVFDNEKLSPVIIALGAGIGDEFDTSKLRYDKVIIMADADVDGSHIRMLLLTFFFRYMRPLVEKGHVYIAMPPLFKVYKGKEEYYAYDDRQVEKIYREKGDQNVNIQRYKGLGEMNPDQLWETTMNPETRSIMKVELDDAITADEVFSTFMGDKVEPRKEYIHLHAKDVTNLD. 641
149 0.000e+00gi|648602046|ref|WP_026293797.1| DNA gyrase subunit B [Saccharibacillus kuerlensis]  clstr ali  53  1MSMDQ--QSYDASQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEVVDNSIDEALAGYCDHIQVIMHENNSITVIDNGRGIPVGEHPKLKRPALEVVMTVLHAGGKFGGGGYKVSGGLHGVGVSVVNALSEKVVVQVKRDGKIYEQEYRYGAP-QYDLRVIXXXXXXXXXXXXFQPDPQIFETTVFNYTTLLTRIRELAFLNKGIMISLLDERTNE--SASFHYEGGISEYVEFLNQNKGVIQEHPIYVEGS----------RDMIAVEIAIQYNDSYTENIYSFANNIHTHEGGTHESGFKSALTRIINDYARKAGVIKDTTGNLTGDDVREGLTAIISVKIPEPQFEGQTKTKLGNSEVRGIVESLFSEKLMDFMNENPAAARRILDKALQASRAREAARKARELTRRKGVLEVSALPGKLADCSSKDASISEVYIVEGDSAGGSAKQGRDRHFQAILPIRGKILNVEKARLDRILSNAEIRAMITAIGTGIGEDFDISKARYHKVVIMTDADVDGAHIRTLLLTFFYRYMRQIIDAGYVYIAQPPLFKIERNKTVVYANSEAERDEIIAGFGGAKVNVQRYKGLGEMNATQLWETTMDPESRTMMQVSIGDAMLADTLFDTLMGDNVEPRRDFIQEHARYVKNLDI 638
150 0.000e+00gi|496508469|ref|WP_009216752.1| DNA-cytosine methyltransferase [Bacteroidetes oral taxon 274]  clstr ali  49  1MSDETTNKEYGASSIQVLEGLEAVRKRPAMYIGDVGEKGLHHLVYEVVDNSIDEALAGYCKNISVTINKDNSVTVKDDGRGIPVDIHEKEKKSALEVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSDYLKAEVCRNGKRYVQEYSRGVP-LGEVKEVG-TSSETGTTITFHPDKDIFIDIHYKYSILVKRMRELAFLNAGIRLTITDLRSEEEKTEEFYSEQGLREFVKYIDSTREPLINDVIYID----------TDKYGTPVEVAMMYNTSYTENLHSYVNNINTIEGGTHVTGFRTALTRTLKKYADDNKLLEKTKVEISSDDFREGITAVISVKVAEPQFEGQTKTKLGNDEVKGMVDRAVGEALNVFLEEHPKEAKTIVEKIILAATARNAARKARELVQRKSPLSGGGLPGKLADCSSRDASLCEIFLVEGDSAGGSAKQGRDRNFQAILPLRGKILNVEKAMRHKAFESEEVRNIYTALGVTIGTELNIEKLRYHKVVIMTDADVDGSHIATLILTFFFRYMKELIEQGHVYIATPPLYLCKKGKVQEYCWTEEQRLRFIQQYGDGKITQQRYKGLGEMNPEQLWETTMNPENRTLRQITIENAAEADYVFSMLMGDDVAPRRQFIEENATYA-NID. 652
151 0.000e+00gi|514418799|ref|WP_016566394.1| dNA gyrase subunit B [Clostridium sp. CAG:226]  clstr ali  50  1MSNHT---DYDASQIQVLEGLEAVKRRPGMYIGSTDFHGLHHLVKELVDNAIDEAMGGYCNHIEVTVHGDNSVTVTDNGRGIPVDMHEKMHKSALEVALTVLHAGGKFGGSGYKVSGGLHGVGLSVVNALSTWLIAEVKRDGKLYYQEYSYGEP-KAPVKAIKDPEGESGTSITFLANDKIFDEVNYNFEILADRMRELAFLNAGVRITVSDERAESPDVRSFCYEGGIVNFVKHLNRKKTVLHEEPVYITASRNEP-----EKQEVTVEVALQYNDDYNENVFTFANNINTGEGGSHLVGFRSALTRVLNDYARKYKILKDNDDALKGEDIREGLSAIVSVKLVEPQFEGQTKTKLGNAYIRGLVDSAVSEGMSVYLEEHPTEARAIVDKCLTXXXXXXXXXXXXELTRRKTALDSTSLPGKLTDCTEKDPEKCEIFIVEGDSAGGSAKMGRDPAHQAILPLRGKILNVEKTRMDKILANNEIRAMITAFGAGIDEEFDTSKLRYHKIVCMTDADVDGSHIRILMLTFFFRHMRPLIEQGYVYVAQPPLYRITKGKNIYYAYDDEELNSILERIGRDKPLINRYKGLGEMNPEQLWETTMDPERRVMLQVHLEDAMKADEIFSVLMGDKVEPRREFIENNSKLVVDLDV 644
152 0.000e+00gi|551005263|ref|WP_022749939.1| DNA gyrase subunit B [Lachnobacterium bovis]  clstr ali  53  1MSEENKNQEYGADQIQILEGLEAVRKRPGMYIGSTSERGLHHLVYEIVDNAVDEALAGYCNSIQVVVEEDNSITVIDNGRGIPVGTNHKANKSALEVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSNSLEVEVAREGKIYRQTYTRGVP-NGSVEIVGECDDKHGTKVHFLPDDTIFEVTEFKYDILKQRLRETAFLTKGLKITLIDTRENSKHNHVFHYAGGIKEFVEYLNRGKEALYDEVIYCEG----------KRNNVYVEVAMQHNESYNDSAYSFVNNIITPEGGTHLTGFRNAITKTFNNYAKATKMIKDNDQPLNGEDIREGLTAIISVKIEEPQFEGQTKQKLGNSEARGAVDSIVSEQLTYFLEQNPDVAKQIISKSILAQXXXXXXXXXXXXTRRKSALENTSLPGKLADCSDKDPKNCEIFIVEGDSAGGSAKVARSRATQAILPLRGKILNVEKARPDKIFNNEEIRSMITAFGTGILDDFDLSKLRYDKIIIMTDADVDGAHIETLMLTFLYRFMPELIKEGHVYLATPPLYKIEKNKKVWYAYSDEELNKIISEIGRDNNKIQRYKGLGEMDAEQLWETTMDPANRILKRVTMDDASEVDVTFTTLMGDKVEPRREFIETNAKYVQNLDI 644
153 0.000e+00METAHIT MH0066 GL0004067 [Complete] locus=scaffold32554_1:34:1983:+  ali  51  13.EEERGAKNYGAKDIRVLEGLEAVRLRPGMYIGSTSARGLHHLVYEVVDNSIDEALAGYCTHIEVTINEDGSCTVNDNGRGIPTDMHE-TGKPAMEVVLTVLHAGGKFGGDGYPISGGLHGVGISVVNALTAWTKVRVKRNGQIYEMAFSRGEK-TEDMTIVGKA-KDTGTSVTFQPDPEIFEGTDFSFETLKERMRELAFLNKGLTITLTDKRAGREQEVQFNYAGGITEYVQYLNEGKDLVNQKVISFEG----------EKDRVIVDIAMQYQDGYTENMYTFVNDINTVEGGMHLAGFRSALTRVINDYARKNNFLKQSEDNLSGDDVREGLTCVISVKVPNPQFEGQTKTKLGNSEVRGIVDGIVSEGLQEFFAENPVDAKAIIEKSLLARRAREXXXXXXXXXXXXDALEISSLPGKLADCTERDPKLTEIYIVEGDSAGGSAKSGRDRRYQAILPLRGKILNVEKARIDRVLSSETIGTMIMAFGTGIGEDFNMDKLRYDKIIIMTDADVDGAHIRTLLLTFFYRYMPRLITEGHVYIAQPPLYQVKKGRSKYYTYDDDEQNALLAKIGLEGCTIQRYKGLGEMNPEQLWDTTMNPEQRIMLQVQLNDAVEADRLFTILMGDKVEPRRKFIEENAKNVTNLD. 648
154 0.000e+00METAHIT V1 GL0066908 [Complete] locus=scaffold7225_4:17279:19213:-  ali  50  1MSNHT---DYDASQIQVLEGLEAVKRRPGMYIGSTDFHGLHHLVKELVDNAIDEAMGGYCNHIEVTVHGDNSVTVTDNGRGIPVDMHEKMHKSALEVALTVLHAGGKFGGSGYKVSGGLHGVGLSVVNALSTWLIAEVKRDGKLYYQEYSYGEP-KAPVKAIKDPEGESGTSITFLANDKIFDEVNYNFEILADRMRELAFLNAGVRITVSDERAESPDVRSFCYEGGIVNFVKHLNRKKTVLHEEPVYITASRNEP-----EKQEVTVEVALQYNDDYNENVFTFANNINTGEGGSHLVGFRSALTRVLNDYARKYKILKDNDDALKGEDIREGLSAIVSVKLVEPQFEGQTKTKLGNAYIRGLVDSAVSEGMSVYLEEHPTEARAIVDKCLTXXXXXXXXXXXXELTRRKTALDSTSLPGKLTDCTEKDPEKCEIFIVEGDSAGGSAKMGRDPAHQAILPLRGKILNVEKTRMDKILANNEIRAMITAFGAGIDEEFDTSKLRYHKIVCMTDADVDGSHIRILMLTFFFRHMRPLIEQGYVYVAQPPLYRITKGKNIYYAYDDEELNSILERIGRDKPLINRYKGLGEMNPEQLWETTMDPERRVMLQVHLEDAMKADEIFSVLMGDKVEPRREFIENNSKLVVDLDV 644
155 0.000e+00  ali  51  13.EEERGAKNYGAKDIRVLEGLEAVRLRPGMYIGSTSARGLHHLVYEVVDNSIDEALAGYCTHIEVTINEDGSCTVNDNGRGIPTDMHE-TGKPAMEVVLTVLHAGGKFGGDGYPISGGLHGVGISVVNALTAWTKVRVKRNGQIYEMAFSRGEK-TEDMTIVGKA-KDTGTSVTFQPDPEIFEGTDFSFETLKERMRELAFLNKGLTITLTDKRAGREQEVQFNYAGGITEYVQYLNEGKDLVNQKVISFEG----------EKDRVIVDIAMQYQDGYTENMYTFVNDINTVEGGMHLAGFRSALTRVINDYARKNNFLKQSEDNLSGDDVREGLTCVISVKVPNPQFEGQTKTKLGNSEVRGIVDGIVSEGLQEFFAENPVDAKAIIEKSLLARRAREXXXXXXXXXXXXDALEISSLPGKLADCTERDPKLTEIYIVEGDSAGGSAKSGRDRRYQAILPLRGKILNVEKARIDRVLSSETIGTMIMAFGTGIGEDFNMDKLRYDKIIIMTDADVDGAHIRTLLLTFFYRYMPRLITEGHVYIAQPPLYQVKKGRSKYYTYDDDEQNALLAKIGLEGCTIQRYKGLGEMNPEQLWDTTMNPEQRIMLQVQLNDAVEADRLFTILMGDKVEPRRKFIEENAKNVTNLD. 648
156 0.000e+00gi|504781960|ref|WP_014969062.1| DNA gyrase subunit B [Exiguobacterium antarcticum]  clstr ali  53  5.EDMEVEQGYGADQIQVLEGLEAVRKRPGMYIGSTASKGLHHLVWEIVDNSIDEALAGYCDTIKVTIESGNSILVEDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTKLEVFVKRNEKLYYQAYHRGVPA-EDLAVIG-TSEETGTMIRFFPDDEIFETLEYDYDLLATRLRELAFLNKGLTIQITDDRSDEPITRSFHYEGGIKSYVEHLNRSKEVVHEEPVYVHGN----------RDGIEVEVALQYNDGFAANIYSFTNNIPTHEGGTHETGFKTALTRVVNDYAKKFGLMKDADGTLSGEDVREGMIAIVSIKHPNPQFEGQTKTKLGNSDARTATDTLFSSAFEQFMMENPTSARAIVEKGMMASRARMAAKRARELTRRKGVLEVSSLPGKLADCSSRDATISEIYIVEGDSAGGSAKSGRDRHFQAILPIRGKILNVEKARLDKILGSNEIRTIITALGTSIGSEFNIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRPLVEHGYVYIAQPPLYGIKQGKNITYVHNERELNEALAALPNARYDIQRYKGLGEMDPEQLWETTMDPSGRQMLRVELQDAIEADEVFDILMGDQVEPRRDFIQSHAHYVKNLDI 643
157 0.000e+00gi|499664824|ref|WP_011345558.1| DNA gyrase subunit B [Carboxydothermus hydrogenoformans]  clstr ali  53  1MELEKNGIKYGAEEIQVLKGLEGVRKRPAMYIGSTNEKGLHHLVYEVVDNSIDEALAGFCNRIEVIIHKDGSITVADNGRGIPVDIHPEVGKPAVEVVLTMLHAGGKFGGGGYKVSGGLHGVGVSVVNALSEWLEVRIKRDGNLYYQKFSRGEPIT-ELKIIGKS-KSTGTIITFKPDAEIFETVEFNYDTLAKRLLELSYLNKNVKIILKDERIN--KEEIFEHSGGIKDYLKYLNKNKEPLH-KIIYFEK----------EKDEVVVEVALQYCNSFSENILSFTNNINTTEGGTHEIGFKTALTRVINDYAKKYNLIKENNLSLQGEDIREGLTAIISVKVPDPQFEGQTKTKLVNTEVRSIVDSIVSDYLSTYLEENPAVGKKLIENXXXXXXXXXXXXXXXELARRKTALESNTLPGKLADCSEKDPSLCELYLVEGDSAGGSAKQGRDRRFQAILPLRGKILNVEKSRLDKILANEEIRAMITALGTGVDKDFDIEKARYHRLIIMTDADVDGAHIRTLLLTFFYRYLRPLIENGYVYIAQPPLYKVKKGKLEKYLYSDDELERYLNEIGREGVTIQRYKGLGEMDPEQLWETTMNPETRTILKVTLEDAAKADEIFTILMGDKVEPRREFIEKNAKLVRNLDI 635
158 0.000e+00  ali  50  1MSNHT---DYDASQIQVLEGLEAVKRRPGMYIGSTDFHGLHHLVKELVDNAIDEAMGGYCNHIEVTVHGDNSVTVTDNGRGIPVDMHEKMHKSALEVALTVLHAGGKFGGSGYKVSGGLHGVGLSVVNALSTWLIAEVKRDGKLYYQEYSYGEP-KAPVKAIKDPEGESGTSITFLANDKIFDEVNYNFDILADRMRELAFLNAGVRITVSDERAESPDVRSFCYEGGIVNFVKHLNRKKTVLHEEPVYITASRNEP-----EKQEVTVEVALQYNDDYNENVFTFANNINTGEGGSHLVGFRSALTRVLNDYARKYKILKDNDDALKGEDIREGLSAIVSVKLVEPQFEGQTKTKLGNAYIRGLVDSAVSEGMSVYLEEHPTEARAIVDKCLTXXXXXXXXXXXXELTRRKTALDSTSLPGKLTDCTEKDPEKCEIFIVEGDSAGGSAKMGRDPAHQAILPLRGKILNVEKTRMDKILANNEIRAMITAFGAGIDEEFDTSKLRYHKIVCMTDADVDGSHIRILMLTFFFRHMRPLIEQGYVYVAQPPLYRITKGKNIYYAYDDEELNSILERIGRDKPLINRYKGLGEMNPEQLWETTMDPERRVMLQVHLEDAMKADEIFSVLMGDKVEPRREFIENNSKLVVDLDV 644
159 0.000e+00gi|548187125|ref|WP_022408081.1| dNA gyrase subunit B [Clostridium sp. CAG:354]  clstr ali  52  2...EKYKHEYGAEQIQVLEGLEAVRKRPGMYIGSVSARGLHHLVYEIVDNCVDEALAGYCKNIHVQIKPGNIVTVQDDGRGIPVEIHPKTKISTAETVYTMLHAGGKFGGDGYKVSGGLHGVGASVVNALSEWTEVEICRDGGKYRMKFARG-KTVEPLKKIEDSDK-TGTTVTFLADSTIFETTNYDFSVLEERFREIAFLTKGLRIKVEDLREEPVKKADFCFEGGLNSFVEYLNQNKEKLHKKPIYIEKT----------EGEVPVEIAIQYTTAYSENIYTFVNNINTVEGGTHLEGFKRALTKVFNDYARKHNILKEKDSNLQGEDIREGITAVISVKVKEPQFEGQTKTKLGNSNVTGIVQSMVNEALSDFLEENPTVAKAILEKCIGASRAREAARKARELVRRKSALETSTLPGKLADCSEKNADLCEVYIVEGDSAGGSAKQGRDRKFQAILPLWGKMLNVEKSRADKIYNNDKLQPVILAVGAGIGADFDITKIRYGKVIIMADADVDGAHIRTLLLTFFFRYMRPLIENGNVYLAQPPLFKLKKGMKDIYCYTDXXXXXXXXXISRDSISIQRYKGLGEMNPEQLWDTTMNPETRILIKVTMDDAIKADQIFTVLMGDEVAPRRKFIEENAKYVKNLDV 643
160 0.000e+00gi|499410949|ref|WP_011098416.1| DNA gyrase subunit B [Clostridium tetani]  clstr ali  54  2..EQDKKQKYDESQIQVLEGLEAVRKRPGMYIGSTGARGLHHLVYEIVDNSIDEALAGYCDKIDIYINEDNSITIEDNGRGMPVGLHPKMNKPTVEVIMTILHAGGKFGGGGYKVSGGLHGVGASVVNALSSECRVEVKRDGYVWRQVYEKGIAVTG-LEKIGETS-QHGTKTYFKPDPTIFDELEFEYDVLVQRLREMAFLNKGINITIEDKRVD--KKEDFHYEGGIKSFVLYLNRTKEVLHKEPIYIEGM----------KDEHMVEISIQYNDGYAENIFSFANNISTIEGGTHLAGFKSAVTRAFNDYARRYGFLKENDKNLAGEDIREGITAIISVKLIDPQFEGQTKTKLGNSEVRGIVDTIVGEGVGNFLEENPQIAKSIIDKTLMXXXXXXXXXXXXDLTRRKSVLESTSLPGKLADCSSKDPKECEIYIVEGDSAGGSAKQGRNRRFQAILPLRGKIMNVEKQRLDKILNSDTIKSMITAFGAGIGKDFDVEKIRYNRIIIMTDADVDGAHIRTLLLTFFYRYMKELVENGHVYIAQPPLYKVSKDRKEHYVYTDRELEEILDEIGGNKTQIQRYKGLGEMNAEQLWDTTMNPDKRILLRATIEDAMAADEIFTILMGDKVDLRREFIQENAKTVVNLDV 637
161 0.000e+00  ali  53  1MTEEERAKEYDASQIQVLEGLEAVRKRPGMYIGSTSSEGLHHLVWEIVDNSIDEVLAGFATKIHVIIEKDNSITVIDDGRGIPVDIQAKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVKVYKEGNVYYQEYRRGA-VVDDLKIIEQTD-RHGTTVHFTPDPEIFETTEFDFSKLATRIRELAFLNRGMRISIEDKREEEPVINEYHYDGGIKSYVEYLNANKTVIFPEPVYLEG----------EQQDIAVEVSMQYTDGYHSNIMSFANNIHTYEGGTHESGFKTALTRVINDYARKQKLMKENDDNLTGEDVREGLTAVISIKHPDPQFEGQTKTKLGNSEVRTVTDRLFSEHFMKFLLENPSVGRQIVEKGLLASRARLAAKRAREVTRRKGALEISNLPGKLADCSSNDPEKCELFIVEGDSAGGSAKQGRNREFQAILPIRGKILNVEKASMDKILANEEIRSLFTAMGTGFGEDFDVSKARYHKLVIMTDADVDGAHIRTLLLTLFYRYMRPIVEAGYVYIAQPPLYGVKQGKNITYVQAEEELKQVVASLPAPKPSVQRYKGLGEMDDHQLWETTMDPSNRMMARVSVDDAIAADQIFEMLMGDRVEPRRAFIEENAHYVKNLDI 648
162 0.000e+00gi|577775818|gb|EUJ36632.1| DNA gyrase subunit B [Brochothrix thermosphacta DSM 20171 = FSL F6-1036]  clstr ali  54  10...DNNGGDYDASQIQVLEGLEAVRKRPGMYIGSTSARGLHHLVWEIVDNAIDEALAGYCDEIHITIEPDNSITVVDNGRGIPVGIQEKTGRPAVEVIFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTKLEVTVSRDGQLYYQSFERG-KVMEDMSIIGETEGR-GTKVHFYPDDEIFETTDFDFDTLAVRTRELAFLNKGLTLIIEDKREEKPAKKKYYYEGGIKSYVEFLNGKKELLHEEPIYTEG----------EKDGITVEVAMQYNGGFASNIMSYANNIHTYEGGTHESGFKIALTRVVNDYSRKQKLLKEAEPNLTGDDIREGLTAIISIKHPDPQFEGQTKTKLGNSETRNITDRLFSAAFEKFLMENPDVGRKIVEKGIIASRARIAAKRAREVARKKSGLEISSLPGKLADCSSRKPDLSELFIVEGDSAGGSAKQGRDRMFQAILPIRGKILNVEKASLDRILANEEIRTIFTAMGTGFGGEFDVAKSRYHKLVIMTDADVDGAHIRTLLLTLFYRYMRPLIEAGYVYIAQPPLYKIAYGRKEHYVYSDKELETFLATLPNTKYGLQRYKGLGEMNAEQLWETTMDPEHRVLLQVKLADAIEADETFEMLMGDRVDPRRQFIEENAEYVDNLDI 646
163 0.000e+00gi|502248008|ref|WP_012740940.1| MULTISPECIES: DNA gyrase subunit B [Eubacterium]  clstr ali  52  1MSKEQNNQEYGADQIQILEGLEAVRKRPGMYIGSTSSRGLHHLVYEIVDNAVDEALAGYCKNIEVTIEEDNSITVQDDGRGIPVGTNHKAKKSALEVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTWLTVEVYKDGNIYRQSYKRG-KTDDTVKIVGQCDESHGTKVHFLPDPEIFEETVYDYDTLKQRLRETAFLTKGLKITLKDVRENSHHNHVFHYEGGIKEFVEYLNRGKEALYDEVIYCEGT----------QNGVYVEVALQHNDSFNDSTFSFVNNVITPEGGTHLAGFRNALTKTFNAYAREKKILKDSDPALTGDDIREGLTAIISIKIEEPQFEGQTKQKLGNSEARGAVDAVVSEKLTYFLEQNPDVAKNICEKSLLAQRAREAARKARDLTRRKTSLDGGTLPGKLADCSDKDPKNCEIFIVEGDSAGGSAKTARSRATQAILPLRGKILNVEKARLDRIYDNAEIRAMITAFGTGIHEDFDITKLRYDKIIIMTDADVDGAHIATLMLTFLYRFMPDLIKEGHVYLATPPLYKVEKNKGVWYAYDDDELKQILNDIGRDNNNIQRYKGLGEMDADQLWETTMDPDHRILKQVMIENSSELDVTFTTLMGDKVEPRKEFIEANAKYVTNLDI 645
164 0.000e+00gi|496025521|ref|WP_008750028.1| DNA gyrase subunit B [Lachnoanaerobaculum saburreum]  clstr ali  51  11..ECSMNTEYGASQIQILEGLEAVRVRPGMYIGSISSRGLHHLVYEIVDNSVDEALAGFCTEIEVSINEDNSITVKDNGRGIPVDIQKKAGIPALEVVFTILHAGGKFGGGGYKTSGGLHGVGASVVNALSTWLDVKVYRDGKVYHMRFEKG-KVVEKIEVIGECDQKTGTEVSFLPDAGIFEETVYDFDILKIRLRETAFLTKALKITLIDNREEK-RKMSFHYEGGIKEFVTYLNKGKVPIYEDVIYCEGT----------KEKVMVEVAMQHNDNYSESIYTFVNNINTPEGGTHLSGFKNALTKTFNEYARSNKLLKDSDENLSGEDIREGLVAIISVKIEDPQFEGQTKQKLGNSEAQTAVNSIVSEQLTYFLEQNPTVAKIISEKAITXXXXXXXXXXXXDLTRRKSALDNMSLPGKLADCSSKNPKECEIFIVEGDSAGGSAKGARRRDTQAILPLRGKILNVEKARLDKIYSNAEIKGMITAFGTGIHDDFDITKLRYNKIIIMTDADVDGAHIDTLMLTFIYRFMPELIKEGHVYLAQPPLYKLEKNKKVWYAYSDEELNNILKEVGRDNNKIQRYKGLGEMDAEQLWETTMDPERRVLKKVVLDESMETDVVFSTLMGDQVAPRREFIEANAKYVSNLDI 650
165 0.000e+00gi|493795615|ref|WP_006743648.1| DNA-cytosine methyltransferase [Bacteroides coprosuis]  clstr ali  48  1MTEEQNKGSYKADSIQVLEGLEAVRKRPAMYIGDTSLKGLHHLVYEVVDNSIDEALAGYCDHIDVTINEDNSITVKDNGRGIPTDFHEKEQRSALEVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTRMITEVSRNGITYRQEYACG-KPQYPVKEVGTTDD-TGTKQTFWPDPTIFTVLVYSYDILATRMRELAFLNAGLKISLTDKRDGTYKSESFQSKEGLKEFVRYIDSSREHLVNDVIYL----------NTEKQGVPIEVAIMYNTSFSENIHSYVNNINTIEGGTHLAGFRRALTRTLKKYAEDNKLLDKIKVDISGDDFREGLTAVISIKVAEPQFEGQTKTKLGNTEVMGAVDQAVGEALNYYLEEHPREAKTIVDKVILAATARHAARKARELVQRKSPMSGGGLPGKLADCSEKNPEICELFLVEGDSAGGTAKQGRDRSFQAILPLRGKILNVEKAMYHKALESEEIRNIYTALGVTIGTEEDLEKLRYHKIIIMTDADVDGSHIDTLIMTFFFRYMPQMIQNGYLYIATPPLYLCRKGKTEEYCWTEEQRLAFINNYGGGGIHIQRYKGLGEMNAHQLWETTMDPDNRMLKQVTIDNASDADRIFSMLMGEDVGPRREFIEENATYA-NID. 651
166 0.000e+00gi|498436890|ref|WP_010742559.1| DNA gyrase subunit B [Enterococcus malodoratus]  clstr ali  53  1MTEEEKSKEYDASQIQVLEGLEAVRKRPGMYIGSTSTEGLHHLVWEIVDNSIDEALAGFASHIHVVIEEDNSITVSDDGRGIPVDIQAKTGRPALETVYTILHAGGKFGGGGYKVSGGLHGVGASVVNALSASLDVRVFKNGKVYFQEYRRGA-VVDDLKVIGETEK-HGTTVHFIPDSEIFESTTFNFDKLATRVRELAFLNRGLKISIEDKREEQPVLREYHYEGGIKSYVEHLNHNKAVIFEEPVYVEG----------EQQDITVEVAMQYTDGYHTNILSFANNIHTYEGGTHEFGFKTALTRVINDYARKQKIMKDNDENLSGEDVREGLTAVISIKHPEPQFEGQTKTKLGNSEVRTVTDRLFSENFLKFLMENPSVGRRIVEKGIXXXXXXXXXXXXXEVTRRKGALEISNLPGKLADCSSNDPEKCELFIVEGDSAGGSAKQGRSREFQAILPIRGKILNVEKASMDRILANEEIRSLFTAMGTGFGADFDVSKARYHKLVIMTDADVDGAHIRTLLLTLFYRYMRPIVEAGYVYIAQPPLYGIKQGKNITYIQAEEELAQKMAELPAPKPNVQRYKGLGEMDDHQLWETTMDPENRLMLQVSVDDAIEADQVFEMLMGDRVEPRRAFIEENAHYVKNLDI 649
167 0.000e+00METAHIT MH0011 GL0096507 [Complete] locus=scaffold23549_2:1775:3691:+  ali  52  2...EKYNHEYNAEQIQVLEGLEAVRKRPGMYIGSVSIRGLHHLVYEIVDNCVDEALAGYCTHIHIIIEKGNIISVEDDGRGIPVDIHPKTHISAAETVYTVLHAGGKFGGDGYKVSGGLHGVGASVVNALSEWAEVTIQRDGGIYEMKFQRG-KTTEKLTRLGDS-KKTGTKVRFLADSTIFETLEYDFGTLEERFREIAFLNKGLHITIEDQRDENLKKSEFCFEGGLISFVEFLNQNKEKIHPTPIYIEK-----------DGEVPVEIALQYTTAYTENIYTFVNNINTIEGGTHLEGFKRGITKVFNDYARAHNILKEKDSNLLGEDIREGMTAVISVKVKEPQFEGQTKTKLGNSVVTGIVQSMVVEVLAPFLEENPSVAKAILEKCISASRAREAARKARELVRRKNSLESTTLPGKLADCSEKDASQCEVYIVEGDSAGGSAKQGRDRRFQAILPLWGKMLNVEKSRADKIYNNEKLQPVILAVGAGIGADFDINKIRYGKIIIMADADVDGAHIRTLLLTFFFRYMRPLIENGNVYLAQPPLYKLKKGFKDVYCYTDEEMAQHLQEMGRDNVNIQRYKGLGEMNPEQLWETTMNPKTRIMIKVTMEDAMKADAIFNVLMGEEIAPRREFIEKNAKSVRNLDV 638
168 0.000e+00METAHIT MH0009 GL0072428 [Complete] locus=scaffold682_7:682:2679:-  ali  49  27..DTVVTEEYGADQIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNSIDEALAGFCTHIEVEILPGNIISVRDNGRGIPVATHEKMGIPTLTVVLTVLHAGGKFGGSGYKVSGGLHCVGSSVVNALSEWMEAEVSRDGHVHYQKFSRGNAVC-DMKIIGDT-NETGTLIRFKPDPEIFETTEYDFDVLERRLRESAFLNAGLSIKLKDSRDENVVEKVYCYEGGLSSFVEYINTSRTPLHTPPIHIS----------TTVGDKYAEVAMAYNDSYNEIILSFANNVHTIDGGTHETGFKTALTRVFNDYGRKYGILKDSDKKLSGEDVREGLSAVISVKLTEAQFEGQTKGKLGNTEMTGIVSSLVYDKLMTYFEENPSVAKAIFSKALDASRAREAARKARDLARRKGALESNSLPGKLADCTEKSADSTELYIVEGDSAGGSAKEGRDRQFQAILPLWGKMLNVEKSRLDKVITNEKLIPIVTALGTGIGEDFDINKLRYDKVVIMADADVDGAHIRTLLLTFFFRYMRPLLDTGHVYLAQPPLFKVSKGKKHVYAFSDEERDRLTEEMGG-GCDIQRYKGLGEMDPIQLWETTMDPKTRIMLRVTLEDAMEADETFSILMGDKVEPRRDFIEKNAKYVQNLDV 665
169 0.000e+00  ali  49  27..DTVVTEEYGADQIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNSIDEALAGFCTHIEVEILPGNIISVRDNGRGIPVATHEKMGIPTLTVVLTVLHAGGKFGGSGYKVSGGLHCVGSSVVNALSEWMEAEVSRDGHVHYQKFSRGNAVC-DMKIIGDT-NETGTLIRFKPDPEIFETTEYDFDVLERRLRESAFLNAGLSIKLKDSRDENVVEKVYCYEGGLSSFVEYINTSRTPLHTPPIHIS----------TTVGDKYAEVAMAYNDSYNEIILSFANNVHTIDGGTHETGFKTALTRVFNDYGRKYGILKDSDKKLSGEDVREGLSAVISVKLTEAQFEGQTKGKLGNTEMTGIVSSLVYDKLMTYFEENPSVAKAIFSKALDASRAREAARKARDLARRKGALESNSLPGKLADCTEKSADSTELYIVEGDSAGGSAKEGRDRQFQAILPLWGKMLNVEKSRLDKVITNEKLIPIVTALGTGIGEDFDINKLRYDKVVIMADADVDGAHIRTLLLTFFFRYMRPLLDTGHVYLAQPPLFKVSKGKKHVYAFSDEERDRLTEEMGG-GCDIQRYKGLGEMDPIQLWETTMDPKTRIMLRVTLEDAMEADETFSILMGDKVEPRRDFIEKNAKYVQNLDV 665
170 0.000e+00  ali  52  2...EKYNHEYNAEQIQVLEGLEAVRKRPGMYIGSVSIRGLHHLVYEIVDNCVDEALAGYCTHIHIIIEKGNIISVEDDGRGIPVDIHPKTHISAAETVYTVLHAGGKFGGDGYKVSGGLHGVGASVVNALSEWAEVTIQRDGGIYEMKFQRG-KTTEKLTRLGDS-KKTGTKVRFLADSTIFETLEYDFGTLEERFREIAFLNKGLHITIEDQRDENLKKSEFCFEGGLISFVEFLNQNKEKIHPTPIYIEK-----------DGEVPVEIALQYTTAYTENIYTFVNNINTIEGGTHLEGFKRGITKVFNDYARAHNILKEKDSNLLGEDIREGMTAVISVKVKEPQFEGQTKTKLGNSVVTGIVQSMVVEVLAPFLEENPSVAKAILEKCISASRAREAARKARELVRRKNSLESTTLPGKLADCSEKDASQCEVYIVEGDSAGGSAKQGRDRRFQAILPLWGKMLNVEKSRADKIYNNEKLQPVILAVGAGIGADFDINKIRYGKIIIMADADVDGAHIRTLLLTFFFRYMRPLIENGNVYLAQPPLYKLKKGFKDVYCYTDEEMAQHLQEMGRDNVNIQRYKGLGEMNPEQLWETTMNPKTRIMIKVTMEDAMKADAIFNVLMGEEIAPRREFIEKNAKSVRNLDV 638
171 0.000e+00JGI.Meta 7037868538 SRS014923_WUGC_scaffold_31122__gene_52289 DNA gyrase, B subunit [Human Stool microbiome from visit number 1 of subject 7  ali  52  1MSKEQNNQEYGADQIQILEGLEAVRKRPGMYIGSTSSRGLHHLVYEIVDNAVDEALAGYCKNIEVTIEEDNSITVQDDGRGIPVGTNHKAKKSALEVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTWLTVEVYKDGNIYRQSYKRG-KTDDTVKIVGQCDESHGTKVHFLPDPEIFEETVYDYDTLKQRLRETAFLTKGLKITLKDVRENSHHNHVFHYEGGIKEFVEYLNRGKEALYDEVIYCEGT----------QNGVYVEVALQHNDSFNDSTFSFVNNVITPEGGTHLAGFRNALTKTFNAYAREKKILKDSDPALTGDDIREGLTAIISIKIEEPQFEGQTKQKLGNSEARGAVDAVVSEKLTYFLEQNPDVAKNICEKSLLAQRAREAARKARDLTRRKTSLDGGTLPGKLADCSDKDPKNCEIFIVEGDSAGGSAKTARSRATQAILPLRGKILNVEKARLDRIYDNAEIRAMITAFGTGIHEDFDITKLRYDKIIIMTDADVDGAHIATLMLTFLYRFMPDLIKEGHVYLATPPLYKVEKNKGVWYAYDDDELKQILNDIGRDNNNIQRYKGLGEMDADQLWETTMDPDHRILKQVMIENSSELDVTFTTLMGDKVEPRKEFIEANAKYVTNLDI 645
172 0.000e+00JGI.Meta 7049397218 SRS051031_LANL_scaffold_3971__gene_3385 DNA gyrase, B subunit [Human Stool microbiome from visit number 2 of subject 764  ali  52  2...EKYNHEYNAEQIQVLEGLEAVRKRPGMYIGSVSIRGLHHLVYEIVDNCVDEALAGYCTHIHIIIEKGNIISVEDDGRGIPVDIHPKTHISAAETVYTVLHAGGKFGGDGYKVSGGLHGVGASVVNALSEWAEVTIQRDGGIYEMKFQRG-KTTEKLTRLGDS-KKTGTKVRFLADSTIFETLEYDFGTLEERFREIAFLNKGLHITIEDQRDENLKKSEFCFEGGLISFVEFLNQNKEKIHPTPIYIEK-----------DGEVPVEIALQYTTAYTENIYTFVNNINTIEGGTHLEGFKRGITKVFNDYARAHNILKEKDSNLLGEDIREGMTAVISVKVKEPQFEGQTKTKLGNSVVTGIVQSMVVEVLAPFLEENPSVAKAILEKCISASRAREAARKARELVRRKNSLESTTLPGKLADCSEKDASQCEVYIVEGDSAGGSAKQGRDRRFQAILPLWGKMLNVEKSRADKIYNNEKLQPVILAVGAGIGADFDINKIRYGKIIIMADADVDGAHIRTLLLTFFFRYMRPLIENGNVYLAQPPLYKLKKGFKDVYCYTDEEMAQHLQEMGRDNVNIQRYKGLGEMNPEQLWETTMNPKTRIMIKVTMEDAMKADAIFNVLMGEEIAPRREFIEKNAKSVRNLDV 638
173 0.000e+00gi|576979927|gb|EUC52706.1| DNA gyrase, B subunit [Mogibacterium timidum ATCC 33093]  clstr ali  50  1MSAEKKQQKYDASQITVLEGLEPVRVRPGMYIGSTGPAGLHHLVYEIVDNSVDESLAGYCKHITVTINEDNSITVTDDGRGMPVDVHPKLGIPAVEVIHTQLHAGGKFGSGGYKVSGGLHGVGASVVNALSTHMIVEVKRNGKLYRQEYKRG-KTVTKLEVIG-TSKDTGSKTTFWPDPEIFDGTVFEYDILQRRMREMAFLNKGLRISIEDKREGKEKRESFHYEGGIIEFVQYLNKNKGVVNNKIFYFE----------YEKDGYEVEVAMQYTDRYSELTLSYANNINTIEGGFHLMGFRAALTRTVNDYARRSKILKENDDSLQGEDVREGLTAIVSVKLTNPQFEGQTKAKLGNSEVRGFVESNMNENLSFYLDENPKEAKLILDKCLXXXXXXXXXXXXXXITRKTSVLETTSLPGKLADCSEKDPALSEIFLVEGDSAGGSAKSGRDRKRQAVLPLRGKIINVEKARADRILNSDEIKNMITAFGCGVGSNFDIDKLRYHKIIIMTDADVDGAHIRTLLLTFFYRFMTPLIEKGYVYAAQPPLFRVKQGKEIHYTYSDAEQDKLLAELKATKIEIQRYKGLGEMDFNQLWETTMDYNHRTLVQIKIEDATAADEIFTTLMGDKVPPRKKFIEDNARYAT-LDI 641
174 0.000e+00gi|652440004|ref|WP_026835042.1| DNA gyrase subunit B [Eubacterium xylanophilum]  clstr ali  52  1MPKKEEKVEYGADQIQILEGLEAVRKRPGMYIGSTSERGLHHLVYEIVDNSIDEALAGYCNKIDVYINEDNSITVRDNGRGIPVGINKKAGKPAVEVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSNWLEVEIYKDGKIYHQRYERG-KTCGELAVIGETDKQ-GTRVTFLPDETIFETTIFDYETLRKRLREMAFLTKGVKIVLHDKRDGEDKVEAFLYEGGIKEYVEYLNRGKNELYEDIIYCEG----------QKGNVYVEVAFQHNDSFTDNCYSFVNNITTPEGGTHLTGFKNAMTKTFNDYARINKILKDNDPNLSGDDIREGLTAIISIKIPEPQFEGQTKQKLGNSEAKRAVESIVTEQLTIFLELNPSVAKLICEKSILAQRAREAARKARDLTRRKTALDGTSLPGKLADCSDKNPENCEIYIVEGDSAGGSAKTARDRATQAILPLRGKILNVEKARLDKILVNNEIRAMITAFGTGISEDFDISKLRYHKIIIMTDADVDGAHIATLLLTFFYRFMPDLIKEGYVYLAQPPLYKIDKNKKSYYVYSDEELNSKLEELGRDGNNIQRYKGLGEMDAEQLWDTTMDPSKRVLLKVQMDESSEIDLTFTTLMGDQVEPRREFIEKNARFA-NLDI 644
175 0.000e+00gi|652814229|ref|WP_027105709.1| DNA gyrase subunit B [Lachnospiraceae bacterium V9D3004]  clstr ali  53  2......SNEYGADQIQILEGLEAVRKRPGMYIGSTSERGLHHLVYEIVDNSIDEALAGYCDHITVTINEDNSITVTDNGRGIPVGINHKAGIPAVEVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSDWLEVTIHSDGKKYIQRYERGN-VMYPLRELGDTNH-TGTEVTFKPDGTIFETLEYNFDTIKTRLREMAFLTKGVRIDLKDKRKGIEQERSFCYEGGIKEYVQYLNRSKEPLYENIIYCEG----------KKNNVYVEVAFQHNSSYNEGCYSFVNNITTPEGGTHMTGFRNAITKTFNDYARNQKILKEKESNLSGEDIREGLTAIISVKIEEPQFEGQTKQKLGNSEARGAVEGVVSEQLTYFLEQNPSVAKIICDKALLAQRAREAARRAKE-TARKGALEGMSLPGKLADCSDKNPENCEIYIVEGDSAGGSAKTARDRATQAILPLRGKILNVEKSRLDKILANKEIRAMITAFGTGIHDEFDISKLRYHKIIIMTDADVDGAHISTLLLTFFYRFMPDLIKEGYVYLAQPPLYKLEKNKKVWYAYSDEELNDILTEVGRDGNNIQRYKGLGEMDAEQLWDTTMDPAKRILHRVTIEQESEIDVTFTILMGDNVEPRREFIEENARFVKNLDI 637
176 0.000e+00METAHIT MH0009 GL0139142 [Complete] locus=scaffold31954_2:6241:8181:-  ali  50  9.EATAVKGNYNAEQIHVLEGLEAVRKRPAMYIGSTSSRGLHHLVYEVVDNSIDEALAGYCSDIKVIIHKDNSITVIDNGRGIPVDMMKKEKKPAVEVIMTVLHAGGKFGDGGYKVSGGLHGVGVTCVNALSEHMEVEVRRGGKCYGIEFAKG-KTSKKLYEKGDCE-TTGTTVHFKPDATIFTETEYSYDTLRLRIRELAFLNKGITISLTDERAED-KSETFHFAGGIIEYVEFMDKDKDKINPKPIYLEG----------EKNAVIVEVAMQYCDTYSENIFTYVNNINTEEGGTHLSGFRKALTRTINAYARKTNMLKENEDALSGDDVREGLTAVLSLKVQNPQFESQTKIKLGNSEVMPIVDNLVGDTLAEFMEENPQVAKKLVEKXXXXXXXXXXXXXXXELTRRKNAMDLGGLPGKLADCKSRNVEDTEIYLVEGDSAGGSAKQGRNSDFQAILPLRGKILNVEKARLDKVLSSEEIRNMITAFGCGIGDDFNLDKARYGKIIIMTDADVDGAHIRTLLLTFFYRYMQPLIKEGHVFIAQPPLYLIRKNKQHYYAYSDEELQQILDEVGRDNPYVQRYKGLGEMNPGQLWETTMDPAARTILQVHLEDAAEADRIFSILMGDKVEPRRQFIEDNAKKVRNLD. 645
177 0.000e+00gi|501153319|ref|WP_012198039.1| DNA gyrase subunit B [Lachnoclostridium phytofermentans]  clstr ali  53  2......SKDYGADQIQILEGLEAVRKRPGMYIGSTSSRGLHHLVYEIVDNAVDEALAGYCNTIDVSINPDNSITVIDNGRGIPVETNKKKGISTVEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVTVELEGKMYKQRYECG-KVIEPLRVVGESD-RTGTTVSFLPDRSIFEETVYDYDILKQRLREMAFLTKGLKIILRDLRTSEPNVKEFHYEGGIKEYVQYLNKHKSNLYPEIIYCEGT----------RDSVYVEVAMQHNDSYSESCYSFVNNITTPEGGTHYTGFKNAITKTFNDFARQMKFLKDNETNLSGEDIREGLTAIISIKLPDPQFEGQTKQKLGNSEARAAVDSVVSEQLTYFLEQNPSVAKIILEKAVLAQRARDAARKARDLTRRKTALEGMSLPGKLADCSDKDPKNCEIYIVEGDSAGGSAKTARSRATQAILPLRGKILNVEKSRLDKILVNNEIKAMITAFGTGISDDFDISKLRYHKIIIMTDADVDGAHISTLLLTFLYRFMPELIRDGYVYLAQPPLYKVEKSKQVWYAYSDEDLNNILLQIGRDNNKIQRYKGLGEMDAEQLWETTMDPERRVLLRVKMENSSEIDLTFTTLMGDNVEPRREFIEANAKYVKNLDI 642
178 0.000e+00gi|515752797|ref|WP_017185397.1| DNA gyrase subunit B [Alkalibacillus haloalkaliphilus]  clstr ali  55  1.............................MYIGSTSERGLHHLVWEVVDNSIDEALAGHCDSIEITIGEDNSITVTDNGRGIPVDLHQKAGKPALEVIMTVLHAGGKFDGGSYKVSGGLHGVGASVVNALSSECEVYVHRDGKLYYQSYKRGIP-NEEVSVIGETDI-TGTKTRFKPDPEIFETQEYSYESLLNRTRELAYLNKKLKISXXXXXXXXXXXXXXXXXGGISEYVEHLNRTREALH-DPIYGE----------SELDDITVEFAIQYNDGFASNLYSFANNINTAEGGTHESGFKTALTRVINDYARKNHLYKENDPNLIGDDVREGLTAIISVKHPDPQFEGQTKTKLGNSEVRTITDQIFSDKFSQFLVEHPKVAKQIVEKGLMASRARIAAKKAREVTRRKSALEVSSLPGKLADCATKDATVSELYIVEGDSAGGSAKQGRDRHFQAILPLRGKIINVEKARLDKILSNNEIRAIITALGTGIGEEFDLSQARYQKIVIMTDADVDGAHIRTLLLTFFYRYMRPLVESGYIYIAQPPLYKMSQGKKDYYAYNEHEMEKIYSELPNPKISLQRYKGLGEMNPTQLWETTMNPESRTLLQVNSQDAMEADEIFEILMGDQVEPRRDFIQQNAQYVQNLDI 610
179 0.000e+00gi|516116870|ref|WP_017547450.1| DNA gyrase subunit B [Salinicoccus carnicancri]  clstr ali  53  1MAETNQEQ-YGASQIQVLEGLEAVRKRPGMYIGSTASKGLHHLVWEIVDNSIDEAMAGYATRVNVTVEKDNWVKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSETLEVYVHLDGKIHHQQYKRGVP-QFDLKVIGETDK-TGTMIRFKADPEIFETTEYELDILQHRIKELAFLNKGLEINLTDERGEVDETFSYHYEGGIKSYVEQMNETREVLHDDVIYMH----------SEKDDIEVEIALQYNSGFTTTLLSYANNINTYEGGTHEDGFKRALTKVINNYGVTNKIIKEGEDRLSGEDVREGMTAVVSIKHTDPQFEGQTKTKFGNSEARLITDQLFTEGFERFMMENPPVAKVIVEKGITAQHARLAAKKAREMTRRKSALEISSLPGKLADCSSKDPAESELFIVEGDSAGGSAKSGRDSTKQAILPLRGKILNVEKARLDRILNNNEIRSMITALGTGIGEEFDLSRARYHKIVIMTDADVDGAHIRTLLLTFFYRFMKPLIEAGYVYIAQPPLYKVEQGKNKHYVFDDKELDRLKNELKDPKISLSRYKGLGEMNADQLWETTMDPGFRSLLQVSLKDAVDADQTFEMLMGDIVEHRKTFIEENAMYVQNLDV 639
180 0.000e+00  ali  51  9.EATAVKGNYNAEQIHVLEGLEAVRKRPAMYIGSTSSRGLHHLVYEVVDNSIDEALAGYCSDIKVIIHKDNSITVIDNGRGIPVDMMKKEKKPAVEVIMTVLHAGGKFGDGGYKVSGGLHGVGVTCVNALSEHMEVEVRRGGKCYGIEFKQG-KTSKKLYEKGDCD-VTGTTVHFKPDATIFTETEYSYDTLRLRIRELAFLNKGITISLTDERAED-KSETFHFAGGIIEYVEFMDKDKDKINPKPIYLEG----------EKNAIIVEVAMQYCDTYSENIFTYVNNINTEEGGTHLSGFRKALTRTINAYARKTNMLKENEDALSGDDVREGLTAVLSLKVQNPQFESQTKIKLGNSEVMPIVDNLVGDTLAEFMEENPQVAKKLVEKXXXXXXXXXXXXXXXELTRRKNAMDLGGLPGKLADCKSRNVEDTEIYLVEGDSAGGSAKQGRNSDFQAILPLRGKILNVEKARLDKVLSSEEIRNMITAFGCGIGDDFNLEKARYGKIIIMTDADVDGAHIRTLLLTFFYRYMQPLIKEGHVFIAQPPLYLIRKNKQHYYAYSDEELQQILDEVGRDNPYVQRYKGLGEMNPGQLWETTMDPAARTILQVHLEDAAEADRIFSILMGDKVEPRRQFIEDNAKKVRNLD. 645
181 0.000e+00gi|499882270|ref|WP_011563004.1| DNA gyrase subunit B [Rubrobacter xylanophilus]  clstr ali  50  6.AAKHSKSDYDASSIQVLEGLEAVKRRPGMYIGSTGPRGLHHLVWEIVDNSIDEALAGYCTEISVTVHPDNSVTVSDDGRGMPVGVMEKYGKSAAEVIMTTLHAGGKFDGQTYKVSGGLHGVGASVVNALSEWLELEIRRDGHLWTQRYERGFPVTG-LERLGKREG-TGTTVRFRPDPQIFETVEFSFDTLSRRFRESAFLNKGLRIRLADER-EEGREVVYRYEGGIKDFVAHINEAKDPVHKTILYFH----------REEEAGDVEVAMQWNSGYQDSVFTFANNINTHEGGTHLSGFRAALTRTINEYARQKGLLKEKEENLTGDDIREGLAAVISVKLREPQFEGQTKTKLGNTEIKGLVESATNRHLAEFLEENPGQARAIVTKAINASRARLAASKARKAI-RKGYLESSTLPGKLADCSSKDPARSELYIVEGDSAGGSAKQGRDRNFQAILPLRGKILNVEKANINKVLSNAEIQAMISAIGAGVGDSFNIEEARYHKIVIMTDADVDGSHIRTLVLTFLYRNMPELIEAGYVYIAQPPLYKITHNRRDVYVYSDAELQETLRRLRADGATVSRFKGLGEMNPQQLWETTMDPANRTLLQVTIDSAATADELFTALMGDKVEPRKAFIEANAREAKNID. 643
182 0.000e+00  ali  49  20..DTSVNEEYSAKDIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNSIDEALAGVCTHIECEILPDNIIAVRDNGRGIPTGINDKTGLPAVTVVLTVLHAGGKFGGSGYKVSGGLHGVGSSVVNALSEWLEVEVTQNGHIYSQRFERGNPV-NDLHIIGDSDG-HGTYIKFKPDGEIFETLVYDFDVLSRRLREQAFLNAGLSITLSDLRPEEQKKEVYCYEGGIKSFVEYINTSRNPIQSEVIHIS----------TTKEERSAEVALCYTDSYNEILLSFANNINTIDGGTHETGFKTALTRVFNDYGKKFNILKDSDKKLSGDDVREGLTAIVSVKLTEAQFEGQTKGKLGNTDITGLVSSMVYEKLMTYFEENPQTAKAILNKALDASRAREAARKARDNARSKSGLENTRLPGKLADCSSNEPELCEIYIVEGDSAGGSAKEGRDRVHQAILPLWGKMLNVEKARLDKVYGNEKLMPIVTALGTGIGEDFDISKLRYHKIVIMADADVDGAHIRTLLLTFFFRYMKPLVEGGYIYLAQPPLFKVTKGKKNAYAFSDEERDSLIQEMGGQ-CDVQRYKGLGEMDPEQLWETTMDPEFRTMLRVTVEDAQQADETFSILMGDNVEPRRDFIEKNAKYVENLDV 660
183 0.000e+00  ali  52  1MSKEQNNQEYGADQIQILEGLEAVRKRPGMYIGSTSSRGLHHLVYEIVDNAVDEALAGYCKNIEVTIEEDNSITVQDDGRGIPVGTNHKAKKSALEVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTWLTVEVYKDGNIYRQSYKRG-KTDDTVKIVGQCDESHGTKVHFLPDPEIFEETVYDYDTLKQRLRETAFLTKGLKITLKDVRENSHHNHVFHYEGGIKEFVEYLNRGKEALYDEVIYCEGT----------QNGVYVEVALQHNDSFNDSTFSFVNNVITPEGGTHLAGFRNALTKTFNAYAREKKILKDSDPALTGDDIREGLTAIISIKIEEPQFEGQTKQKLGNSEARGAVDAVVSEKLTYFLEQNPDVAKNICEKSLLAQRAREAARKARDLTRRKTSLDGGTLPGKLADCSDKDPKNCEIFIVEGDSAGGSAKTARSRATQAILPLRGKILNVEKARLDRIYDNAEIRAMITAFGTGIHEDFDITKLRYDKIIIMTDADVDGAHIATLMLTFLYRFMPDLIKEGHVYLATPPLYKVEKNKGVWYAYDDDELKQILNDIGRDNNNIQRYKGLGEMDADQLWETTMDPEHRILKQVMIENSSELDVTFTTLMGDKVEPRKEFIEANAKYVTNLDI 645
184 0.000e+00JGI.Meta 7053148717 SRS048164_WUGC_scaffold_24762__gene_52005 DNA gyrase, B subunit [Human Stool microbiome from visit number 1 of subject 8  ali  51  9.EATAVKGNYNAEQIHVLEGLEAVRKRPAMYIGSTSSRGLHHLVYEVVDNSIDEALAGYCSDIKVIIHKDNSITVIDNGRGIPVDMMKKEKKPAVEVIMTVLHAGGKFGDGGYKVSGGLHGVGVTCVNALSEHMEVEVRRGGKCYGIEFAKG-KTSKKLYEKGDCE-TTGTTVHFKPDATIFTETEYSYDTLRLRIRELAFLNKGITISLTDERAED-KSETFHFAGGIIEYVEFMDKDKDKINPKPIYLEG----------EKNAVIVEVAMQYCDTYSENIFTYVNNINTEEGGTHLSGFRKALTRTINAYARKTNMLKENEDALSGDDVREGLTAVLSLKVQNPQFESQTKIKLGNSEVMPIVDNLVGDTLAEFMEENPQVAKKLVEKXXXXXXXXXXXXXXXELTRRKNAMDLGGLPGKLADCKSRNVEDTEIYLVEGDSAGGSAKQGRNSDFQAILPLRGKILNVEKARLDKVLSSEEIRNMITAFGCGIGDDFNLEKARYGKIIIMTDADVDGAHIRTLLLTFFYRYMQPLIKEGHVFIAQPPLYLIRKNKQHYYAYSDEELQQILDEVGRDNPYVQRYKGLGEMNPGQLWETTMDPAARTILQVHLEDAAEADRIFSILMGDKVEPRRQFIEDNAKKVRNLD. 645
185 0.000e+00JGI.Meta 7040086290 SRS016342_Baylor_scaffold_38609__gene_44589 DNA gyrase, B subunit [Human Tongue dorsum microbiome from visit number 1 of  ali  51  15......SKEYGADQIQILEGLEAVRKRPGMYIGSTSVRGLHHLVYEIVDNSVDEALAGFCNTITVKIHQDNSITVRDNGRGIPVDIQKKAGKSALEVVFTVLHAGGKFGGAGYKVSGGLHGVGASVVNALSEWLHVKVYKEGKIYTMSFAKG-KVTKPIECIGTCEEEQGTEVHFLPDASIFEESVYEFETLKIRLRETAFLTKNLKIRLVDEREGMEQEKEFHYEGGIQEFVSFLNKGKEALYPDVIYCEG----------EKEKILVEVAMQHNDSYTENIYTFVNNINTPEGGTHLTGFKNALTKTFNDYARQNKLLKDSEANLSGEDIREGLTCIISVKIEDPQFEGQTKQKLGTSEAQVAVQGIVSEQLTYFLEQNPAVAKVICEKSILXXXXXXXXXXXXDLTRRKSALDGVGLPGKLADCSSKDPERCEIFIVEGDSALGPAKEGRNPETQAVLPLRGKVLNVQKARLDRIYANEEIKGMITAFGTGIHEDFDLSKLRYHKIIIMTDADVDGAHISTLMLTFIYNFMPELIRKGHVYLAQPPLFTIQKNKKHYYAYSDEEYQRILKEIGSDGADVSRFKGLGEMNTEELQETTLDPETRTLLRVNMEDKAELDITFTTLMGDQVEPRREFIEQNARYVTNLDI 650
186 0.000e+00gi|547237075|ref|WP_021973252.1| dNA gyrase subunit B [Eubacterium sp. CAG:180]  clstr ali  50  19..DTVVTEEYGAEQIQVLKGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNSIDEALAGYCTHIEVEILPGNVITVRDNGRGIPVDINEEEGLPAVTVVLTVLHAGGKFGGSGYKVSGGLHGVGSSVVNALSEWFEIEVSRQGHIYHQRFERGD-VKSDLEIIGDT-NETGTFIKFKADPEIFETTEYDFETLQKRLREQAFLNAGLSISLTDKRDENILSEVYCYEGGIRSFVDYINKSRTPLHEDIMHFSVVD----------GDRSAEVAMSYNDGYNEIILSFANDVRTIDGGTHEMGFKTALTRVFNDYGKKFNLIKDSDKKLSGDDVREGLTAVISVKLTEAQFEGQTKGKLGNTEITGLVSKMLYDKLMTYLEENPSTARTILNKSLDASRAREAARKARDNARRKSALESNSLPGKLADCTDKNPENTELYIVEGDSAGGSAKGGRDRNTQAILPLWGKMLNVEKARVDKVIGNEKLTPVILALGTGIGDDFDITKLRYHKIVLMADADVDGAHIRTLLLTFFFRYMRPLIEHGYVYIAQPPLFKVSKGKKHFYAFSDEERDEKIAELGGS-CDVQRYKGLGEMDSQQLWETTMDPKYRTMLRVNLEDAMEADETFSVLMGDKVEPRREFIEKNAKFVQNLDI 657
187 0.000e+00gi|548327792|ref|WP_022513653.1| dNA gyrase subunit B [Dialister sp. CAG:588]  clstr ali  51  14..EENGDANYSAGEIRVLEGLEAVRLRPGMYIGSTSSRGLHHLVYEIVDNSIDEALAGFCDKIEVRINEDGSCTVVDNGRGIPVDMHE-SGKPALEVVLTVLHAGGKFGDGGYAISGGLHGVGVSVVNALSSWMKVQVHRDGNVYEMMFSRGE-VTKEMTIVDKTDH-TGTIVTFMPDPEIFEGVDFSYDTLKVRVRELAFLNKGLRIRLTDNRPATTKSEEFHYAGGIIEFVKYLNNGKDLVTKDVIAFEG----------EKDKVIVDIALQYQNGYTENMYTFVNDINTIEGGMHLSGFRTALTRCINDYARKNGLLKNSDENLTGEDVREGLTCVISVKVPNPQFEGQTKTKLGNQEVKGIVDNITSEGLRVYLEEHPAEAKEIIGKSITXXXXXXXXXXXXXLTRRKNALEVSSLPGKLADCSERDPKFTELYIVEGDSAGGSAKSGRDRRYQAILPLRGKILNVEKARLDRVLNSDAIRTMITAFGTGIGQDFDIEKLRYHKIIIMTDADVDGAHIRTLLLTFFYRYMPKLITEGHVFIAQPPLYQVRKGKKKYYTYNDDEQNKLIEEIGLEGSYIQRYKGLGEMNPEQLWDTTMDPKNRIMFRVDLMDAVEADHIFDVLMGDKVEPRRKFIEENAENVTNLD. 648
188 0.000e+00gi|652832795|ref|WP_027116683.1| DNA gyrase subunit B [Lachnospiraceae bacterium P6B14]  clstr ali  53  1MAETEVNQEYGADQIQILEGLEAVRKRPGMYIGTTSERGLHHLVYEIVDNAIDEALAGYCDNIQVIIHEDNSITVEDNGRGIPVGINSKAGLPAVEVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTYLEVEIYQDGKSYIQRYERGN-TMYPLKETGTTDKR-GTKVTFLPDPEIFETTVYDFRILRRRLREMAFLTKGVKITLKDERKEGEREETFHYEGGIKEYVAYINKNKKPLYEDIIYCEG----------QRDEVYVEVAFQHNSEYNEGCYSFVNNINTPEGGMHLTGFKNALTKTFNEYSRANKILKDSDPNLSGEDIREGLTAIISVKIPEPQFEGQTKQKLGNSEANAATSSVVSEQLTYYLEQNPVVAKVICEKAVLAQRAREAARKAREMT-RKSSLDVSSLPGKLADCSDKDPSKCEIYIVEGDSAGGSAKTARDRATQAILPLRGKILNVEKARLDRILGNAEIRAMITAFGTGISEDFDIEKLRYHKIIIMTDADVDGAHIATLMLTFFYRFMPELIRQGYVYLAQPPLYKVEKNKKTYYAYTDDELNAVLEQIGRDGNNIQRYKGLGEMDAEQLWDTTMDPEKRILLRVDMDDGEELDITFNTLMGDEVEPRREFIETNAKYAKNLDI 649
189 0.000e+00METAHIT MH0016 GL0115475 [Complete] locus=scaffold40450_1:21249:23222:+  ali  50  19..DTVVTEEYGAEQIQVLKGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNSIDEALAGYCTHIEVEILPGNVITVRDNGRGIPVDINEEEGLPAVTVVLTVLHAGGKFGGSGYKVSGGLHGVGSSVVNALSEWFEIEVSRQGHIYHQRFERGD-VKSDLEIIGDT-NETGTFIKFKADPEIFETTEYDFETLQKRLREQAFLNAGLSISLTDKRDENILSEVYCYEGGIRSFVDYINKSRTPLHEDIMHFSVVD----------GDRSAEVAMSYNDGYNEIILSFANDVRTIDGGTHEMGFKTALTRVFNDYGKKFNLIKDSDKKLSGDDVREGLTAVISVKLTEAQFEGQTKGKLGNTEITGLVSKMLYDKLMTYLEENPSTARTILNKSLDASRAREAARKARDNARRKSALESNSLPGKLADCTDKNPENTELYIVEGDSAGGSAKGGRDRNTQAILPLWGKMLNVEKARVDKVIGNEKLTPVILALGTGIGDDFDITKLRYHKIVLMADADVDGAHIRTLLLTFFFRYMRPLIEHGYVYIAQPPLFKVSKGKKHFYAFSDEERDEKIAELGGS-CDVQRYKGLGEMDSQQLWETTMDPKYRTMLRVNLEDAMEADETFSVLMGDKVEPRREFIEKNAKFVQNLDI 657
190 0.000e+00METAHIT V1 GL0078913 [Complete] locus=scaffold4094_4:619:2601:+  ali  49  20..DTSVNEEYSAKDIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNSIDEALAGVCTHIECEILPDNIIAVRDNGRGIPTGINDKTGLPAVTVVLTVLHAGGKFGGSGYKVSGGLHGVGSSVVNALSEWLEVEVTQNGHIYSQRFERGNPV-NDLHIIGDSDG-HGTYIKFKPDGEIFETLVYDFDVLSRRLREQAFLNAGLSITLSDLRPEEQKKEVYCYEGGIKSFVEYINTSRNPIQSEVIHIS----------TTKEERSAEVALCYTDSYNEILLSFANNINTIDGGTHETGFKTALTRVFNDYGKKFNILKDSDKKLSGDDVREGLTAIVSVKLTEAQFEGQTKGKLGNTDITGLVSSMVYEKLMTYFEENPQTAKAILNKALDASRAREAARKARDNARSKSGLENTRLPGKLADCSSNEPELCEIYIVEGDSAGGSAKEGRDRVHQAILPLWGKMLNVEKARLDKVYGNEKLMPIVTALGTGIGEDFDISKLRYHKIVIMADADVDGAHIRTLLLTFFFRYMKPLVEGGYIYLAQPPLFKVTKGKKNAYAFSDEERDSLIQEMGGQ-CDVQRYKGLGEMDPEQLWETTMDPEFRTMLRVTVEDAQQADETFSILMGDNVEPRRDFIEKNAKYVENLDV 660
191 0.000e+00  ali  50  19..DTVVTEEYGAEQIQVLKGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNSIDEALAGYCTHIEVEILPGNVITVRDNGRGIPVDINEEEGLPAVTVVLTVLHAGGKFGGSGYKVSGGLHGVGSSVVNALSEWFEIEVSRQGHIYHQRFERGD-VKSDLEIIGDT-NETGTFIKFKADPEIFETTEYDFETLQKRLREQAFLNAGLSISLTDKRDENILSEVYCYEGGIRSFVDYINKSRTPLHEDIMHFSVVD----------GDRSAEVAMSYNDGYNEIILSFANDVRTIDGGTHEMGFKTALTRVFNDYGKKFNLIKDSDKKLSGDDVREGLTAVISVKLTEAQFEGQTKGKLGNTEITGLVSKMLYDKLMTYLEENPSTARTILNKSLDASRAREAARKARDNARRKSALESNSLPGKLADCTDKNPENTELYIVEGDSAGGSAKGGRDRNTQAILPLWGKMLNVEKARVDKVIGNEKLTPVILALGTGIGDDFDITKLRYHKIVLMADADVDGAHIRTLLLTFFFRYMRPLIEHGYVYIAQPPLFKVSKGKKHFYAFSDEERDEKIAELGGS-CDVQRYKGLGEMDSQQLWETTMDPKYRTMLRVNLEDAMEADETFSVLMGDKVEPRREFIEKNAKFVQNLDI 657
192 0.000e+00JGI.Meta 7024850691 SRS013951_WUGC_scaffold_46387__gene_78428 DNA gyrase, B subunit [Human Stool microbiome from visit number 1 of subject 7  ali  50  19..DTVVTEEYGAEQIQVLKGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNSIDEALAGYCTHIEVEILPGNVITVRDNGRGIPVDINEEEGLPAVTVVLTVLHAGGKFGGSGYKVSGGLHGVGSSVVNALSEWFEIEVSRQGHIYHQRFERGD-VKSDLEIIGDT-NETGTFIKFKADPEIFETTEYDFETLQKRLREQAFLNAGLSISLTDKRDENILSEVYCYEGGIRSFVDYINKSRTPLHEDIMHFSVVD----------GDRSAEVAMSYNDGYNEIILSFANDVRTIDGGTHEMGFKTALTRVFNDYGKKFNLIKDSDKKLSGDDVREGLTAVISVKLTEAQFEGQTKGKLGNTEITGLVSKMLYDKLMTYLEENPSTARTILNKSLDASRAREAARKARDNARRKSALESNSLPGKLADCTDKNPENTELYIVEGDSAGGSAKGGRDRNTQAILPLWGKMLNVEKARVDKVIGNEKLTPVILALGTGIGDDFDITKLRYHKIVLMADADVDGAHIRTLLLTFFFRYMRPLIEHGYVYIAQPPLFKVSKGKKHFYAFSDEERDEKIAELGGS-CDVQRYKGLGEMDSQQLWETTMDPKYRTMLRVNLEDAMEADETFSVLMGDKVEPRREFIEKNAKFVQNLDI 657
193 0.000e+00gi|498304867|ref|WP_010619023.1| DNA gyrase subunit B [Lactobacillus malefermentans]  clstr ali  51  1MADEKETKEYDASQIQVLEGLEAVRKRPGMYIGSTSSQGLHHLVWEIIDNGIDEALAGFANEIHVTVEKDNSITVMDNGRGIPVGLQEKTGRPALETVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSTELDVKVVRDGKRYYMDFAYG-HVHTEMKVIDEAENIHGTTVHFVPDPDIFETTTFDINTLTTRIRELAFLNKGLQITIRDERPEEPTEQDFLYEGGLRHYVEYLNKNKTTLFPEPVYVEGKEK----------GITVEVAMQYTDDFHSNLLTFTNNIHTYEGGTHEEGFKRALTRVVNDYAHKKGLLKENEDNLTGEDVREGMTAVLSIKHPDPQFEGQTKTKLGNSDARTVTDHLFSEYLMDYLMENPTVGKIIVDKGSLASKARVAAKRAREVTRKKSGLEISNLPGKLANNSSKDPAISELFIVEGDSAGGSAKQGRSRLTQAILPIRGKILNVEKASMDRILANEEIRSLFTAMGTGFGDEFDVSKANYHKLIIMTDADVDGAHIRT