current user: public




Query: gi|13507742|ref|NP_109691.1| DNA gyrase subunit B MPN003 [Mycoplasma pneumoniae M129], from M.pneumoniae

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650
# E-value Template Links and tools%idFirst MEDNNKTQAYDSSSIKILEGLEAVRKRPGMYIGSTGEEGLHHMIWEIIDNSIDEAMGGFASTVKLTLKDNFVTIVEDDGRGIPVDIHPKTNRSTVETVFTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSSFKVWVAREHQQYFLAFHNGGEVIGDLVNEGKCDKEHGTKVEFVPDFTVMEKSDYKQTVIASRLQQLAFLNKGIQIDFVDERRQNPQSFSWKYDGGLVQYIHHLNNEKEPLFEDIIFGEKTDTVKSVSRDESYTIKVEVAFQYNKTYNQSIFSFCNNINTTEGGTHVEGFRNALVKIINRFAVENKFLKETDEKITRDDICEGLTAIISIKHPNPQYEGQTKKKLGNTEVRPLVNSIVSEIFERFMLENPQEANAIIRKTLLAQEARRRSQEARELTRRKSPFDSGSLPGKLADCTTRDPSISELYIVEGDSAGGTAKTGRDRYFQAILPLRGKILNVEKSHFEQIFNNVEISALVMAVGCGIKPDFELEKLRYNKIIIMTDADVDGAHIRTLLLTFFFRFMYPLVEQGNIYIAQPPLYKVSYSNKDLYMQTDVQLEEWKQQHPNLKYNLQRYKGLGEMDAIQLWETTMDPKVRTLLKVTVEDASIADKAFSLLMGDEVPPRREFIEQNARNVKNIDILast
1 0.000e+00gi|547700738|ref|WP_022127468.1| dNA gyrase subunit B [Ruminococcus sp. CAG:579]  clstr ali  48  37.SRVDENNNYDENQIQVLEGLEAVRKRPGMYIGSSGPHGLHHLVYEIVDNAIDEALAGYCTQIDVDILPGDVIQVSDNGRGIPTGIHPKEGISAATVVFTVLHAGGKFGGGGYKVAGGLHGVGASVVNALSEWLELTIYDGKNVHFQRFERG-KYSEPLKVIGTTER-TGSVIKFKADPEIFETTVYDYETLLRRLREQAFLNAGLKIVFTDSRDENIQTETLHYEGGIREFVEHIHRSKDAIIPEVIHI----------QGMEGDIFAEIAMQYNTSYTEFVLSFANNIHTPDGGTHETGFKTALTKVINEYGKKFGLLKDGDK-LMGDDVREGLTAIISVKLTNCEFEGQTKGRLGNPEVKPLVDRIVSDKLMDYLEKNPQVAKTIFEKSMAAQRAREAAKNARDLARRKSALESSSLPGKLADCSDRNNEYTEIYIVEGDSAGGSAKEGRDRKFQAILPLWGKMLNVEKARIDKVYGNEKLMPVVTALGTSIGEDFDISKLRYGKVIIMADADVDGSHIRTLLLTFFFRYMRPLIEEGHVYCAQPPLFKVWRGKQVRYAFSEEERDMYASELAGEKVDIQRYKGLGEMNPTQLWETTLDPERRTMIKISVEDAQKADEAFTILMGDKVEPRRDFIEKNAQYATNLDV 680
2 0.000e+00gi|503314687|ref|WP_013549348.1| DNA-cytosine methyltransferase [Cellulophaga algicola]  clstr ali  48  8..DEQKKNNYSADSIQALEGMEHVRMRPSMYIGDVGVRGLHHLVYEVVDNSIDEAMGGHCDTITVAINEDNSITVRDNGRGIPVDIHKKEGVSALQVVMTKIGAGGKFDKDSYKVSGGLHGVGVSCVNALSKDLKATVFRNGTIYEQEYQKG-KALYPVKSIGETEI-RGTEVTFYPDETIFTTVEFNYDTLANRMRELSYLNKGVSITMTDKRQKDKHEERFYSEEGLKEFIKFLDGNREPLIKGVISME----------GEKNGIPVEVAMVYNTSYTENLHSYVNNINTHEGGTHLSGFRRGLTSTLKKYADASGMLEKLKFEIQGDDFREGLTAIISVKVGEPQFEGQTKTKLGNREVSAAVSQAVSEMLSDYLEENPEDAKIIVQKVVLAATARHAATKAREMVQRKTVMSIGGLPGKLSDCSDQDPVNCEVFLVEGDSAGGTAKQGRDRMFQAILPLRGKILNVEKAMRHRVFENEEIKNIYTALGVSIGTELNLEKLRYHKVVIMCDADVDGSHIETLILTFFFRYMRELVEAGHVYIATPPLYLVKKGAKKRYAWNDKERDEIAESF-NGSVGIQRYKGLGEMNAEQLWDTTMNPEFRTLRQVVIENATETDRVFSMLMGDEVPPRREFIEKNAVYA-NID. 652
3 0.000e+00gi|503864357|ref|WP_014098351.1| DNA topoisomerase IV subunit B [Bacillus coagulans]  clstr ali  46  24.AKKQNILEYNDDAIQVLEGLEAVRKRPGMYIGSTDARGLHHLVYEIVDNAVDEALSGYGNHIIVNIHKDNSISVQDFGRGMPVGMH-KLGKPTTEVILTILHAGGKFGQGGYKTSGGLHGVGASVVNALSEWLVVTIHRDGYVYEQRFRDGGKPETTLEKTGKTNKTG-TTIHFKPDPSIFSTITFNYDTLCERLRESAFLLKGLKIEITDERFG--RHDLFHYENGIEAFVQYLNEGKEVLHP-VVFIE----------GETNGIEAEFAFQFNDGFSENILSFVNNVRTKDGGTHEAGAKTALTRVVNDYARKTGLLKEKDKNLEGTDIREGLSAIISVRIPEEQFEGQTKGKLGTSEARSAVDTIVSEHLSYFLEENPDTSNLLIRKAIKASQAREAARKAREEARKKRKKSETTLSGKLTPAQSRNPQRNELYLVEGDSAGGSAKQGRDRKFQAVLPLRGKVINTEKAKLADIFKNEEINTIIYTIGAGVGPEFNLEDVNYDKVIIMTDADTDGAHIQVLLLTFFYRYMRPLIEAGKVYIALPPLYKVSKGEIVEYAWTEKELDETIKKVGR-GYILQRYKGLGEMNADQLWETTMNPETRTLIRVRIDDAARAERRVTTLMGDKVEPRRQWIESHVEF...... 658
4 0.000e+00gi|505033818|ref|WP_015220920.1| DNA gyrase subunit B [Cyanobacterium aponinum]  clstr ali  49  1MSTTNQTSNYDAEQIQVLEGLEPVRKRPGMYIGSTGPRGLHHLVYEVVDNSIDEALAGYCTHIEIDLNADGSVSVTDDGRGIPTDIHPRTKKSALETVMTVLHAGGKFGGGGYKVSGGLHGVGISVVNALSEWVQVTVWRKDKVHTQRYERG-KPITDLETKDDTGHSTGTSVSFLPDNQIFETTEFDYNLLSNRLRELAYLNAGVKITFTDKRVTPEREETYCYEGGIKEYVTYMTREKEVLHQDIIY----------TSGEKNGVQVEVALQWCDAYSDTILGFANNIRTIDGGTHLEGLKTVLTRTLNNIGRKRNKIKENDSNLGGENVREGLTAVISVKVPDPEFEGQTKTKLGNSEVRGIVDSLVGEALNEYLEFNPHVADSIIEKAIQAFKAAEAARRARELVRRKSVLESSPLPGKLADCSSRDPAESEIFLVEGDSAGGSAKQGRDRRFQAILPLRGKILNIEKTDDAKIYKNNEIQSLITALGLGIGDEFDASQLRYHHIVIMTDADVDGAHIRTLLLTFFYRYQRELVEQGYIYIACPPLYKLERGKNHFYCYSDRELQQKIAEFPNANYNIQRFKGLGEMMPEQLWDTTMNPETRMMKRVEIEDAAEADRIFTVLMGDRVAPRREFIETHGPNLTELDV 649
5 0.000e+00gi|546406867|ref|WP_021857441.1| dNA gyrase subunit B [Firmicutes bacterium CAG:555]  clstr ali  49  1MSEEKITQKYDASQIQVLEGLEAVRKRPGMYIGSTSSSGLHHLVYEIVDNSIDEALAGYCDRIEVVIEPGDVISVADNGRGIPVDIQEQTGKSALEVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNAMSEWLIVQVHKNGKIYEMRFSRG-HITQEMRIIGDTDR-TGTTVRFKPDPEMFEDTVYDYDILHTRMREQAFLNGGLFISTEDKREGKEQKDEMCYEGGIREFVSFINQNKTPLHNDVIYM----------KGERADSEAEIALQYNDSYNEIIVSFANNIHTPEGGMHETGFRTALTRVLNAYGIKVGLLK-NDDKLTGEDCREGMTAIISVKLTEPQFEGQTKAKLGNSEMRTLVDSVVSDKLEQFLEENPAVGKAIIEKAMTASRAREAARKARESVRRKTGLESGQMPDKLQDCNERDPSLCEIYIVEGDSAAGSAIQGRDSRFQAILAMWGKMLNVEKARADKIYGNDKLYPLIVALGAGIGDEFNIEKLRYHKIIIMADADVDGSHIRTLLLTFFFRYMRPLIDNGYVYSAVPPLYKLTRGKTVKVAYSDEERDRISAELANAKVDISRFKGLGEMDPHELWETTMDPEKRSLRRITLDDALRADEVFTILMGEEVEPRRAWIESNAKYVVNLDI 643
6 0.000e+00METAHIT MH0026 GL0005813 [Complete] locus=scaffold20795_3:491:2467:+  ali  48  1MEDQAAEQNYSASNIQVLEGLEAVRKRPAMYIGDISEKGLHHLINETVDNSIDEAMAGYCSHIEVTICADGSIVVEDDGRGIPVDEHKKLHKSALEVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTHMMSQVFRDGNIYQQEYEQG-KPLYPVKIVGKTGK-HGTRQQFWPDGTIFTTTTFKWEIIARRMRELAYLNAGVKITLTDEHPDPERQEVFHAKEGLKEFVRYIDRHRTHLFDDVIYL----------KTEKQGVPIEVAIMYNTDYNENLHSYVNNINTIEGGTHVTGFRTALTRTLKAYADNSKQIEKAKIDIVGDDFREGLTAVISIKVAEPQFEGQTKTKLGNSEVSGAVQQAVGEALADYLEEHPDEAKLICNKVVLAATARIAARKARESVQRKNVMSGGGLPGKLADCSIRDPKRAEIFLVEGDSAGGSAKQGRDRYTQAILPLRGKILNVEKVQRHRVFEAESVMNIIQSIGVRFGDDFNTDKLRYDKIIIMTDADVDGSHIDTLIMTLFYRYMPRVIEEGHLYIATPPLYKCTYKKISEYCYTEQQRQIFLDKYANKGVHTQRYKGLGEMNPEQLWETTMDPKTRLLKQVTIENAAEADEIFSMLMGDDVEPRREFIEANATYA-NID. 657
7 0.000e+00gi|502424930|ref|WP_012782643.1| DNA gyrase subunit B [Actinosynnema mirum]  clstr ali  50  1MAAQKK--DYGASSITVLEGLEAVRKRPGMYIGSTGERGLHHLIQEVVDNSVDEAMAGYASKVVVTLLANGGVRVVDDGRGIPVDLHPVEGKPTLEVVLTKLHAGGKFDSDSYAVSGGLHGVGISVVNALSTAVDVEVKRQGFTWNQRFE-ASKPAHELQR-GVPTSETGTTITFWADPTIFETTDYNIETISRRLQEMAFLNKGLSIVLRDERVXKVRERVFHYPGGLEDFVRHLNHTREAVHQKVVSFEAKG----------DDLEVEVAMQWNTGYTPSVYTFANTINTHEGGTHEEGFRAALTRVVNEYARDKKLIKEKDANLTGDDIREGLAAIISVKLKEPQFEGQTKTKLGNSEAKSFVQKSTNEHLADWFERHPNEAKTIITKAVSSSQARIAARKARELVRRKGALDIGGLPGKLKDCRSSNPEECEVYIVEGDSAGGSAKEGRDSMYQAILPIRGKIINVEKARIDRVLKNTEVQSIITAMGTGIHDEFDVSKLRYHKVVLMADADVDGQHIRTLLLTLLFRFMRPLLEHGHVYLAQPPLYKIKWLRAEEYAYSDRERDGLIEQGLAAGDNIQRYKGLGEMNAEELWETTMDPANRVLLQVTMDDAAAADELFSVLMGEDVEARRSFITRNAKGVRFLDV 657
8 0.000e+00gi|513043395|ref|WP_016510623.1| DNA gyrase, B subunit [Exiguobacterium sp. S17]  clstr ali  53  4MSNEKQMQDYGADQIQVLEGLEAVRKRPGMYIGSTGSRGLHHLVWEVVDNSIDEALAGHCETITVTVEPGNSVVVEDDGRGIPVDIQKKTGRPAVEVIFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSKKLEVFVRRNGNVYYQAFKRGAP-QGELEIVGTTDTTG-TTVRFFPDEDIFETLEYDFDLLATRLRELAFLNKGLRIVAKDERGDETIERNYYYEGGIKSYVEHLNRSKSSIHDEPVYV----------HGTKDGIEVEIALQYNEGFSSNIYSFTNNIPTHEGGTHETGFKTALTRAVNDYAKRFGLMKEADGSLSGDDVREGMTAIVSIKHPSPQFEGQTKTKLGNADARTVTDSLFSETFEQFLLENPSVGRLIIDKGLMXXXXXXXXXXXXEMTRRKGILEVSSLPGKLADCSTKDASKSELYIVEGDSAGGSAKSGRDRHFQAILPIRGKIINVEKARLDKILANQEVRTIITALGTGIADEFDLGKARYHKLIIMTDADVDGAHIRTLLLTFFYRYMRPLIESGYVYIAQPPLYGLKHGKEIVYVQNDRELQEAIKRLPNARYSVQRYKGLGEMDPEQLWSTTMNPESRSMLRVDLQDAIEADEVFETLMGDNVEPRRDFIQSHAHYVKNLDI 645
9 0.000e+00gi|654142388|ref|WP_027723869.1| DNA gyrase subunit B [Tuberibacillus calidus]  clstr ali  45  3......NAAYTEDTIQVLEGLEAVRKRPGMYIGSTDARGLHHLVYEIVDNAVDEALSGFGNEIYVTIHEDDSISVRDHGRGMPTGMH-KTGKPTPEVIFTVLHAGGKFGSGGYKTAGGLHGVGASVVNALSEWLVVTITRDGFKYRQRFEHGGKPVTTLEKIG-TARGSGTTIHFKPDPSIFSATRFNFEILSERLREAAFLLKGLKITLDDLRTG--VKETYHYETGLEAFIDYLNEDKDTLHP-VVSFE----------GIQNGIEVDIAFQFNDGYSENILSFVNNVRTKDGGTHESGFKTAMTRVFNDYARKSGLLKEKDKNLEGSDIREGFTGIVSVRVPEHQFEGQTKGKLGTSEARSAVDTVVSEKLTYFLEENPPISDMLIRKAIKAAQAREAARKAREEARKKGKRKEAVLSGKLTPASSKNPQKNELFLVEGDSAGGSAKQGRDRSFQAVLPLRGKVINTEKAKLSDILKNEEINTIIHAIGAGVGPEFNVEDTNYNKIIIMTDADNDGAHIQVLLLTFFYRYMRPLIEAGKVYIALPPLYKVSKGEVIEYAWDDKGLKAAIKKVG-KGYTVQRYKGLGEMNADQLWETTMNPETRTLIRVKIDDAARAERRVSVLMGDKVEPRRKWIESHVAF...... 633
10 0.000e+00gi|496829295|ref|WP_009376905.1| DNA gyrase subunit B [Brevibacterium casei]  clstr ali  48  1MTTEEQ-SHYDAGDITVLEGLEAVRKRPGMYIGSTSERGLHHLVQEIVDNSVDEAMAGYADDIDVTILADGGVRVADNGRGMPVAMHPTEHKPTVEVILTILHAGGKFGGGGYAVAGGLHGVGSTVVNALSERLDVEVMRDGYHWTMDFRRGVP-TGELQR-GEPTEATGTIVTFWPDAEIFETTDFSYEYLRARFQQMAFLNKGLKIRLIDEREAKPREATYLYEHGLLDYVQYLNSAKKVINPDIIVFEAEEAGQTL--------SLEIAMQWTTAYSESVHTYANVINTHEGGTHEEGFRTALTSLVNAYAREQKLLREKDPNLTGDDIREGLTAVISVKVGDPQFEGQTKTKLGNSEVKGFVQRVVRDELGHWFESNPAQAKDVVRKALQASQARLAARKAREATRRKGLLETSGMPGKLKDCQSKDPDISEVFIVEGDSAGGSAVQGRNPFTQAILPLRGKILNVEKARLDRALGNNEVQAMITAFGTGIGEEFDLEKLRYHKIILMADADVDGQHITTLLLTLIFRYMKPLIEHGYVYLAMPPLYKIKWSNAHYFAYTDRERDALLTAGKAEGKAIQRYKGLGEMNYEELWETTMDPDTRLLKQVTLDDAIVADEIFTVLMGDDVDSRRRFIQENAKDVRFLDI 665
11 0.000e+00gi|548301533|ref|WP_022492739.1| dNA gyrase subunit B [Clostridium sp. CAG:628]  clstr ali  52  1MSD----NNYNENDIQVLEGLEAVRKRPGMYIGTTDVKGLHHLVWEIVDNSIDEALAGYCKNIEIIINKDNSITVKDDGRGIPVGKHPKTGISTVETVYTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSSRVTVTVYKDGKIYECKFANGGKTVQPLTIIGTCANRTGTTVTFKPDSEIFDTEIYDYETLKVRVRELAFLNRGLQLTLRDDRDEEDTQEKFLYEGGISEYVRFLNQNKTPIHDDIIHLE----------GEQDGIFFEVAMQYNNSYNDNIYSFVNNINTHDGGTHEEGVRRALTRVINNYARKTKMLKEKDDGLTQDDVKEGLTMIISCKHPNPQFEGQTKGRLGNSEVRKIADNVFAEGFERFLMEHPTDAKIIVEKAMLASRARSAAKKAREATR-KSDLTITNFFGKLTDCKSKDPTVCELFIVEGDSAGGSAKKGRDSMTQAILPLRGKILNVEKTRLDKALGNEEIKTIITAFGTGIGQDFDLEKLRYHKIIIMTDADVDGSHIRILLLTLFYRYFKPILEQGHVYAAQPPLFRVMHGKTRKYCLDEAEKDRYLASLPRNRAEIARMKGLGEMDAEELNETTMDINKRILRKISVDDAILADQIFTKLMGEEVEPRRKFIEENAGFVQNLDI 640
12 0.000e+00gi|547233118|ref|WP_021969627.1| dNA gyrase subunit B [Mycoplasma sp. CAG:956]  clstr ali  51  7.......EDYNDNDIQVLEGLEAVRKRPGMYIGTTGEAGLHHLVWEIVDNAVDEALAGYCDDIEVIVEKGNIITVRDDGRGIPTGMNKKTGLSTVETIFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTWLEVTIYRDGHIYYQKFENGGHSVEPLKIIGECDNRTGSTVRFKADPEIFETTVYNYATLAKRLQEIAFLNKGLRIILMDDREDN-KKDEFLYQGGIIEFVKMLNKNKTPIHDDVIYVE----------GREDNILIEVAMQYNDGYNEALYSYTNNIHTHEGGTHEDGVKRALTRIINNYARNNKMLSEKADPLTGDDVREGLTMIISCKHPDPQFEGQTKTKLGNMEVRKIADDVFSNGFERYLMENPEIAKKIVEKSLTASRARMAAKKARELQRQKGGLDLSNQWGKLTDCTSKNPSECEIFIVEGDSAGGSAIGGRNSKTQAVLPLRGKILNVEKARLDRALSNEEIRSMITAFGTGIGEDFDISKLRYDKIIIMTDADVDGDHIRILLLTLFYRFFRPLVETGHIYIAQPPLYKVSWGKNFHYVLTDAERDEFLKTLPNVKFDVARNKGLGEMDPEELCSTTMDINNRTLIQVKLDEAMEADGIFSLLMGEEVEPRRKFIEENAHFASNLD. 641
13 0.000e+00gi|547878764|ref|WP_022284307.1| dNA gyrase subunit B [Clostridium sp. CAG:417]  clstr ali  52  4..EEKVENKYDSSAIQVLEGLEAVRKRPGMYIGTTDVKGLHHLVWEIVDNSIDEALAGYCKNIEIVINKDNSITVKDDGRGIPVDVHPKTGISTVETVYTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSKWVEVKVYKNSKIYYIRFENGGHTVEPLKVIGTCEERTGTYVTFKPDPEIFDTDIYDYNILMTRVRELAFLNRGLRLTLRDDRDEEDTTETFMYEGGISEYVRFINQGKTPIHDDIIHLE----------GMENDVFFEVAMQYNTGYTENIYSFVNNINTHDGGTHEEGVKRALTRVINSYARKSGILKEKDDSLTGDDVKEGLTMIISCKHPNPQFEGQTKGRLGNSEVRKLADNVFSEGFEKFLLENPEEAKIIVEKAMLASRARNAAKKAREITR-KSDLTITNFFGKLSDCKSKDPKVSEIFIVEGDSAGGSAKKGRDSLTQAILPLRGKILNVEKNRLDRALGNEEIRTIITAFGTGIGDEFNLDKLRYDKIIIMTDADVDGSHIRVLLLTLFYRFFKPIVQAGHVYAAQPPLFRIMHGKTRKYVLNEEEKENYLMSLPRAKAEIARMKGLGEMDAEELNETTMDIEKRTLRKITVDDCMEADAMFSKLMGEEVEPRRKFIEDNAIYVKNLDI 645
14 0.000e+00JGI.Meta JGI_HUM.7549081 7020995338 SRS023604_Baylor_scaffold_8705__gene_15192 hypothetical protein [Human Posterior fornix microbiome from visit number 2 o  ali  50  5......ANNYDSSAIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEVVDNSVDEALAGYCDHIQVIIHPDNSVTVIDNGRGIPVDIHPKEQIPTVEVVLTILHAGGKFGGSGYKVSGGLHGVGISVVNALSKRVEVEVSRNGKRYAIAFE-GGKTVEKLHEIGTSEH-TGTKVTFWPDPTIFETCVYDYQTLQERFREMAFLTKGLHIEMIDERVLIEKTESFHFEQGLIDFVTYINEGKETLNK-PLYFSDSN----------DDGSVEVAMQWSKSYSNNVMAFANNINTAEGGTHLEGFKQGLTRTINDYARAKGLLKDKDPNLTGDDTREGLAAVISVKLHDPQFEGQTKTKLGNTEIRSLVQTAIVQKLAEFLEENPAPAKAIIDKAMQALKAREAARRARELTRRKNVLDSFALPGKLADCSSKDPSLSEIFIVEGDSAGGSAKQARDRQHQAILPLRGKILNVERAGYSRSLASETISSLITAIGTNIGEDFDADKARYHRIVIMTDADVDGAHIRCLLLTFFYRHMPELISRGYIYIAQPPIYGIKKKKIDRYIYDEKALSSTLAEYDDDKWSVQRYKGLGEMDPEQLWETTMEPATRTLLQVNIDDAAEAERAVRDLMGDKVEARREFIQEHARDVRFLDI 652
15 0.000e+00gi|545438083|ref|WP_021675829.1| DNA gyrase, B subunit [Peptostreptococcaceae bacterium oral taxon 113]  clstr ali  51  1MEDNKR--HYGAQDIQVLEGLEPVRKRPGMYIGSTGTKGFHHLVYEVVDNSIDEALAGVCDTINVIIYKDGSVSIEDNGSGIPVEIHPQTGKSTLETVLTILHAGGKFNNGAYKVSGGLHGVGVSVVNALSEKLIATVKREGKIYQQTFSEG-KPVSELENIGKTN-QTGTKIHFWPDEKIFDKLFFEWEVLELRFREMAFLNHVVTITLEDHRIN--KKEIFHYEGGIKSFVEYINRKKTPIHSKVIFFEET----------KDGVNVQVALQYNDGYSETVLTFANNIHTIEGGYHLIGFRSALTRSINDYARKFNLIKEKEQNLMGEDVREGLAAVISVKLPNPQFEGQTKGKLGNSEIQGIVQSAFNDNFSSFLEENPNVAKEIILKSLXXXXXXXXXXXXXQTIRSSNMLENTSLPGKLADCTSSDINETEIYLVEGDSAGGSAKSGRDRNFQAILPLRGKIMNVEKSRLDKILGYEEIRSMITAFGTGIGEDFNLNTLRYGKIIIMTDADVDGAHIRTLLLTFFYRYMRPLIDAGHVYIAQPPLFHIVKNKKDYYAYGDDELEDLLQKIGRTNYNVSRYKGLGEMDAEQLWETTMDPERRILLKVHVEEDITSDETFTVLMGDKVEPRRQFIEENAKYAENID. 634
16 0.000e+00gi|488936675|ref|WP_002847750.1| DNA gyrase subunit B [Ruminococcus albus]  clstr ali  50  21.SQIDKSNNYDENQIEVLEGLEPVRVRPGMYIGSTGPKGLHHLVYEIVDNAIDEALAGYCTEIIVDILPGDVIRVVDNGRGIPTGIHPKEGISAATVVYTVLHAXXXXXXXXYKVAGGLHGVGASVVNALSEYLELTVYDGSHVHFQRFDRG-QYSEAMKVIGDTDK-TGTEVKFKPDPLIFETTTFDYEVLLKRLREQAFLNAGIKIIFSDLRNEKPVTETLHYEGGIRQFVEHIHKTREPLSEDVIYI----------NGVEDDMFAEIALQYNDTYNEIILSFANNIHTPDGGSHEMAFKSALTKILNEYGKAHNLIKDNDDALMGEDCREGLTAIVSVKLTNCEFEGQTKGRLGNPEVRPFVDKMLKEKLRNYLEENPAVAKAIFDKSLQAQKAREAAKRARELTRRKSVLESASLPGKLADCSERDMTMTEIYIVEGDSAGGSAKEGRDRRYQAILPLWGKMLNVEKARIDKVYGNDKLMPVVTALGTSIGEDFDISKLRYGKVIIMADADVDGSHIRTLLLTFFFRFMRPLIEQEHVYLAQPPLFKVERAKKVRYAFTDEERDKYIAELGKLKVAVQRYKGLGEMDPEQLWETTMDPERRTMIKVTMEDAVKADEIFTILMGDKVGPRKEFIEKNAEYVRNLDV 665
17 0.000e+00gi|491410426|ref|WP_005268241.1| DNA gyrase subunit B [Arthrobacter crystallopoietes]  clstr ali  49  25.........YGAGDITVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEVVDNSVDEALAGYCDTIDVTLLADGGVRVKDNGRGIPVDLHPTEGKPTVEVVMTILHAGGKFGGGGYAVSGGLHGVGISVVNALSRRVETEIRRQGFTWHQSFADGGKPVGQLRK-GEPTEETGTMQTFWPDPEIFEITEFDFETLRARFQQMAFLNKGLKITLTDERTPEHRQVVYKYDNGLLDYVTHLNSSKDVIHPDVIAFESEDTERKL--------SLEVAMQWTSSYSESVHTYANTINTHEGGTHEEGFRAAMTSLINRYARDKNLLKEKDDNLTGDDIREGLTAVISVKLGEPQFEGQTKTKLGNSEAKGFVQRVVTDELGDWLERNPNLARDVIRKSIQASQARLAARKARESTRRKGLLESGGMPGKLKDCSSKDPSKSEIYIVEGDSAGGSAVRGRNPETQAVLPLRGKILNVERARLDRALGNAEVQAMITAFGAGIGEDFDVEKARYHKIVLMADADVDGQHITTLLLTLLFRYMRPLIEEGYVYLAQPPLYRIKWSNHHDYVYSDRERDEVVRKGLANNNGIQRYKGLGEMDYTELWDTTMDPDHRTLLQVTMEDAAAADQIFAVLMGEDVESRRSFIQQNAKDVRFLDI 688
18 0.000e+00T2D.2965346 [EC:5.99.1.3][KEGG:K02470] DNA gyrase subunit B;|[COG0187] Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit  ali  54  18.........YDASQIQVLEGLEAVRKRPGMYIGSTSSQGLHHLVWEIIDNGIDEALAGFCDEINVTVEKDNSITVQDNGRGIPVDIQKKTGRPALETVYTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELDVQVKREGNVYGIDFELG-KVKNPMKVIGQCEHEHGTRVHFCPDPDIFETTVYDIKVLTTRIRELAFLNKGLKITIEDKRPETPTREEFHYAGGIKHYVEYLNKGKEVLFDDPIYVE----------GEQRNITVEVALQYTDDFHSNLLTFTNNIHTYEGGTHESGFKTALTRVINDYARKAGILKENDDNLSGEDVREGLTAVVSIKHPDPQFEGQTKTKLGNSDARAVTDKMFSETFSKFMLENPSVAKRIVEKGMLXXXXXXXXXXXXEVTRKKNGLEISNLPGKLADNTSKDPEISELFIVEGDSAGGSAKQGRSRLTQAILPIRGKILNVEKASLDRILANEEIRSLFTALGTGFGQDFDVEKANYHKLIIMTDADVDGAHIRTLLLTLFYRFMKPMIEKGYVYIAQPPLYQVRQGKMIRYIDSDEELKEVLGSLPSPKPVVQRYKGLGEMDAEQLWETTMDPEKRRLLRVNLSDAEEANSVFEMLMGDQVGPRRQFIEDNATFVNNLDV 652
19 0.000e+00gi|501246227|ref|WP_012289245.1| DNA gyrase subunit B [Halobacterium salinarum]  clstr ali  50  1MSDQ---SEYSAGQIQVLEGLEAVQKRPAMYIGSTDARGLHHLVYEVVDNSIDEALAGYCDRIDVTLHDDGSVSVTDDGRGIPVATHEEYDRPAVEVILTVLHAGGKFDAKSYQVSGGLHGVGVSVVNALSERLAVEVSRDGARYREQFERGEPVT-DLQHVGDSD-DSGTLIRFRPDSEIFETTAYDFSTLENRLRELAFLNSGVEITLTDERGDEPTQSTFEYEGGIREFVEYLNETRNALHDDVIYF----------QGEDDGISVEIAMQASEDVQSSTHAFANNINTREGGTHLTGFKTALTRTVNDYANDNNLLSELDENLTGDDIREGLTAVISVKHPDPQFEGQTKTKLGNSEVRGIVERAVNDGLGTYFEENPATAKAVVRTXXXXXXXXXXXXXXXXLTRRKSALGSTSLPGKLADCQSKAPEDAELFVVEGDSAGGSAKQGRNPGFQAILPLGGKILNVEKHRLDRILEHDELRHIITALGTGIGDEFDIDELRYENIIMMTDADVDGAHIRTLLLTFFYRHMKPLLEAGYVYAAQPPLYRIRYRGKTYDAMTEADRERIVEEQCNGNPTVQRFKGLGEMNPQQLWDTTMDPENRILKRITVEDAAAADKMFSVLMGDAVEPRKQFIQERAGDAEWVDI 637
20 0.000e+00gi|696212509|gb|KGL51528.1| DNA gyrase subunit B [Porphyromonas canoris]  clstr ali  49  1MTEDQEAANYGASNIQVLEGLEAVRMRPAMYIGDIGEKGLHHLVYEVVDNSIDEALAGYCDKVDVEINEDNSISVHDNGRGIPVDLHEKEGKSALEVVLTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTTLRAEVKREGKVYMQEYHRGVPAD-DVKVIGEST-ETGTTIYFKPDDTIFITTEYSYKTLSDRLRELAFLNAGITLTLTDYRDGNPKKEIFYSENGLKEFVSYLDSNKEPLIDDVIHI----------VTEKQDIPVEVAMTYNTSYNENVYSYVNNINTIEGGTHLAGFRRALTRTLKKYAEESKILEKEKIDVSGDDFREGITAVISIKVAEPQFEGQTKTKLGNSEVAGAVDTAVGEALGHYLEENPKQAKMIVDKVVLXXXXXXXXXXXXEMVQRKTPMFGGGLPGKLSDCRSKDPARCELFLVEGDSAGGTAKQGRDSMFQAILPLRGKILNVEKAMPHRVLESDEIRAMYTALGVTIGTELNISKLRYNKVIIMTDADVDGSHIATLILTFFFRHMRVLVERGCIYLATPPLYQCKMGDVVEYCWDDRQRMEFIQKYAEGKVVTQRYKGLGEMDAEQLWETTMDPDNRLLKQITIDNAVEADVVFSMLMGEDVAPRRDFITANADYA-NID. 650
21 0.000e+00gi|504603327|ref|WP_014790429.1| DNA-cytosine methyltransferase [Ornithobacterium rhinotracheale]  clstr ali  50  1MNENQKQ--YTADSIQSLEGMEHVRLRPSMYIGDVGKRGLHHLVYEVVDNSIDEALAGYCSMIDVIIHEGESITVKDNGRGIPVDFHKKEGKSALEVVMTKIGAGGKFDKDSYKVSGGLHGVGVSCVNALSNKLTATVYRNGKIYQQEYARG-KALGDVQEIGETDR-TGTTVTFSPDDSIFNHTEYSFETLAARLRELSFLNKGISITLTDERNGNYLSEVFHSEGGLKEFVEFIDENREPLMQKVIFME----------GEIDDIPVEVAMRYNTSFNENLHSYVNNINTHEGGTHLTGFRRALTRTLKKYADEKMSAKEKDKSITGDDFREGLTAVVSVKVMEPQFEGQTKTKLGNSEVSGAVDKIVSEMLTNYLEENPSEAQIIVDKVVLXXXXXXXXXXXXEMVQRKSPMGGSGLPGKLADCSSKDPYESEIFLVEGDSAGGTAKQGRDRHFQAILPLRGKILNVEKAMQHKVFENEEIKNIFTALGVTIGTELNTEKLRYHKIVIMTDADVDGSHIATLILTFFFRYMKELIENGNIYIATPPLYLLKKGKQEIYAWGDKEREEIQRQMSGRGISVQRYKGLGEMNAEQLWDTTMNPENRKLRQVNIENASEADRIFSMLMGDDVPPRREFIEKNAVYA-NID. 648
22 0.000e+00T2D.3480315 [EC:5.99.1.3][KEGG:K02470] DNA gyrase subunit B;|[COG0187] Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit  ali  49  1MEENKEI--YSASNIQVLEGLEAVRKRPAMYIGDTGHKGLHHLVYEVVDNSIDEALAGFADHIEVTIGEDNSITVVDNGRGIPVDKHEKLHKSALEVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSEYLRAEICRNGKTYMQEYAYG-HPKAPVEVIGDADH-TGTKVTFLPDKTIFETTVYDFGTLANRLRDLAYLNAGIHLTLTDKREGNPKKEIFYSEEGLKEFVRYIDSNKEDLIDDIIYI----------NTERNGIPVEVAFTYNTSFNETILSFVNNINTIEGGTHLTGFRRGLTSTLKKYAEDQKMLEKVKIEIASDDFREGLTAVVSVKVLEPQFEGQTKTKLGNNEVIGSVQTAVSEALRNYLEEHPKQAKTIVEKIILAAQARHAAYNARKKVQSGSSL-SGGLPGKLAACSSKKAEECELFLVEGDSAGGSAKKGRDRKFQAILPLRGKILNVEKAMEHKIFDSEEITNIFRALGVTIGKEVNISKLRYHKIIIMTDADVDGAHIATLLMTLFFRRMRTVIENGYLYLATPPLYRCSKGDIEEYCWTDAQLNEFVQTYGKGNVKIQRYKGLGEMNADQLWDTTMDPEHRLLKQVTIDDVVKADRVFSMLMGEDVAPRREFIEENAHYA..... 643
23 0.000e+00gi|504977768|ref|WP_015164870.1| DNA gyrase subunit B [Pseudanabaena sp. PCC 7367]  clstr ali  50  1MAKTIAPETYNADNIQVLEGLEPVRKRPGMYIGSTGPKGLHHLVYEVVDNSVDEALGGYCDTILVELLADGSVAVTDNGRGIPTDVHPRTGKSALETVMTVLHAGGKFDGNSYKVSGGLHGVGVSVVNALSEWVEVSVWRQGKLHQQRYERGIP-IGNLEVTAKDKQKRGTKVCFMPDTMIFATIEFEFDILVGRLRELAYLNAGLKIEIADRRGETDKVETYQYDGGIREYVSYMTRDKEALHPEIIYI----------KGERNDIQIEVAMQWCDSYSDNVFGFANNIRTVDGGTHLEGLKTVLTRTINSTARKLKKLKDSDSNLAGENVREGLTAVISVKVPEPEFEGQTKTKLGNTEVRGTVDSFVGEVLNEFIEFNPQVASTIIEKALQSYNAAEAARRARELVRRKSVLESSTLPGKLADCSSRDPSESELFIVEGDSAGGSAKQGRDRHFQAILPLRGKVLNIERADDNKIYKNAEIQALITSIGMGIGEEFDFSQLRYHKIILLADADVDGAHIRTLLLTFFYRYQRELVEQGNIYIGCPPLYKVERGRSHQYCYSDRELQQILSSFPNANYTIQRFKGLGEMMPLQLWETTMNPETRTLKQITIEDAAEAERIFTILMGDKVAPRREFIETYGPNITDLDI 646
24 0.000e+00gi|493752632|ref|WP_006701543.1| DNA gyrase subunit B [Facklamia ignava]  clstr ali  52  1MTEE--FQNYDASQIQVLEGLEAVRKRPGMYIGTTSIEGLHHLVWEIVDNSIDEALAGYADHIEVTIEANNSITVEDNGRGIPIDIQQKTGLPAVETVYTMLHAGGKFGGGGYKVSGGLHGVGAAVVNALSTELTVEVSRNGKVYSLKFERGI-TVQELTEIGESDH-TGTRVNFIPDPAIFDTVDFKFSMLENRIRELAFLNKGLRITLEDKREEREAFSTFYYEGGIQSFVDYINEDKTPIIDEPIYI----------FGEQDDIQLEIALQYTEGYETKILSFANNIHTHEGGMHEQGFKSALTRAINDYARKQNIIKDGDDNLSGEDTREGLTAIVSVKHPNPQFEGQTKTKLGNSEVRTITERLFNENFGKFLMENPREGRAIVDKGILXXXXXXXXXXXXEMTRKKSGLEIANLPGKLADCSSRDPEKCELFIVEGDSAGGSAKQGRSRMYQAILPIRGKILNVEKATLDRILNNEEIRSLFTAMGTGFGSEFDVNKARYHKLILMTDADVDGAHIRTLLLTLIFRYMRPLIEAGYVYIAQPPLYQIRQGKKEIYLDSDDELDQWRQENPDARYSIQRYKGLGEMNYGQLWETTMNPENRRLLQVKVEDAQEADQVMDMLMGEEVEPRRIFIEENAVYVKNLDI 637
25 0.000e+00gi|701525757|emb|CEG32375.1| DNA topoisomerase IV subunit B [Bacillus simplex]  clstr ali  45  1MAKKVKTIEYNDDAIQVLEGLEAVRKRPGMYIGSTDARGLHHLVYEIVDNSVDEALAGYGDQISVKIHKDNSVSVSDKGRGMPIGMH-KLGKPTPEVILTILHAGGKFGQGGYKTSGGLHGVGASVVNALSEWLVVTIKRDGFIYEQRFFNGGKPETTLEKIGKTNQA-GTKIHFKPDPKIFSVTTFNYEILCERLRESAFLLKGMKIELTDERNDHN--EIFHYENGIEAFVDYLNEEKETLHSVV-----------SLEGEQNGIEVELAFQFNDGYSENILSFVNNVRTKDGGTHEIGAKTAMTRAFNDYARKMGLLKEKDKNLEGTDIREGLSSIISVRIPEEQFEGQTKSKLGTSEARSAVDSIVSEHLAYFFEEDPTTSTLLVKKAIKAFQAREAARKAREDARKKRKKSDAILSGKLTPAQSKNPERNELYLVEGDSAGGSAKQGRDRRFQAVLPLRGKVINTEKAKLADIFKNEEINTIIHAIGGGVGAEFNTPDTNYDKVIIMTDADTDGAHIQVLLLTFFYRYMKPLIESGKVYIALPPLYKVSKGKKEEYAWSDEELQGAIDKVG-KGYMIQRYKGLGEMNADQLWDTTMNPETRTLIRVKIDDGARAERRVTTLMGDKVEPRRKWIEANVAF...... 636
26 0.000e+00gi|647327513|ref|WP_025762405.1| DNA gyrase subunit B [Dyadobacter tibetensis]  clstr ali  49  1MSNEIVVNSYSAENIQVLEGLEAVRKRPAMYIGDTGFKGVHHLIWEVVDNSIDEAMAGYCDTIHVTIEENNSITVRDNGRGIPTGYHAKEKKSALEVVLTVLHAGGKFDKDTYKVSGGLHGVGVSCVNALSIHLRAEVHREGQIFEQEFSEG-KPLYPVRVIGETEK-TGTTIHFLPDDTIFTVTEYKYETVATRLRELSFLNKGIRLTLEDKREGKALYEEFYSEVGLKEFVRYLDATRQPLIPEPIYMENN----------KGTVPVEVSMMYNTSYSENVYSYVNNISTIEGGTHVSGFRAALTRTLKSYADKSGILTKEKIEISGDDFREGLTAVISIKVAEPQFEGQTKTKLGNSEVTGAVSQVVAEMLETYLDEHPKEARTIIDKVILXXXXXXXXXXXXEMVQRKNVLTGTGLPGKLADCSETDPKVCEIYLVEGDSAGGTAKQGRNRAFQAILPLRGKILNVEKAQEYRIYENEEIKNMFTAMGVQIGKDLNIEKLRYHKIIIMTDADIDGSHIRTLILTFFFRYMKILIDEGYIYIAQPPLYLVKKGREERYCWTEGQREQAVKEIAGAGVNVQRYKGLGEMNAEQLWQTTMNPEKRSLKQVTIESAAEADHLFSMLMGDEVAPRREFIEKNAKYAR-VDV 652
27 0.000e+00gi|653817616|ref|WP_027692772.1| DNA gyrase subunit B [Rathayibacter toxicus]  clstr ali  49  1MS-TKSSGDYGANQIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVSEIVDNAVDEALAGHCDNIEIVMRSDGGITVTDNGRGIPVDMHPTEGISTVELVLTVLHAGGKFGGGGYAVSGGLHGVGSSVVNALSTRLEVEVKRQGAIYRMSFINGVP-EAPLAKC-EASTETGTTITFWPNDEIFETVDFDYETLRSRFQQMAFLNKGLRIVLTDEKEIEPRSDVFHYEKGLVDYVDYLNSLKKAVHSEVIYFESEDTERR--------ISLEVAMQWTTAYTESVHTYANTINTHEGGTHEEGFRAALTTLVNRYARANNLLKEKDENLSGEDIREGLTAVVSIKLGEPQFEGQTKTKLGNTEAKAFVQRVTGEQLADWFDRNPSQAKDIIRKAIQAASARLAARKARETARRKGLLEGGGMPGKLKDCQSKDPSISEIFIVEGDSAGGSAVQGRNPETQAILPLRGKILNVEKARLDRALSNNEVQAMITAFGAGIGEDFTPDKARYHKIILMADADVDGQHITTLLLTLLFRYMRPLIDLGYVYLAQPPLYRLKWSNFHEYVYSDRERDALLAHGSATNNGIQRYKGLGEMDYKELWETTMDPATRTLLQVTLDDAAAADEIFSTLMGEDVESRRSFIQKNAKDVRFLDI 659
28 0.000e+00gi|496176668|ref|WP_008901175.1| DNA gyrase subunit B [Peptoniphilus duerdenii]  clstr ali  49  2....TNNRHYGAGDIQVLTGLEPVRLRPGMYIGSTGPKGLHHLIYEVVDNSIDEALQGMCDTIEVTILKDGSVSVSDNGSGIPVEKHPQTGKSTVETVLTILHAGGKFKEGAYKVSGGLHGVGVSVVNALSTKLVAEVKRNKKLYRQEFSRGVP-QTELEVVEDKEDVTGTTIIFHPDPEIFETVEFEFEVLEKRFREMAFLNKNVKIIFTDERVD--RQEIFHYEGGIKSFVEYINRKKTKIHKDVIYFEELA----------ENTQVEVAIQYTDSYSENVLTFANNINTEEGGTHLSGFRASVTRTINDYGRKYNIIKEKEENLSGDDVREGMTAIISVKIPNPQFEGQTKSKLGNSETRGIVDGVVSNGLTAYLEENPKVAKIILDKALQXXXXXXXXXXXXDLTRKRSILDSMTLPGKLKDCHESDISVNEIFLVEGDSAGGTAKDGRDSNIQAVLPLRGKIMNVEKARLDKILNSDEIKAMITAFGTGIDKEFDINNLRYGKIIIMTDADVDGAHIMTLLLTFFFRHMKPLIEHGHIYVAKPPLYGVKRGKVIRYCYDDEELESALNELGRKNYKIARYKGLGEMNAEQLWETTMNPDSRILLRVNIEDVLDADDVFSTLMGVDVEPRREFIEENAKYAENID. 636
29 0.000e+00gi|510820056|ref|WP_016193560.1| DNA gyrase subunit B [Arcticibacter svalbardensis]  clstr ali  48  1MSEQKEDKNYGAENIQVLEGLEAVRKRPAMYIGDIGIKGLHHLVYEVIDNSIDEALAGYCTDINVVILPDNSITVEDNGRGIPTGIMAKEKKSALEVVMTVLHAGGKFDKDTYKVSGGLHGVGVSCVNALSTLLVATVYRDGKIFRQEYSCG-KPLYEVKIIGDSDK-RGTTITFTPDTSIFSTNEYKFDTLAARLRELAYLNKRIRLTLTDEREGSFKKEEFYSEGGLKEFVKFLDGTRTPLIPEPIYVE----------GIKQGIPVELAMQYNETYTENVHSYVNNINTIEGGTHVAGFRRGLTRTLKSYAEKSGLLKNIKIEINGDDFREGLTAIISVKVQEPQFEGQTKTKLGNNDVMGAVDMAVGEILNNYLEENPREAKLIVGKVIIXXXXXXXXXXXXEMVQRKTVMGGSGLPGKLADCSEKDASKCELYLVEGDSAGGTAKQGRNRYFQAILPLRGKILNVEKAQEHKIYENEEIKNIFTALGVSIGDDLNIDKLRYHKVVIMTDADVDGSHITTLILTFFFRYMKELVEFGYVYIATPPLYLVKKGKEQAYAWDDTTRDAAVQRLRGAGVHVQRYKGLGEMNAEQLWETTMNPETRTLRRATIENAAECDHIFSMLMGDEVAPRRDFIEKNAKYAR-IDV 652
30 0.000e+00gi|495255637|ref|WP_007980392.1| DNA gyrase subunit B [Haladaptatus paucihalophilus]  clstr ali  50  1MSD---GNEYSAGQIQVLEGLEAVRKRPAMYIGSTDSRGLHHLVYEVVDNSIDEALAGYCDSIDVTIHEDNSVSIADDGRGIPVDRHEEYDMPALEVILTVLHAGGKFDNKSYQVSGGLHGVGISVVNALSEKFDVEVKRDGGVWKQTFERGDPA-GEMERVRDDDEETGTYQRFWPDTEIFETTDFTYSTLENRLRELAFLNSGVAITLADERDEE-KGDTFHYSGGIREFVEYLNETKTALHNEVIYFED----------EDDNIQVEVAMQATDELQGSIHAFANNINTREGGTHLTGFKTALTRVVNDYANDNDMLGDLDENLRGEDIREGLTAVISVKHPDPQFEGQTKTKLGNSEVRGIVESAVHEGLSVYFEEHPDTAQAIISXXXXXXXXXXXXXXXXXLTRRKSALESSALPGKLADCQSRDPTKSELFVVEGDSAGGSAKQARDREFQAILPLFGKVLNVEKHRLDRVLENEKIRNFITAIGTGVGEEFDIDDARYHKIIIMTDADVDGAHIRTLYLTLLYRYMRPLLEAGYVYAAQPPLYRVRYRGKTYDAMTEEERDEIIEEKCDGNPSVQRFKGLGEMNPEQLWETTMNPENRILKQITIEDAAAADKMFSVLMGDAVGPRKQFIQDHATEAEWVDI 638
31 0.000e+00gi|653227750|ref|WP_027440249.1| DNA gyrase subunit B [Lachnospiraceae bacterium AC2031]  clstr ali  50  8....EVTEEYGADQIQILEGLEAVRKRPGMYIGSTSTRGLHHLVYEIVDNSVDEALAGYCKNIQVFINEDNSITVIDDGRGIPVGIQEKTGRPAVEVVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSDWLEVEVSRDGKVYKQRYERGN-ICYDLKVVGEAE-GTGTKVTFKPDATIFDDVIYDYDTLRVRLRETAFLTKGLKITLTDLRSWEPKTESFHYEGGIKEFVTYLNRHKTAIYDKVIYCE----------GTRDNIYVEVALQHNNAYNEMVYSFVNNIITPEGGMHLTGFRSAMTKVFNDYARNNKLLKDKDDNLSGEDLREGLTAIISVKIEDPQFEGQTKQKLGNAPARTAVESLMNEQLVIFLEQNPSVAKAIVEKAVNAQRARIAARKARDASRKSYLSDGMSLPGKLADCSDKNPKNCEIYIVEGDSAGGSAKTARNRATQAILPLRGKILNVEKARIDHIMENKEIQAMITAFGTGIHENFDIEKLRYDKIIIMTDADVDGAHIATLLLTFFYRFMPDLIRQGHVYLAQPPLYRLEKNKKFWYAYSDEELASIIDEVGRDNNKVQRYKGLGEMDADQLWDTTMDPEKRILLKVSMEDESEVDLTFNVLMGDDVEPRKRFIEENAKFVKNLDI 662
32 0.000e+00gi|653187614|ref|WP_027423967.1| DNA gyrase subunit B [Lachnospiraceae bacterium AC3007]  clstr ali  51  1MS--TAEAEYGADQIQILEGLEAVRKRPGMYIGTTSSRGLHHLVYEIVDNSVDEALAGVCNNIHVWINEDNSITVEDNGRGIPVGINHKAGKSALEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLTVNVYTDGKIYEECFSRGN-ITKELTVIGECEEKHGTKVTFLPDKEIFETQVFEFNILKQRLRETAFLTKGLRIDLHDKREGQERDDFYHYEGGIKEFVKYLNKASSPLYDNVIYFE----------GMRNKIYIEVALQHNDTYNENSLSFVNNVNTPEGGMHLTGFRNAITKTFNDYSRNSKILKDNEENLTGEDIREGMTSVVSIKIEDPQFEGQTKQKLGNAEARTAVESFISEQLTYFLEQNPNIAKIICEKSVQSQRARLAARKARDLTRRKSALDGMSLPGKLADCSDPDPSHCEIFIVEGDSAGGSAKTARSRATQAILPLRGKILNVEKARLDRIYGNAEIKAMITAFGTGIHEDFDISKLRYNKIIIMTDADVDGAHIATLMLTFLYRFMPELIKQGHVYLAQPPLYKLEKNKKTWYCYSDEELAGVLDEVGRDNNKIQRYKGLGEMDADQLWETTMDPERRVLLKVVMEDEASVNVTFQTLMGDKVEPRREFIEQNAKFVKNLDV 642
33 0.000e+00gi|545656248|ref|WP_021763539.1| DNA gyrase, B subunit [Leifsonia aquatica]  clstr ali  48  1MTTEETDHEYGANEIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNSVDEALAGHADNIEVTILPDGAVRVIDNGRGIPVDEHPVQKKSTVEVVLTILHAGGKFGGGGYAVSGGLHGVGSSVVNALSSRLDIEVYRQGSVWRQSYRDGVP-QAPLEQ-GEASDRTGTTITFWPSAETFETTVFDYDTLRTRFQQMAFLNKGLRIAITDERTDTPRSEVFLYEQGLTDYVHYLNSAKEVVHDEIISFESEDTERK--------IALEVAMQWTTSYNESVFTYANTINTHEGGTHEEGFRAALTTLVNKYAREKNILKEKDDNLSGDDVREGLTAVVSVKLSEPQFEGQTKTKLGNTEAKAFVQKVVGDQLGDWFDRNPNQAKDIIRKALQAATARLAARKARETARRKGLLESGGMPGKLKDCQSKDPTVSEIFIVEGDSAGGSAVQGRNPETQAILPLRGKILNVEKARLDRALANNEVQAMITAFGAGIGEDFNPEKARYHKIVLMADADVDGQHITTLLLTLLFRYMRPLVDLGYVYLAQPPLYRLKWSNEHEYVYSDRERDAYLAEGLAAGNGVQRYKGLGEMDYKELWETTMNPESRTLLQVTLDDAAAADEIFATLMGEDVESRRSFIQKNAKDVRFLDI 673
34 0.000e+00gi|517537096|ref|WP_018707304.1| DNA topoisomerase IV subunit B [Bacillus fordii]  clstr ali  46  1MAENMTMTDYNDDSIQILEGLEAVRKRPGMYIGSTDARGLHHLVYEIVDNSVDEALAGFGDRITVKIHKDNSISVEDKGRGMPTGMH-QSGKPTTEVILTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSEWLVVTIKRDGYIYEQRFRDGGKTETTLERLGTT-RQTGTTIHFKPDPTIFSVTAFNYEVLSSRLMESAFLLKGLTIELIDLRND--QKEVFHYENGIEAFVEYLNGEKDVLHPVV-----------PIEGKSGGIEVEFAFQFNDGFSENILSFVNNVRTKDGGTHEVGAKTAITRVFNEFARKNGMLKEKDKNLEGTDIREGLAAIVSVRVPEDQFEGQTKGKLGTAEARSAVDTTVSEHLSYFLAENPSISSLLVKKAIKAAQAREAARKAREDARKRRKRSDALLSGKLTPAQSKNPNKNELYLVEGDSAGGSAKQGRDRRFQAVLPLRGKVINTEKAKLEDIFKNEEINTIIHTIGAGVGSDFNLDDVNYDKVIIMTDADTDGAHIQVLLLTFFYRYMKPLIEAGKVFIALPPLYKVSKGKKEEYAWTDEELDGVTKKVG-KGFMLQRYKGLGEMNPDQLWETTMNPETRTLIRVLIDDAASAEKRVTTLMGDKVEPRRKWIEKNVQF...... 636
35 0.000e+00gi|663304773|ref|WP_030305400.1| DNA gyrase subunit B [Streptomyces sp. NRRL F-6131]  clstr ali  49  26...EQSERSYDANAIQVLEGLDAVRKRPGMYIGSTGERGLHHLVQEIVDNSVDEAMAGHADTIDVTLLADGGVRVVDNGRGIPVGIMPGQGKPAVEVVLTVLHAGGKFGNGGYAVSGGLHGVGVSVVNALSTRLAVEIHTDGHRWTQEYKAGTP-TAPLSQH-EAAERTGTSVTFWADPDIFETTVYSFETLSRRFQEMAFLNKGLTIALTDERDGKPLSVTYKYDGGIADFVAHLNSRKDVVHPSVIDFEAEDKDKA--------ISVEIAMQWNSSYTEGVYSFANTIHTHGGGTHEEGFRAALTGLVNRYARDKKLLREKDDNLSGEDIREGLTAIISVKLGEPQFEGQTKDKLGNTEAKTFVQKVVHEHLNDWLDRNPNEAADIIRKSIQAATARVAARKARDLTRRKGLLESASLPGKLSDCQSKDPAECEIFIVEGDSAGGSAKQGRDPRIQAILPIRGKILNVEKARIDKVLQNTEVQALISAFGCGIQEDYDEAKLRYHKIVLMADADVDGQHIRTLLLTLLFRFMRPLVESGYVYLAMPPLYKIKWGKDDEYVYSDRERDAVIAAGVAKDDAIQRFKGLGEMNAEELRVTTMDQAHRLLLQVTLEDAARADELFSVLMGEDVEARRSFIQRNAKDVRFLDV 676
36 0.000e+00gi|656321876|ref|WP_029253870.1| DNA gyrase subunit B [Paraoerskovia marina]  clstr ali  50  10.AQEPHAGSYDAGNITVLEGLEAVRKRPGMYIGSTGERGLHHLVYEVVDNSVDEALAGHADTIDVALLANGGVRVSDNGRGIPVAMHPTENRPTVEVVMTILHAGGKFGGGGYAVSGGLHGVGISVVNALSEKVETVVRRDGYVWSQRFADGGVPQTGLDQ-GEATEETGTTQTFWPDGTIFETTHFDFETLRARFQQMAFLNKGLRITLTDERPGKPRVVSYKYDGGLVDYVKHLNSAKKVVHEEIIDFESEDTEKR--------ISAEIALQWTSAYSESVHTYANTISTTEGGTHEEGFRAAMTSLVNSYAREKNIIKEKDDNLTGDDIREGLTAVVSVKLGEPQFEGQTKTKLGNTEAKTFVQRIVRERLTDWFDSHPTEARDIIRKAIQASQARMAARKAREATRRKGLLESGGMPGKLRDCQSNDASLCEVYIVEGDSAGGSAVRGRNPEYQAILPIRGKILNVERARLDRALGNQEVQAIITAFGAGIGEDFDISKLRYHKIVLMADADVDGQHINTLLLTLLFRYMRPLIEGGHVYLAQPPLYRLKWSNAHDYVYSDRERDVFLAAGQAEGNGIQRYKGLGEMDYSELWDTTMDPEHRTLLQVTMDDAAAADEIFSVLMGEDVESRRGFIQRNAKDVRFLDI 683
37 0.000e+00gi|488786362|ref|WP_002698769.1| DNA gyrase subunit B [Treponema phagedenis]  clstr ali  50  2.....TNSTYSASNITVLEGLEAVRKRPGMYIGSTGPNGLHHLVYEVVDNCIDEAMAGFCDRITVVLEKNDIVRVEDNGRGIPVDIHPQEGISALEIVLTKLHAGGKFDKGSYKVSGGLHGVGVSVVNALSTWMEATVYKDGAEHYQKFEIGVP-LDSVKKISTTDK-HGTTIRWAADPAIFETTTYDFDVLATRLRELAFLNSNITIVMRDERLSTPKEATFAFEGGISHFVQYLHGTKQVLPAEPIYIEA----------EKNDIIMEIALQYNDGYNENLLSFVNDINTREGGTHLEGFKSALTRVMNEFLKKNKLIKDKEEKLTGEDVRAGLTAVISIKVPEPQFEGQTKTKLGNSDVRGIVDSFVNEKLTLFFEQNPAIIDKILEKTVSEATARIAARRAKEATRRKSGLDSFGLPGKLADCSLKDPKLCEVYIVEGDSAGGSAKKGRDSKTQAILPLWGKMLNVEKTRIDKVMNNEKLQPIIASLGTGIGKDFNIDKIRYHKIIIMADADVDGSHIRTLLLTFFFRYMPQIIEEGYVYLAMPPLYKISYNKKEWYVYNDEERDQVLKEIGKENVAVQRYKGLGEMDGTQLWETTMDPARRKMMRVTLPDAIEADRIFSTLMGEEVEPRRQFIEENAVYA-NLDV 638
38 0.000e+00gi|545384263|ref|WP_021625239.1| DNA gyrase, B subunit [Atopobium sp. oral taxon 810]  clstr ali  50  6..KNDTTNNYEATDIKILEGLEAVRKRPGMYIGTTSAAGLHHLVWEIVDNSVDEAMAGFCNKIKVTIHPDNSISVEDNGRGIPVANHPKKRMPTLEVVLTILHAGGKFDNNAYKVSGGLHGVGISVVNALSKRLVAQVKRDGGIFEMEFARG-KTTKKMEKIGKS-KATGTTITFWPDDMIFETTTYNFDTLHDRLQETAFLNKNLKIVLVDERELTPRVEEFCYAGGIVDFVKYLNNEQKVLERTPIYIEGKSDPDAPFSQKG---EVEVAIQWNQGYSEHVMSFANDIFTEEGGMHLEGFRTALTKVVNDYARSHKLLKEKDPNLQGNDLREGLTAIISVKLPDPQFEGQTKAKLGSSYMRTLTNRVVSQGMAEYLEEHPNQAKEIFKKANSAAKGRMAAQKARQATRRKGLLESASLPGKLADCSVRDAEMTELFIVEGDSAGGSAKSARDRSIQAVLPLRGKILNVERVQEHRALSSETIQSLITAIGTGVPPEFDISKARYHKIVIMTDADVDGAHIRILLLTFFYRFMRPMIDAGYIYVAQPPLYQLKKGKKHKYIYTDEELALEASKFEDARYTVQRYKGLGEMDPEQLWITTMDPKNRILLKVTIEDGMAAERAVAELMGTQVEKRKDFIQTHAKDVRFLDI 653
39 0.000e+00gi|548257208|ref|WP_022474640.1| dNA gyrase subunit B [Ruminococcus sp. CAG:353]  clstr ali  50  1MSDIQNENAYDESQIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNAIDEALAGYCTEITVNILKGDIIEVTDNGRGIPTGIHPKEGISAATVVYTILHAGGKFGGGGYKVAGGLHGVGASVVNALSEWLELTVKDGKHIHFQRFHNGGHYDEPLKIIGDTT-ETGTSVKFKADPEIFETTVYDYEVLLKRLREQAFLNAGVRIVFSDLRDDNIQSEILHYEGGIRQFVEHIHKVKDPLSDKVIYV----------SGSKGDSTAEIALQWNDSYNEDIRSFANNIHTVDGGTHETGFKNALTKVINEYGKKFNLIKDNADKLIGDDVREGLTAIISVKLTNCEFEGQTKGRLGNPEVRPLVEDIVTEKLMCYLEENPEQARLVFDKAVNAQKAREAAKKARETARRKSAMDSASLPGKLSDCYDKDNTLTELYIVEGDSAGGSAKLGRNARYQAILPLWGKMLNVEKARIDKVYGNEKLMPVVAALGTSIGEDFNIEKLRYGKIIIMADADVDGSHIRTLLLTFFFRYMRPLITNGNIYIAQPPLFKVKKGKREKYAFSDEERDMYISELGDGKLNVQRYKGLGEMDPEQLWETTMNPETRTMLRVELEDAAKADEIFTILMGDKVEPRRDFIEKNAKYVQNLDI 656
40 0.000e+00gi|494376147|ref|WP_007200848.1| DNA topoisomerase IV subunit B [Fictibacillus macauensis]  clstr ali  46  4....KTKVEYNDDAIQVLEGLEAVRKRPGMYIGSTDSRGLHHLVYEIVDNAVDEALGGFGNHIAVTIHKDQSVSVKDEGRGMPTGMHS-LGKPTPEVILTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSEWLEVIIHRDGHIYKQRFERGGQPVTTLEAIG-TSKKTGTTIHFKPDATIFSTTNFNFETLSERLREAAFLLKGVIIELRDLRSG--QHETYQYESGLTAFVSYLNEDKDVLHP-VVSFE----------GTQNEIEVDFAFQFNDGYSENVLSFVNNVRTKDGGTHESGAKTAITRITNDYARKIGLLKEKDKNLDGSDIREGLTAVVSVRIPEEQFEGQTKSKLGSSDARSSVDSVVSGNLSYFLEENPQTSEMLIKKAVKAAQAREAARKAREDARKKNKRKDTVLSGKLTPATSRNPAKNELYLVEGDSAGGSAKQGRDRRFQAVLPLRGKVINTEKAKLADIFKNEEINTIIHALGAGVGSDFAVKDLNYDKIVIMTDADTDGAHIQVLLLTFFYRYMKPLLESGKVYIALPPLYKVSKGKKEEYAWDDSELQQAMKKVG-KGYIIQRYKGLGEMNADQLWETTMDPETRTLIRVKIDDAARAEKRISVLMGDKVEPRRKWIEEHVQFGLN... 638
41 0.000e+00gi|684288556|gb|KGA08218.1| hypothetical protein GM45_6205 [actinobacterium acAMD-5]  clstr ali  49  2........SYDASAIQVLEGLDAVRKRPGMYIGSTGERGLHHLVYEVVDNSVDEALAGHCTHIEVTILSDGGVRVVDNGRGIPVDIVPSEGKPAVEVVLTVLHAGGKFGGGGYAVSGGLHGVGVSVVNALSKKVDVEVGREGFTHTQSYKYGVPV-APLKK-GKKVSTTGTTITFWADGDIFETTVYDFETLSRRFQEMAFLNRGLTLSLTDERPATPRHVSYMYEGGITDFVKYLNTRKTPVHNDIVEF--------FLEDSKRGLSLEVAMQWNSTYSESVHTFANTINTVEGGTHEEGFRTALTSLVNKFAREWNILKEKDTNLSGEDVREGLTAIVSIKLHEPQFEGQTKTKLGNTEAKTFVQKVVNEELAAWFEKNPAQGKDIARKSLQAATARLAARKARDLARRKGLLGSSSLPGKLKDCSSNQPAECEVYIVEGDSAGGSAGQGRDPRTQAILPIRGKILNVEKTRIDRVLANTEVQAIISAFGTGIQDEFDINKLRYHKLILMADADVDGQHIRTLLLTFLFRYMRPLVDGGFIYLAQPPLYKVKWSREAPYAYSDRQRDELIETGLTAGEDVQRYKGLGEMNADELWETTMNPATRVLLQVSVDDAAQADQLFSTLMGEDVESRRNFIQRNAHDVRFLDI 655
42 0.000e+00gi|503143708|ref|WP_013378369.1| DNA gyrase subunit B [Eubacterium limosum]  clstr ali  52  1MSDNNEKNDYTADQIQVLEGLEAVQKRPGMYIGSTGKQGLHHLVYEVVDNSIDEALAGYCKNIVVTIDKNNGITVVDDGRGIPTDMNHKMKKTGVELALTVLHAGGKFGGGGYKVSGGLHGVGVSVVNALSSELTVEVKQNKKIYHQTFAKG-KKTSELEVTGNTNRTG-TTVHFQPDPDIFDELVYDFDVLEHRLRELAFLNKGVSITLADEREAEKRKETYCYEGGIRSYIEYMNKNKDPLYEQIAYYEK----------EMDDYSLEIAFQYTAGYSENIYSYANNIYTPEGGSHLNGFKSALTRTINTYARKNNYIKGNDKNLTGEDVREGLTAIISIKLLDPQFEGQTKTKLGNPEVKGIVETIVGDELSAFLEENPTIAKTVIEKTLSASRAREAAKKARELTRRKSALDTTALPGKLADCREKDPSMSEIFIVEGDSAGGSAKSGRDSRIQAILPLRGKILNVEKSRLDRILTADTLKSMITAFGTGVGEDFNVEKARYHKIIIMTDADVDGAHIRTLLLTFFYRYMRGLIEEGYVYIAQPPLFKVARGQHVEYVYNEKALDKMFEDKDRSKYTIQRYKGLGEMDAHQLWETTMDPSVRILNRVNIEDAAYADEVFTILMGDKVQPRKEFIERNAAKVKNLDI 640
43 0.000e+00gi|516845264|ref|WP_018128035.1| hypothetical protein [Balneola vulgaris]  clstr ali  50  1MA-NKKSADYKASNIQVLEGLEAVRKRPAMYIGDTGQRGLHHLINEVVDNSIDEALAGHCDHIIVQINNDGSMTIQDNGRGIPVDMHPKLGLPAVEVVLTKLHAGGKFDKDTYKVSGGLHGVGVSCVNALSTSFNAEIHRDGEIHRMGFEKGI-TTTALTTDGKTDK-TGTIITFTPDPEIFTTVEFKFNIIAERMRELAFLNPQVTIELIDEREEDEDKEVYHYEGGVRDFVKYLDESRESHMPEPIYIE----------GEVEGVPVEMAMQYNSTYAENVHSYVNNINTREGGSHVSGFRRALTRSLKTYAEKNKIIKSNKISISGEDFREGLTAVLSVKVAEPQFEGQTKTKLGNSEVQSAVEVTVYDQLNEYLEQNPKTAKKIIEKVVLXXXXXXXXXXXXQLVQRKSVMSGGGLPGKLADCSIKDPEHCEVYLVEGDSAGGSAKMGRNRSFQAILPLRGKILNVEKAKINKILENKEIQAMITALGTGVGEDFDVDKLRYHKIIIMTDADVDGSHIRTLLLTFFYRYMRPLIDNGHMYIATPPLYRITAGKNIEYAWDDDTRDKLVKELGRRKFDVSRYKGLGEMNPEQLWETTMDPETRTLQQVTVESAAGADKMFSTLMGDEVAPRREFIERNAKYAK-IDI 645
44 0.000e+00gi|339891873|gb|EGQ80794.1| DNA topoisomerase (ATP-hydrolyzing) subunit B [Fusobacterium nucleatum subsp. animalis ATCC 51191]  clstr ali  51  6........SYEAQNITVLEGLEAVRKRPGMYIGTTSERGLHHLVWEIVDNSVDEALAGYCDKIEVKILPDNIIEVVDNGRGIPTDIHPKYGKSALEIVLTVLHAGGKFENDNYKVSGGLHGVGVSVVNALSEWLEVEVRKNGTVHYQKYHRG-KPEEDVKVIGTCDEEHGTTVRFKADGEIFETLVYNYFTLSNRLKELAYLNKGLTIILSDLRKDEKKEEIYKFDGGILDFLNEIVKDETTIIEKPFFVSA----------EQDNVGVDVTFTYTTSQNEVIYSFVNDINTHEGGTHVQGFRTALTKVINDVGKAQGLLKDKDGKLMGNDIREGVVGIISTKIPQPQFEGQTKGKLGNSEVSGIVNTVVSNSLKIFLEDNPNITKIIIEKILNSKKAREAAQKARELVLRKSVLEVGSLPGKLADCTSKKAEECEIFIVEGDSAGGSAKQGRDRYNQAILPLRGKIINVEKAGLHKSLESSEIRAMVTAFGTSIGETFDISKLRYGKIILMTDADVDGAHIRTLILTFLYRHMIDLIYGGNVYIACPPLYKVAAGKQIIYAYNDLELKNILGQMNNKKYTIQRYKGLGEMNPEQLWETTMNPDGRLLLKVSIDNAREADMLFDKLMGDKVEPRREFIEEHAEYVKNIDI 639
45 0.000e+00gi|499368916|ref|WP_011056494.1| DNA gyrase subunit B [Thermosynechococcus elongatus]  clstr ali  49  2......TAEYSSAQLRVLKGLEPVRTRPGMYIGSTGPKGLHHLVYEVVDNSVDEALAGYCSTILVQINADGSVTVTDDGRGIPTDIHPDTGVSGVETVMTVLHAGGKFGDGGYKVSGGLHGVGVSVVNALSEWLEVTVWRNGFVHHQRYERGVP-TTPLEKTPDTEERRGTSVTFFPDRQIFETIEFDAKVLMTRLRELAYLNAGIRIEFKDLRVTPPLSETYCYEGGIREYVRYMVQEKEPLHPEIIYI----------QGEKDDVQVEAALQWCDAYSENLLGFANNIRTIDGGTHMEGLKAVLTRTLNALGRKRNKLKENNANLAGENIREGLTAIISVKVPNPEFEGQTKTKLGNTEVRGIVDAIVGAALTEYLDFHPNVTDTILEKAIQAFNAAEAARRAREMVRRKSVLESSTLPGKLADCSSRDPAVSEIFIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIEKTDDAKIYKNNEVQSLITALGLGVGEEFDPAKLRYHKIILMTDADVDGSHIRTLLLTFFYRYQQELVNQGFVYIACPPLYKVERGRQHFYCYSDRELQQQIASFPNANYTIQRFKGLGEMMPEQLWETTMNPETRILKRVEIEDAAEADRIFTILMGDRVAPRREFIETYGPQLENLDI 640
46 0.000e+00gi|505453314|ref|WP_015640416.1| DNA topoisomerase IV subunit B [Lactobacillus plantarum]  clstr ali  46  1MRMAKKSPKYDDSSIQVLEGLEAVRKRPGMYIGSTDGRGLHHLVYEIVDNAVDEALAGYGKEINVIIHADNSITVVDHGRGMPVGMHA-SGIPTPEVILTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSSELTVTIVRDGYRYVEHFKDGGHPVGTLEKKGKTNKPTGTTMTFKPDASIFTTTVYNFQTLAERLRESAFLLKGVKITLTDERENQQQELVFHYEDGIKAFVSYLNEDKDTL-GDIMFFD----------GTKEGVEVEVAAQYNDGYSENLLSFVNNVRTPDGGTHEVGFRSAWTKAFNEYARKVGLLKDKDKNLEGSDVREGLSAVISLRVPENQFEGQTKEKLGTPEARTIVDNIVSEQLQFFLMENGEFAQMLIRKSTKARQAREAARKARDESRKRRHKQERLLSGKLTPAQSKNAKKNELFLVEGDSAGGSAKQGRDRKFQAILPLRGKVLNTEKAKLADIVKNEEINTMIYTIGAGVGPEFDIKASNYDKIIIMTDADTDGAHIQILLLTFFYKYMRPMIDAGKIYIALPPLYRLQKKQNTEYAWTDEELTLKTKSFG-KGYALQRYKGLGEMNAEQLWETTMDPEKRTLVRVRIDDAALAEKRVTTLMGDKVEPRRKWIESNVHF--NLD. 642
47 0.000e+00gi|671602283|ref|WP_031575604.1| DNA gyrase subunit B [Proteiniclasticum ruminis]  clstr ali  51  6.SNTKVEEAYGDSNIQVLEGLEAVRKRPGMYIGSTSSRGLHHLVYEIVDNSIDEALAGYCTHIEVTIHKNNSITVVDDGRGMPIGMNEKLGKSTVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSETCVVEIRRNNKIYRQKFEFGNP-IGGLEEIGVSEH-TGTTTTFLPDKTIFDEVEYDFEILSERLRELAFLNKGLRISLTDXXXXXXXXXSYFYEGGIKSFVEYLNRNKEVLHKEVVYIED----------MKDEYIVEVAMQFNDSYNENIFSYANNIDTIEGGTHLDGFKRALTRVVNDYGRRFGHLKENDKNLSGDDIREGLTAVVSVKLIDPQFEGQTKTKLGNAEVRSIVDNIVGGALSITLEENPAIGKIVIDKALMXXXXXXXXXXXXXLTR-KSVLERTTLPGKLADCASKDPLESEIYIVEGDSAGGSAKQGRNRQFQAILPLRGKIMNVEKARLDKMLGSDTIRSMITAFGAGIGKDFDTTKLRYSRIIIMTDADVDGAHIRTLLLTFFYRYMRELIEKGHVYIAQPPLYKITKGKNMQYAYSDKEMEEIVESMGGKDSSIQRYKGLGEMNASQLWETTMDPEHRILLRADIEDAKSADEIFTILMGDKVEPRREFIEKNAKLVDNLDV 646
48 0.000e+00gi|515771257|ref|WP_017203857.1| DNA gyrase subunit B [Microbacterium barkeri]  clstr ali  48  33.AKKKQPGEYGADSIQILEGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNSVDEALAGYADTILVTMLADGGVRVVDNGRGIPVDPHSSDNKSTVEVVLTILHAGGKFGGGAYAVSGGLHGVGSSVVNALSTRFDVEVKQKGFVWRHSFADGGIPQQKLEK-GEETDETGTSITFWPDAQIFETIEFDYDTLRTRFQQMAFLNKGLRIELKDERESSAYEDVFFYERGLVDYVEYLNKVREVVNDEIIAFESEDTERK--------ISLEVAMQWTTSYTENVFTYANTINTHEGGTHEEGFRAALTTLVNKYARANNLLKEKDDNLSGDDVREGLTAVISIKLGEPQFEGQTKTKLGNTEAKAFVQKVVGDQLGDWFDRNPNQAKNVIRKAIDAATARLAARKARETARRKSVFESAAMPDKLKDCTSKDPSISEIFLVEGDSAGGSAVQGRDPHTQAILALRGKILNVERARLDKALGNKEVQAMIQAFGTGIGEEFDIEKARYHKIVLMADADVDGQHITTLLLTLLFRYMRGLIEAGFVYLAMPPLYRLKWSNSHEYVFSDAERDALLKHGLDSGAGIQRYKGLGEMNPKELWETTMDHTTRTLQQITIEDAAAADEIFSVLMGEDVESRRSFIQRNAKDVRFLDI 696
49 0.000e+00gi|589844060|gb|EXJ24299.1| DNA gyrase subunit B [Alkalibacterium sp. AK22]  clstr ali  53  1MADEQLTEEYDASQIQVLEGLEAVRKRPGMYIGSTSSEGLHHLVWEIVDNSIDEAMAGHAESIEVIIEPGNVIVVKDDGRGIPIDIQAKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSEYLEVDVHKNGKIYNQRYERGA-VMYDLKEIGTTD-LSGTEVRFKADDEIFETTVYDFNKLATRVRELAFLNRGLAISIEDRREEEPVRLDYQYDGGIKSYVEYLNQSKTALYDEPIYLED----------EQEGITVEVALQHTDGYHMNIMSFANNIHTYEGGMHESGFKTALTRIVNDYGRRNKLIKENEDNVTGEDVREGLTVVLSIKHPDPQFEGQTKTKLGNSEVRTITDRLFSEHFDRFLMENPKTSKKIVDKALLXXXXXXXXXXXXEVTRKKSGLEISNLPGKLADCSSKDPSQSEIFIVEGDSAGGSAKQGRSRLFQAILPIRGKILNVEKASIDRILANEEIRSLFTAMGTGFGEEFQIDKARYHKLIIMTDADVDGAHIRTLLLTLIFRYMRPVVEAGFVYIAQPPLYQVKQGKKEVYLDSDRELDEYLKEIPAPKPSIQRYKGLGEMDAEQLWSTTMNPENRRLLQVTVEDAIEADLVFDMLMGEKVEPRRDFIEDNAQYVENIDI 648
50 0.000e+00gi|652825058|ref|WP_027111758.1| DNA gyrase subunit B [Lachnospiraceae bacterium NK4A179]  clstr ali  51  2...............QILEGLEAVRKRPGMYIGTTSERGLHHLVYEIVDNSVDEALAGYCKNIFVDINPGNYITVTDDGRGIPVGINHKAGKPAVEVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTWLEVDIYHEGQIYNQRYERG-KVCYPLKVVGKCDDKTGTKVTFQPDPEIFDSTVYDFDTLKKRMREMAFLTKGLNITLTDKRDGGDRVESFYYEGGIKEYVKYLNEGSSALYDKIMYFE----------GKKEGVYVEVAMQHNNGFNEIINGFVNNINTPEGGMHVEGLKTSLTRIFNDYGRKNEILKKNEANLSGDDVREGLTAIISVKIEDPQFEGQTKQKLGNSIARTAVSGIVSEQLTYFLEQNPDIAKKIIDKAVTAQRAKEAARRAIEATRRKTPLDGAALPGKLADCSDKDPKNCEIFIVEGDSAGGSAKSARSRATQAILPLRGKILNVQKARPDKVFANAEIKAMIKAFGTGIDEEFDISKLRYNKIIIMTDADVDGAHIATLMLTFLYRYMPELIRQGHVFLAQPPLYKLEKNKKVWYAYSDEELASIINEVGRDNNKIQRYKGLGEMDAEQLWETTMDPEHRILLRVGMDDASELDLTFSTLMGDEVEPRREFIEANAKYVQNLDI 642
51 0.000e+00gi|514416481|ref|WP_016564300.1| dNA gyrase subunit B [Bacteroides sp. CAG:927]  clstr ali  48  1MAE--KEEEYSASNITVLEGLEAVRKRPAMYIGDISEKGLHHLVYEVVDNSIDEALAGFAKDIEVTINADNSVTVVDDGRGIPVDMHEKEHKSALEVVLTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTYLRAEVRRDGKVYMQEYSCG-KATSELKVIGESD-TTGTSITFLPDSSIFTVTVYDYNILANRLRDLAFLNAGITLRLTDMREGEPRSETFYSQNGLREFVEYIDSNKESLIDDVIHL----------NTERGGIPVEVALTYNNTYNENVYSFVNNINTIEGGTHLTGFRRGLTLTLKKYGDDNKMFEKEKVTVDASDFREGLTAVVSVKVLEPQFEGQTKTKLGNNEAIGAVQTAVSEALGNYLEEHPREAKAIVSKVIVAAKARHAARNARDKVLRKSPLSGGGLPGKLADCSSRHAEDCELFLVEGDSAGGTAKQGRDRTFQAILPLRGKILNVEKAMEHRIFDNQEITNLFKAMRVTVGKEVNISKLAYHKIIIMTDADVDGAHIATLLMTFFFRRMRPIIENGYLYLATPPLYKCMRGKNEEYCWTDAQVQQFIAKYGD-KTKVQRYKGLGEMSAEELRDTTMSPEKRLLKQVHISDAAEADRIFSMLMGEDVEPRRDFIESNANYA-NID. 642
52 0.000e+00T2D.4006920 [EC:5.99.1.3][KEGG:K02470] DNA gyrase subunit B;|[COG0187] Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit  ali  50  21...TKTNQEYGASEIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNSIDEALAGYCDKIDVSILPGNVIRVKDNGRGIPVGIQPKMGIPAVTVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVKVCDGENIYRQRYERGN-IASDLEIIGKGTTK-GTEITFKADPLIFTETVYEYEVLETRLREQSFLNAGIHIELRDERDENILQNNFLYEGGVSNFVEYIHKKRDVIHPDVIHFEGKMDD--------DSASVEIAMQYNDSYNELILSFANNIHTTDGGTHEEGFKRALTKVMNDYARKFNILKENDKNLSGEDVREGLTAIISVKLKEAQFEGQTKAKLGSTFVRGLVDKLVTEKLSVYLEENPATAKAIFDKALMXXXXXXXXXXXXXLARRKTAMEGAGLPGKLADCQSRNAEETEIYIVEGDSAGGSAKGGRDRRFQAILPLWGKMLNVEKARLDRVYGNDKLMPVITALGCGIGDDFDITKLRYGKVIIMADADVDGSHIRTLLLTFFFRFMRPLIEEGHIYLAQPPLYRLTKNKEHHYAYSDPERDKIMAELG--KADIQRYKGLGEMDSEQLWETTMNPETRIMLRVDMEDAALADETFTILMGDKVEPRREFIEKNAKYVQNLDI 659
53 0.000e+00JGI.Meta JGI_HUM.0433527 7058149693 SRS049959_WUGC_scaffold_413__gene_644 DNA gyrase, B subunit [Human Stool microbiome from visit number 1 of subject 76570  ali  52  1MAE-----HYDASDIQVLEGLEAVRKRPGMYIGTTDVKGLHHLVWEIVDNSIDEALAGYCKNIEVIVNKDNSITVKDDGRGIPVDIHPKTGLSTVETVYTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSSWVEVKVFKNGKIYFIRFEKGGHTVEKLHEIGDCENRTGTTVTFKPDPEIFDTTIYDYETLKVRIRELAFLNRGLRITLRDDRDEEDTTDTFLYEGGISEYVKFINQNKTPIHDDIIHLE----------GQDSGVFFEVALQYNDGYSDNIYSFVNNINTHDGGTHEEGVRRALTRVINNYARKANLLKEKDESLTGDDVKEGLTMIISCKHPNPQFEGQTKGRLGNSEVRKLADNVFSEGFEKFLLENPADAKIIVEKAMLACRARNAAKKAREITR-KTDLAVTNFFGKLCDCKSKDPNECEIFIVEGDSAGGSAKKSRDSLRQAILPLRGKILNVEKNRLDKALNNEEIRSIITAFGTGIGEEFNLDKLRYNKIIIMTDADVDGAHIRILLLTLFYRFFRPIVEAGHVYAAQPPLFRIRYGKTRKYVLDEKERDAYLNSLPRNRVEITRMKGLGEMDPEELNETTMDIEKRTLRKIVVEDCMMADEIFSKLMGDEVEPRRTFIEENAINVQNLDI 639
54 0.000e+00JGI.Meta JGI_HUM.3935695 7052613006 SRS015264_WUGC_scaffold_52168__gene_112582 DNA gyrase, B subunit [Human Stool microbiome from visit number 1 of subject  ali  50  2......SAEYNESQIQVLEGLEAVRKRPGMYIGSTSEKGLHHLVYEIVDNAVDEALAGFCTEITVTIHPDNSISVLDNGRGIPVGIHHQKGISALEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSTWLYVNVYTDGKIYEQKYERGN-VLCPVHEIGTTDK-HGTFVHFLPDPEIFEETVFTYDVLKQRLRETAFLTKGLKINLIDLREGKEQERSFHYEGGIKEFVAYINKSRQPLYDNIFY----------ASGEKDGVLVEVAFQHNDGYTENIFTFVNNINTPDGGTHLVGFKSGLTKTINDYGKKIGIIKDSDKKLSGDDVREGMTAVVSIKVGDPQFEGQTKAKLGTSEAKGAVEAVLSEYLTYFLEENPAVGKIIIEKGLMASRARDAARKARELVRRKTGLENTRMPGKLTDCTSRDPYECEIYIVEGNSAGGSAIKARDPKTQAILPLRGKILNVEKARLDRILNSEEIRNMITAFGTGISEDFDIEKLRYHKIVIMTDADVDGAHIRTLLLTFFYRYMPQLIEEGKVYIAQPPLYRVEKNKKHYYVYDDAQLEELYKEIGRDNIDVQRYKGLGEMDYDQLRDTTMAVEHRILKKVDISDALLADEIFSMLMGDSVEPRREFIEENAQYAE.... 630
55 0.000e+00JGI.Meta JGI_HUM.8002287 7079414920 SRS014343_WUGC_scaffold_855__gene_1816 hypothetical protein [Human Posterior fornix microbiome from visit number 1 of su  ali  50  8.TKAELASEYDASQIQVLKGLDAVRKRPGMYIGSTSAQGLHHLVWEIVDNGIDEALAGFCDEINVVVEPDNSISVTDNGRGIPVDTQKETGKPALETVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELDVKVSRQGKRYYMDFDHG-HVKTSMKVIDEPEDVHGTTVHFKPDPEIFETTTYNIKTLTNRLRELAFLNKGLKITIEDKRDKESERQEFHYEGGIRHYVDFLNEGKTTLFEPPIYVE----------GKENGITVEVSLQYTDSYRSDLLTFTNNIHTYEGGTHETGFKMALTRVINDYGHKSGVLKGNE-TLSGDDVREGLTAVVSIKHPDPQFEGQTKTKLGNSDARTATDHVFAATFNRFLLEHPDEARQIIEKGQLASKARVAAKRAREVTRKKSGLEISNLPGKLADNTSKDPNISELFIVEGDSAGGSAKQGRSRLTQAILPIRGKILNVEKATLDRILANDEIRSLFTALGTGFGEDFDITKANYHKLIIMTDADVDGAHIRTLLLTLFYRFMKPMITHGYVYIAQPPLYQVRQGKFVKYIESDEELDRVVNSLPSPKPVIQRYKGLGEMDAEQLWETTMDPEKRHLLRVNLDDAKAAEEIFPMLMGNKVTPRRDFIEKNAKFVENLDL 648
56 0.000e+00gi|512503636|ref|WP_016437049.1| DNA gyrase subunit B [Streptomyces sp. HGB0020]  clstr ali  47  51.SNGEVTASYDASAITVLEGLDAVRKRPGMYIGSTGERGLHHLVYEVVDNSVDEALAGHADTIDVTILADGGVRVVDNGRGIPVGIVASEGKPALEVVLTVLHAGGKFGGGGYAVSGGLHGVGVSVVNALSAKVAVEVKTDGHRWTQDYKMGVP-TAPLAQH-EATDVTGTAVTFWADPDIFETTEYSFETLSRRFQEMAFLNKGLTIKLTDEREDEVKTVTYHYEGGIVDFVKYLNSRKDVVHNTVIDLEAEDKDKSL--------SLEVAMQWNSGYSEGVYSFANIIHTHEGGTHEEGFRAALTSLINKYARDKKLLREKDDNLTGDDIREGLTAIISVKLSEPQFEGQTKTKLGNTEAKTFVQKAVYEHLNDWLDRNPVEAADIVRKGIQAATARVAARKARDLTRRKGLLETASLPGKLSDCQSNDPTKCEIFIVEGDSAGGSAKSGRNPQYQAILPIRGKILNVEKARIDKILQNQEIQALISAFGTGVHEDFDIEKLRYHKIILMADADVDGQHINTLLLTFLFRFMRPLVEAGHVFLSRPPLYKIKWGREVEYAYSDRERDALLEMGRQRGDSIQRFKGLGEMNAEELRVTTMDQEHRVLGQVTLDDAAQADDLFSVLMGEDVEARRQFIQRNAKDVRFLDI 712
57 0.000e+00gi|631783399|dbj|BAO74686.1| DNA gyrase subunit B [Winogradskyella sp. PG-2]  clstr ali  48  1MSEEKKEHGYSADSIQALEGMEHVRMRPSMYIGDVGVRGLHHLVYEVVDNSIDEALAGHCDNITVTINEDNSITTEDDGRGIPVGLHKKEGVSALEVVMTKIGAGGKFDKDSYKVSGGLHGVGVSCVNALSEHLKATVFREGKVYEQEYERG-KAMYPVKQTGDTDK-RGTTVTFKPDSTIFTTLEYNYDTLASRMRELAYLNKGITVHLVDKRDGTFEGETFHSKEGLKEFIKFLDATRDPLMSDVIAFE----------GEKNGVPVEVAMIYNTSYAENLHSYVNNINTHEGGTHLSGFRRGLTHTLKKFADSSGMLDKLKFDVAGDDFREGLTAIISVKVQEPQFEGQTKTKLGNREVSAAVSQSVSEMLTDYLEEHPDDAKTIVQKVILAAQARHAAQKAREMVQRKTVMSIGGLPGKLSDCSEQDPEKCEIYLVEGDSAGGTAKMGRDRAFQAILPLRGKILNVEKAMSHKVFENEEIKNIFTALGVTIGTELNLSKLRYHKIVIMCDADIDGSHIETLILTFFFRYMKELIENGHVYIATPPLYLVKKGAKKEYAWNDEERLALMEQYGD-GAKIQRYKGLGEMNAVQLWDTTMNPEFRTLRQIQVDNGVEADRVFSMLMGDEVPPRREFIEKNAIYA-NID. 649
58 0.000e+00gi|497968012|ref|WP_010282168.1| DNA topoisomerase IV subunit B [Bacillus timonensis]  clstr ali  46  3....KQQFEYNDDAIQVLEGLEAVRKRPGMYIGSTDSKGLHHLVYEIVDNSVDEALSGYGNHIIVKIHKDNSISVQDKGRGMPTGMH-KMGKPTPEVIFTVLHAGGKFGQGGYKASGGLHGVGASVVNALSEWLTVTIKRNGFVYEQRFENGGKPATTLENKGKTN-QTGTTIHFKPDPTIFNTTTFNFEILSERLRESAFLLKGLKIEILDERNGF--HEVYHYENGLEAFVQYLNEEKDVLHP-VVSFE----------GIQNRIEVDFAFQFNDGYSENILSFVNNVRTKDGGTHEVGSKTALTRAFNEYARKTGQLKEKDKNLDGSDIREGLTAIVSVRIPEEQFEGQTKGKLGTSEARSAVDSVVSENLAYFLEENPDVSTLLVKKAIKASQARDAARKAREEARKKRKKSETLLSGKLTPAQSRNPEKNELYLVEGDSAGGSAKQGRDRRFQAVLPLRGKVINTEKAKLADIFKNEEINTIIHTIGGGVGADFTVEDINYDKIVIMTDADTDGAHIQVLLLTFFYRYMKPLIEAGKVYIALPPLYKVSKGKKEEYAWDDSELQSAINKIG-KGYIIQRYKGLGEMNADQLWDTTMNPETRTLIRVRIDDGARAERRITTLMGDKVEPRRKWIETNVAF...... 634
59 0.000e+00gi|547591860|ref|WP_022114910.1| dNA gyrase subunit B [Clostridium sp. CAG:524]  clstr ali  53  2......KEEYGVNEIQVLEGLEAVRKRPGMYIGTTGERGLHHLVWEIVDNSVDEALAGFCDDIEIIVHEDNSVSVRDDGRGMPTGVHPKTGVSTVETIFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVKVYRDGKIYHQRFEKGGHPVKPLEIIGDCDNRTGTTVTFKPDPQIFETTEFNYETLKSRSRELAFLNKGLRIILSDLRTGA--KDEFLYNGGLREYVELLNTNKKPIHNDIVHVE----------GEEDNISIEVAMQYNDGYSSNIYSFTNNIHTVEGGTHEDGVRLALSRVINNYARANGILKEKDDSLTQDDVKEGITLVISCKHPNPQFEGQTKTKLGNVEVRKIASNIFGAGLEKFLLENPDQARAIIDKVMLASRARVAAKKARELTRRKGDLEITNFYGKLTDCKSKDPSESEIFLVEGDSAGGSAKKGRDYMTQAILPLRGKILNVEKARLDRALSNEEIRTIVTAFGTGIGEEFDLSKLRYHKIIIMTDADVDGSHIRILLLTLFYRFFKPVVEHGHVYAANPPLYKIVYGKNIKYVLSDDEKDEYVKTLPNAKYTITRMKGLGEMDADELRDTTMSKEFRILRQITVDDIMAADEIFTTLMGEEVEPRRKFIEENALDVENLDI 636
60 0.000e+00gi|503151807|ref|WP_013386468.1| DNA gyrase subunit B [Ilyobacter polytropus]  clstr ali  52  2.......SNYQAENITVLEGLEAVRKRPGMYIGSTSARGLHHLVWEIVDNSVDESLAGYCNKIEIKVLKDNIIEVSDNGRGIPVGIHPKHGKSALEIVLTVLHAGGKFENSNYKVSGGLHGVGVSVVNALSEWTEVFVKRDGKIHNQRYNRGVP-EFDVKVVGKTN-ETGTTVRFKADSEIFETLEYDFDVLKSRLKEMAYLNKGLEIVLIDERKEEIKEEILKFDGGIVDFIKEVEEGQATLIPEPIYM----------AGESEDIIVEIAILYTEKQRETIYSFVNNINTHEGGTHVSGFRMALTRIINEMAKSLGLLKERDGNFQGQDIREGVTAIISIKVPEPQFEGQTKTKLGNSEVTAVVSSIMGQFLKMHMEDHPSDARNIIERILMSRKAREAAKKARELVMRKSALEVGSLPGKLADCSSKKPEESEVFIVEGDSAGGSAKQGRDRHTQAILPLRGKIINVEKSGLHKALENNEVRSMVTAFGANIGDDLELEKLRYHKIIIMTDADVDGAHIRTLILTFFYRYMVDLIHGGYIYIAQPPLFKVTAGRTIQYAYSDKQLKEIVMDADNKRYTLQRYKGLGEMNPDQLWETTMNHDTRTLLQVTIDDAREADILFDKLMGDKVEPRRNFIEEHSHFVKNLDI 634
61 0.000e+00gi|490134877|ref|WP_004035237.1| DNA gyrase, B subunit [Clostridium sp. ASF356]  clstr ali  49  2......SSEYNENQIQVLEGLEAVRKRPGMYIGSTSTQGLHHLVYEIVDNAVDEALAGYCDEISVIIHEDNTISVKDNGRGIPIGIQAQKGIPAVEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVQIYIDGKIYEQKYARG-HVVTKLQEIGKT-QEHGTYIRFKPDTEIFEDTVFQFDILKKRLRETAFLTKGLKISITDQREGKKQQKSFHYEGGIKEFVAYINQYRDTLYDNIFYAE----------GEKDGILIEVAFQHNDSADENIHTFVNNINTSDGGTHLIGFKSGMTKTINDYSRKAGILKESDKNLTGDDVREGLAAIVSIKVAEPQFEGQTKSKLGNSEAKGAVESIVNEYLSYFLEENPAIGRLIVEKGILASRAREAAKRARELVRRKSVLETSRLPGKLADCSDKDPVNCEIYIVEGDSAGGSAKGARDQRIQAILPLRGKILNVEKARMDKILNSDEIKNMITAFGTGVDTDFDITKLRYHKIVIMTDADVDGAHIRTLLLTLFYRHMPQLIKAGHIYIAQPPLYRVEKNKEHYYVYDDKELENLYTRIGREGIEVQRYKGLGEMDAEQLWDTTMDPEHRILKRVDLEDAVSADEIFTRLMGDKVEPRREFIQEYAEKVQNLDI 634
62 0.000e+00gi|551281970|ref|WP_022902075.1| DNA gyrase subunit B [Humibacter albus]  clstr ali  47  1MTTEPKDSDYGASQIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVTEIVDNAVDEYLAGYGSHIDVTLTQDGAVRVIDNARGIPVAIHQPEGISTVELVLTVLHAGGKFGGGAYAVSGGLHGVGSSVVNALSTRLDVEVKNRGYVWTQTYHNGVP-DAPLERGAETS-DTGTTITFWPSAEIFESTEFDYDTLRTRFQQYAFLNKGLSISLWDRREREERNDTFLYQRGLEDYVEYLNSAKDIVNDEIISFESEDTERK--------IALEVAMQWTTAYTESVHTYANTINTHEGGTHEEGFRAALTTLVNKYAREKGILKEKDDNLSGEDVREGLTAVISVKLGEPQFEGQTKTKLGNTEAKAFVQKVVGDQLGDWFDRNPNQAKEIIRKAIQAATARFAARKARDTARRKGLLEGGGMPGKLSDCSSRNPDESEIFLVEGDSAGGSAKQGRNPATQAILPLRGKILNVEKARLDRALANAEIQAMITAFGTGIGEDFNGEKARYHKIVLMADADVDGQHITTLLLTLLFRYMRPLIEMGYVYLAQPPLYRLKWSNDHQFVYSDRERDALLADGLAAGNGIQRYKGLGEMSYQELWETTMNPETRTLLQVTMDDAAAADETFATLMGEDVESRRHFIQKNAKDVRFLDI 663
63 0.000e+00gi|653182890|ref|WP_027419371.1| DNA gyrase subunit B [Crocinitomix catalasitica]  clstr ali  48  1MSEEKNNGGYSADSIQALEGMEHVRMRPSMYIGDVGYRGLHHLVYEVVDNSIDEAMAGHCDEVEVVILEGNGVRVTDNGRGIPIGMHAKEKVSALEVVMTKIGAGGKFDKDSYKVSGGLHGVGVSVVNALSRHLKAEVRREGKLYVQEYERG-KPLYPVKEDGVST-ENGTTVTFFADGQIFDELDYTYDILASRMRELSFLNKGLRLIIRDEREGNFKEDNFFSEIGLSEFVRFLDESREPLIEEVIHV----------SGEKNGVPVEVAMIYNTSYAENLHSYVNNINTHEGGTHLSGFRRGLTSTLKKYADESGMLDKLKFEIAGDDFREGLTAVISVKVAEPQFEGQTKTKLGNREVNAPVSQAVSEMLSDYLEENPKDARRIIEKVILAATARHAARKAREMVQRKSVLTGTGLPGKLADCSSKDPAESEVYLVEGDSAGGTAKQGRDRHFQAIMPLRGKILNVEKAMVHKIFENEEIKNIYTALGVRIGTELNLEKLRYHKIIIMCDADVDGSHIETLILTFFFRYMRELIELGYIYIATPPLYQVKKGKKSHYAWNDDQRDKLVMDMKGAGVNVQRYKGLGEMNAEQLWDTTMNPEFRTLRQVQIENAIESDRTFSMLMGDEVAPRRAFIEKNAKYA-NID. 650
64 0.000e+00gi|547840482|ref|WP_022248068.1| dNA gyrase subunit B [Eubacterium sp. CAG:274]  clstr ali  50  3......QQDYNENQIQILEGLEAVRVRPGMYIGSTSIRGLHHCVYEIVDNAVDEALAGYCTDIEITINPDDTVTVFDNGRGIPVGIHPQKGIPAVEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLVVDIYHDGNIYRQHYARG-KVQDKLTIVGQCPKETGTKITFKPDAEIFEETHFDYATLREHFQETAFLTKGVKIIFKDEREGQQAENVFHYEGGIREFVEHINKTRETSYDEIFYCE----------GMKDDISVEVAFQHYDGYNEVNFSYVNNINTVDGGTHVMGFRSALTKTINDYGRKFGLLKASDKNLTGEDIREGLTSVISVKIPDPQFEGQTKGKLGTSEATSAVATVLSEKLEYFLEENPTIAKAIFEKSMVASRAREAARKARELVRRKSPLESGRLPGKLTDCSSNDPSESEIYIVEGNSAGGSAVGARNPRVQAVLPLRGKILNVEKARLDRILGNEEIRAMITAFGTGIHEDFDISKLRYHKIILMTDADVDGAHIATLLLTFIFRFMPDLIKEGYVYLAQPPLYKLEKNRKAYYAYSDEERDSIISEIGSDGMSIQRYKGLGEMDPEQLWDTTMNPENRILVKVTIDDARVADAIFDQLMGDNVEPRREFIQENAKYVTNLDV 637
65 0.000e+00gi|496355709|ref|WP_009064885.1| DNA gyrase subunit B [Clostridium sp. MSTE9]  clstr ali  52  7...TQTDQNYDENQIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNAIDEALAGFCDRIIVKILPGNIISVEDNGRGIPVGIEHKTGISAVTVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSQWLEVEVFTEDGVYSQRFERGV-AVTELTRTGDSDH-TGTVVRFQPDSEIFESIEFEYDILQNRLREQAFLNAGIHIELDDDRPEHLVHNVYQYEGGIRSFVEYLNKKREVIHENVIYFDAVAAD--------DNATAEVAMQYNNSYNELMLSFANNIHTTDGGTHEDGFKRALTRIMNDYARKYNILKENDKNLSGEDVREGLTVIISVKLKEAQFEGQTKARLGNTEIAGLVSQMMSDKLTTYLEENPSVARAIFEKALSXXXXXXXXXXXXXLVRRKSALESAALPGKLADCQSRNPEETEIYIVEGDSAGGSAKGGRDRKFQAILPLWGKMLNVEKARLDKVYGNEKLMPVVTALGCGLGEEFDLSKLRYGKIIIMADADVDGSHIRTLLLTFFFRFMRPLVEQGHIYLAQPPLYRITRGKNHRYAYSDKQRDAIMAELGGTNYDIQRYKGLGEMDAQQLWETTMDPETRTMLKVEMEDAAAADETFTILMGDKVEPRRLFIEQNARFVSNLDI 647
66 0.000e+00gi|496686658|ref|WP_009328201.1| DNA topoisomerase IV subunit B [Bacillus sp. BT1B_CT2]  clstr ali  45  5...KKQQVDYNDDSIQVLEGLEAVRKRPGMYIGSTDSRGLHHLVYEIVDNSVDEVLAGHGDHIIVKIHKDNSISVQDRGRGMPTGMH-KLGKPTPEIILTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSEWLTVTIERDGNVYRQRFENGGKPVTSLDKIGTT-KKTGTLIHFKPDPAMFSTTTFNFETLSERLRESAFLLKGLKIELIDERD--QTKETFLYENGIEAFVAYLNEEKDAL-SEVVSFE----------GEHNGIEVDFAFQFNDGYSENILSFVNNVRTKDGGTHESGAKTAMTRAFNEYARKVALLKEKDKNLEGTDIREGLSAIVSVRIPEEQFEGQTKGKLGTSEARSAVDAIVSEQLAYFLEENRETATLLVKKAIKASQAREAARKAREEARKKRKKSEATLSGKLTPAQSRNPSKNELYLVEGDSAGGSAKQGRDRKFQAVLPLRGKVINTEKAKLADIFKNEEINTIIHAIGGGVGADFDIEDINYDKVIIMTDADTDGAHIQVLLLTFFYRYMKPLIEHGKVFIALPPLYKVSKGKKEEYAWSDEEMDDVLKKVG-KGYTIQRYKGLGEMNADQLWETTMNPESRTLVRVKIDDAARVERRVTTLMGDKVEPRRKWIEKNVAF...... 637
67 0.000e+00JGI.Meta JGI_HUM.1375900 7016807179 SRS052697_LANL_scaffold_9661__gene_14926 DNA gyrase, B subunit [Human Stool microbiome from visit number 1 of subject 70  ali  48  9...KKQEEEYSASNIQVLEGLEAVRKRPAMYIGDIGEKGLHHLVYEVVDNSIDEALAGHCTDIDVTINEDNSITVKDNGRGIPTDFHEKEGKSALEVVLTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTLLIAEIHRDGKIFRQSYSKGAP-TSPVEVIGTCD-DRGTTITFKPDGSIFTTTEYKYDILANRLRELAFLNKGIHLNLLDKRNGEYVGDHFYSEEGLKEFVEYLDATRQAITESIIYID----------TEKNGVPVEVAMQYNDSFSENVHSYVNNINTIEGGTHLTGFRRALTRTLKKYAEDSGMLAKLKFDINGDDFREGLTAVVSVKVAEPQFEGQTKTKLGNDEVSAAVDQAMSTALSHYLEENPRDAKAIVQKVILXXXXXXXXXXXXEMVQRKTVLSGAGLPGKLADCSSRDRSIAEIFFVEGDSAGGTAKQGRDRNFQAIMPLRGKILNIEKAQEHRMWENEEIKNMFTALGVTIGTELNLEKLRYDKIIIMTDADVDGSHIATLMLTFFFRKMKELIENGHVYIATPPLFLVKKGQQERYCWTEKERDEITAEMG-KGVHVQRYKGLGEMNSHQLWETTMNPDTRILRKVTIDNAAEADRVFSMLMGDEVPPRREFIEKHAHYA-NID. 651
68 0.000e+00JGI.Meta JGI_HUM.7349509 7073762396 SRS023468_LANL_scaffold_20547__gene_42703 hypothetical protein [Human Posterior fornix microbiome from visit number 1 of  ali  50  80..NTENDVVYSDDQIQVLEGLEAVRKRPGMYIGDTTTRGLHHLIYEIVANSVDEALAGRCDKIVVTLQADGSVKVVDDGSGIPVGIHPKMGIPTVEVVHTILHAGGKFGGGAYSISGGLHGVGASVVNALSEWMEVYVKRDGKIHYIRFERG-KTVKPLTVVGECPNETGTCTIFKPDQEIFPDVTFDFALMLTRYREMAFLNKEVTIILQDARNGENENKNLHYDGGIISFVEYLNKKKECLHPEPIYIAYADDAAK--------MFVEVAMQYNNSYVENVYTYANNIATVEGGTHLTGFRSALTKVINDYARNFKLLKDNDRNLSGEDVREGLTAIISVKLPDPQFEGQTKTKLGNAEMRTLVESTITDELSTYLAEHPVEAKIIVSKCIDAMSARDAARKARELTRRKSVFDSVSLPGKLSDCQEKDPELCEIFIVEGDSAGGSAKSGRERKYQAILPLWGKMLNVERARIDKVYNNEKLQPIVIALGTGLGSDFNIEKLRYNKVIIMADADVDGAHIRTLLLTFFFRHMKPLVEQGHVFIACPPLYMVESGKK-YYAYSDSELENLKVEHNWKNPRIQRYKGLGEMDKEQLWETTMNPETRRLLKVNVKDLQDADETMDLLMGDQVEPRRDFIQSNAALAQ.... 719
69 0.000e+00gi|493928418|ref|WP_006873112.1| DNA gyrase subunit B [Anaerotruncus colihominis]  clstr ali  51  26......EQEYDGSQIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNSIDEALAGHCTKIEVDLLPGNIVKVSDNGRGIPVGIQPKLGIPAVTVVFTVLHAGGKFGGSGYKVSGGLHGVGASVVNALSEWLEVEVCDGSARYYQRFERGV-AVEPLKNTGPTEEK-GTSVAFKADAAIFETTEYDYDTLLRRLREQAFLNAGVYIVLRDQRGTEPVEEHLHYEGGIRSFVEHIHKSKEPIHDEIIYLAARDGDNTA----------EVAMQYNDSYTDLILSFANNIHTTDGGTHESGFKTALTRTMNDYAHKYKLLKD-DEKFSGEDVLEGLTAIVSVKLTDAQFEGQTKARLGNTQMRAMVSSLVYEKLTTYYEENPAVAKAIIEKSINXXXXXXXXXXXXXXXXXKSALETASLPGKLADCSQRGRDGTEIYIVEGDSAGGSAKMGRDRRFQAILPLWGKMLNVEKARLDKVYGNDKLMPVITALGTGIGDEFDIEKLRYGKVIIMADADVDGSHIRTLLLTFFFRFMRPLIEHGHVCIAQPPLFKVSRGKQVRYAFSDEERDQYIRELGSGKADVQRYKGLGEMDPEQLWETTMDPRNRTMLRVEMADAIRADEIFTVLMGDKVAPRKDFIEQNAKYVQNLDI 662
70 0.000e+00gi|491685769|ref|WP_005541907.1| DNA gyrase subunit B [Johnsonella ignava]  clstr ali  50  2.....TERDYNASNIDILDGLEAVRLRPGMYISTTSINGLHHLVYEIVDNSVDEAIAGYCNLIDITINKDNSITVRDNGRGIPVDIQKKANKSALEVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLTVKVYRDNKIYQMGFSRGN-VTQGLTVIGDCEDESGTEVTFFPDGNVFEETVFDYDTLKNRFRETAFLTRNLKINIKDERYEEKRENSFHYEGGLNEFVAFLNKEKNPFYDKVIYCE----------GIRENVNVEVAMQHNDSYSENIYSFVNNINTPAGGTHLTGFKNAITKTFNDYIRKNKLIKESEENLSGEDIREGLTAVISIKIENPQFDSQTKQKLGNSEASLAVSSIINEQLTYFIEQNPQIAKKICEKAIGAMHARLAARKARDITRRKSALEGLSLPGKLADCSSKNASECEIFIVEGDSAGGSAKNARKRDTQAILPLRGKILNVEKARLDKIYANSEIRSMITAFGTGIQDDFDIEKLRYHKIIIMTDADVDGAHIDTLMLTFIYRFMPELIRQGHVYLARPPLYKLEKNKRVWYAYNDDELADILNQVGRDGNKIQRYKGLGEMDEEQLWETTMDPERRVLLKVVADDEIEIDLTFTTLMGDKVEPRREFIEKNAKFAKNLDI 639
71 0.000e+00gi|492549454|ref|WP_005882568.1| DNA gyrase subunit B [Brevibacterium mcbrellneri]  clstr ali  49  1MTADD-NRHYDADDITVLEGLEAVRKRPGMYIGSTSERGLHHLVYEIVDNAVDEALAGFNDRIHVTILADGGVRVEDRGRGIPVAIHSTEKVPTLQVVLTILHAGGKFGGGGYAVSGGLHGVGSSVVNALSKRMDAEVHRDGFVWRQSYERGVP-TGEVTK-GEAADHTGTIITFWPDEEIFDTVQFNFETLRARFQQMAFLNKGLSITLRDERAEKPREVTFKYDNGLFDYVKYLNSTKEPVHEDIISFEAEDT--------EETIALEVAMQWTSSYAESVHTYANTINTHEGGTHEEGFRIALTNLINAYAREQKLLKEKDTNLTGDDVREGLTAVISIKLGEPQFEGQTKTKLGNSEARGFVQRVVRDHLGHWLESNPMQAKEVVRKAIQASQARMAARKAREATRRKSLLESSGLPGKLKDCQSKDPSISEVFIVEGDSAGGSAVQGRDPLTQAILPLRGKILNVEKARLDRALSNLEVQSMITAFGTGIGDEFDIEKLRYHKIVLMADADVDGQHITTLLLTLIFRYMKPLIERGHVYLATPPLYRIKWSNADEFAYTDRERDALLTDGRANGLGIQRYKGLGEMNYHELWETTMNPDHRLLKQVTLDDAMVADEIFSVLMGDDVDSRKRFIQENAKDVRFLDI 664
72 0.000e+00gi|550657465|ref|WP_022636847.1| DNA gyrase subunit B [Chitinivibrio alkaliphilus]  clstr ali  51  3......ENNYNAENIKSLKGLEAVRKRPAMYIGSTSSAGLHHLVYEIVDNSIDEALAGYCDTIDVTIHRDNSITIQDNGRGIPVDYHEEEGMSALELVVCTLHAGGKFDNSNYKVSGGLHGVGVSCVNALSAKFYAEVYRNGTIYAMHFVRGEK-TEELQEIGTTDK-TGTIITFTPDHEIFETLEYSFDILSQRLRELAFLNKGITINLFDER-EADKEHHFSYPGGLVSFIEYLDENKHPLHEEPVHFIYTGKDDAG-----EDLEIEVAFQYNDTYKENIFSFANNINTREGGTHLTGFRQGLTRALTKYIDDNGLLKTKNIKISGEDLREGMTAVISVKLTDPQFEGQTKQKLGNSGVTKLVAQNVRENLVTYLEENPQIAKKIVEKSINSAVAREAARKARQLARRKSVMDGGGLPGKLADCSEKDPAKSEIFIVEGDSAGGSAKSGRSRETQAILPLKGKIINVEKARPDKVIANDEIQAMIQAFGTGFGEDFNMSKLRYHKIIIMADADVDGAHISTLLLTFFFRHMPELIESGYVYKSCPPLYKAKAGKKEEFLFNDAALEEFKQRHPNQKVTYQRFKGLGEMNPDQLATTTMNPETRKVLQVRLEDVVEADRIFTMLMGEEVPPRRKFIEDNAKKVSNLDI 638
73 0.000e+00gi|502822265|ref|WP_013057241.1| MULTISPECIES: DNA topoisomerase IV subunit B [Bacillus]  clstr ali  46  1MAR-KQQFNYNEDAIQVLEGLDAVRKRPGMYIGSTDTRGLHHLVYEIVDNSVDEALAGYGEEIIVTIHKDNSISVQDKGRGMPTGMH-KLGKPTPEVILTILHAGGKFGQGGYKTSGGLHGVGASVVNALSEWLTVTIHRDGFIYEQRFENGGKPVTTLEKIGKT-KKTGTTIHFKPDATIFSTTVYNYDTLCERLRESAFLLKGFKIELIDKRHD--RHDIFHYETGIQAFVSYLNEEKDSLHP-VVFFE----------GIHHNIEVEFAFQFNDGYSETILSFVNNVRTKDGGTHESGAKSAMTRAFNEYARKVSLLKEKDKNLEGTDIREGLGAIVSVRIPEEQFEGQTKGKLGTSEARSSVDAVISEKLAYFLEENPDVSSLLVKKAIKAAQAREAARKAREDARKKRKRQETVLSGKLTPAQSRNPQRNELYLVEGDSAGGSAKQGRDRRFQAVLPLRGKVINTEKAKLQDIFKNEEISTIIHAIGGGVGADFTIDDINYDKIVIMTDADTDGAHIQVLLLTFFYRYMKPLVEAGKVFIALPPLYKVSKGKKEEYSWSDEELQGAIDKVGR-GYMIQRYKGLGEMNADQLWETTMNPETRTLIRVRIDDAARADRRVTTLMGDKVEPRRKWIESNVAF...... 635
74 0.000e+00gi|499123828|ref|WP_010852737.1| DNA gyrase subunit B [Cyclobacteriaceae bacterium AK24]  clstr ali  48  12MSKEKESNDYSAQNIQVLEGLEAVRKRPAMYIGDIGVKGLHHLIWEVVDNSIDEALAGHCDTIKVSVLEDNSVRVEDNGRGIPTDFHEKENRSALEVVMTVLHAGGKFDKDTYKVSGGLHGVGVSCVNALSTMLLATVHRQGKMFEQEYSRGVP-QYPVREIGVTEK-RGTIIHFKPDHEIFQVTDYKYETIANRLREMAFLNAGIRIFLEDYREGKPRSDEFFSEGGLVEFVEYLDENKQKIIETPIYIES----------EKNGVPVQVAMGYNSSYNENVVSYVNTINTYEGGTHVSGFRRALTRTLKAYADKSGMLDKVKLEISGDDFREGLTAVISVKVAEPQFEGQTKTKLGNSEVIGAVDGAVSETLQTWLEEHPREAKIIVGKVILAAQARHAAKKAREMVQRKNVLGGGGLPGKLADCANSDPAVCELYLVEGDSAGGSAKQGRDRDYQAILPLKGKILNVEKALEHKIYDNDEIKNILTALGVKIGKELDLANLRYHKIIIMTDADIDGSHIRTLILTLFFRYMRTLIERGYVYIALPPLYLLKRGKDERYCWSEEERKRITEEMAADGVGVQRYKGLGEMNPEQLWTTTMDPNTRTLKQVTIDSAAEADHLFSMLMGDEVAPRREFIERNAKYAK.... 660
75 0.000e+00METAHIT O2 GL0075697 [Complete] locus=scaffold2116_1:19:1968:+  ali  48  1MAENETANEYDASEIQVLEGLEAVRKRPGMYIGSTSTSGLHHLVYEIVDNAIDEALAGYCTDILVRINEGDTITVVDNGRGIPVDIQAQTGKPALEVVYTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLTVQVHRDGHIYEMKFSRGN-VTQPMTIVGDTDH-TGTTVTFKPDPEMFEDTEYNYDTLHTRMREEAFLNAGLCIRTVDARPGREQEDNMCFEGGIREFVTWLNKSKDVVHNDVIYM----------SGAREDSVAEVAMQYNDGYNETILSLANNVHTPEGGMHEEGFKRALTNVLNAYGRKIKLLKD-DEKVSGEDCREGLTAVISVKLTDAQFEGQTKSKLGNSEIRTLVNNIVSEKLEIFLEENPQVGRMILDKALTANRAREAAKKARESIRRKTALGGAAMPDKLRDCNENNPELTELYIVEGDSAGGSATQGRDSRFQAILPLWGKMLNVEKARADKVYGNDKLQPVITALGAGIGDEFDLNRLRYHKVIIMADADVDGAPIRTLLLTFFFRFMRPLIEEGYVYSAVPPLYKLTRGKTTRVAFDDIQREKIAAEMPNAKIDISRFKGLGEMNPHELWETTMDPTTRTLRRITLDDAVAADETFTILMGEKVEPRKEFIERNAQYAVNLD. 648
76 0.000e+00gi|695914906|emb|CEG27401.1| DNA topoisomerase IV subunit B [Bacillus sp. B-jedd]  clstr ali  46  11.AANQQVFNYDDDAIQVLEGLEAVRKRPGMYIGSTDSRGLHHLVYEIVDNSIDEALAGYGKEITVKIHKDNSISVIDKGRGMPTGMH-KLGKPTPEVILTILHAGGKFGQGGYKTSGGLHGVGASVVNALSEWLVVTIKRDGFIYEQKFINGGKPETTLEKIGKTN-QTGTTIHFKPDPAIFSATAYNFETLSERLRESAFLLKGMKINIIDDRNG--VQETFHYENGIEAFVEYLNEGKEVLHP-VVSFE----------GIHSDIEVEFAFQFNDGYSENVLSFVNNVRTKDGGTHEAGSKTAMTRIFNDYARKIGLLKEKDKNLDGADIREGLSAIISVRIPEGQFEGQTKSKLGTSEARSAVDSVVSEHLSYFLEENPDISSLLIKKSIKAYQAREAARKAREEARKKRKRSDAVLSGKLTPAQSRNPQKNELYLVEGDSAGGSAKQGRDRRFQAVLPLRGKVINTEKAKLQDIFKNEEINTIIHAIGGGVGNDFNLEDINYDKVIIMTDADTDGAHIQVLLLTFFFRYMKPLVEEGRVFIALPPLYKVSKGKKEEYAWNEDELQTAMKKVG-KGYIIQRYKGLGEMNADQLWETTMDPETRTLIRVKIDDLARAERRVTTLMGDKVEPRRKWIESNVAF...... 645
77 0.000e+00gi|547965778|ref|WP_022365830.1| dNA gyrase subunit B [Firmicutes bacterium CAG:341]  clstr ali  49  16..DTTVTEEYSAKDIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNSIDEALAGVCTHIECNILPGNIIEVKDNGRGIPTGINEKTGLPAVTVVLTVLHAGGKFGGSGYKVSGGLHGVGSSVVNALSEWLEVEVTQNGHVYSQKFERG-KPVNDLHIIADKD-GHGTTIRFKADAEIFETTVYDYEILARRLREQAFLNAGLSITLTDKRGDEDSGEEFCYEGGIRSFVEYINTSRNPIQDEVIHL----------STTKGDRSAEVALCYTDSYNETLLSFANNINTIDGGTHETGFKTALTRVFNDYGKKFGILKDSDKKFTGDDVREGITAVISVKLTEAQFEGQTKGKLGNTDITGLVSTMLYDKLMTYFEENPNVAKTLLNKSLDXXXXXXXXXXXXXXXXXKSPLESNSLPGKLADCISNDPEKCEIYIVEGDSAGGSAKEGRDKQHMAILPLWGKMLNVEKARVDKVITNEKLVPVVMALGTGIGEDFDINKLRYHKIIIMADADVDGAHIRTLLLTFFFRYMPQIIEDGYVYLAQPPLFKVSKGKKSSYAFSDEERDDKIAEFGGD-CDIQRYKGLGEMDPEQLWETTMDPEFRTMLRVTIEDAQRASENFSILMGDNVEPRREFIEKNAKFVQNLDV 653
78 0.000e+00gi|548227992|ref|WP_022446786.1| dNA gyrase subunit B [Faecalibacterium sp. CAG:74]  clstr ali  50  23...TQVKSEYGEEQIQVLEGLEAVRKRPGMYIGSTDSRGLHHLVYEIVDNSVDEALAGYCKRIDVTLHKDGSVSVRDDGRGFPVGIHPKMGRPAVEVCLTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSKSLSVTVYQDGKIYQQEYARG-KYLYDLRVIGETDR-TGTTIRFLPDDGIFEGVTFDFDVLKKRLREMAFLNKGIHITFTDERGETPVTEDFLYEGGLREFVKYLNHNKEVLFPEPIYTE----------GVKDGILVEVAMQYNDSYAENIYTFVNNIATPDGGTHLTGFTTALTSAINDYGRKYKLLRDNEPNLKAEDAKESLTAVVSVKMEDPQFESQTKSKLGSGQVRGVVNDLVKEELSTYLEENPSVGRTILDRCVSAQXXXXXXXXXXXXTRRKTVLESASLPGKLADCSERDPSKCEIFLVEGDSAGGSAKEGRDRHFQAILPLRGKILNVEKTRLDKALGNNEIKSMLTAFGCGFGDEFDESKLRYHRIVCMTDADVDGAHIRILMLTFFYRYMRPLVEKGYVYAAMPPLYKVTKGKMEKYVYDDDELQRLLDEIGRDKPDIQRYKGLGEMSAEQLWQTTMNPETRTMMQITPEDAMAADEIFTLLMGDQVEPRRKFIEENADLVKDLDV 666
79 0.000e+00gi|501247086|ref|WP_012290104.1| DNA gyrase subunit B [Finegoldia magna]  clstr ali  52  2....KKNREYTADQITVLEGLEPVRVRPGMYIGSTDEKGLHHLVYEVVDNSIDEALAGVCDLIKVTIKKDNSIIVEDDGSGIPVETHPKTGKSTLETVLTVLHAGGKFSNDAYQYSGGLHGVGVSCVNALSTYLIARVKRDGKMYEQRFEKG-KTVTGLTVVKENVRGTGTTIEFMPDDTIFETLNFDKNVLAKRFREMAFLNKGVKIEFSDERDG--YKELFHYEGGIKSFVEYINKSKKPLDHEVMYIE----------GEKDTTKVEIAMQYTESYNETIVSFTNNIKTVDGGTHVVGFKSALTRALNDYARNKNILKEKDDNLSGDDVREGITAVVSVKLNNPQFEGQTKGKLGNSEARTVVDSVVYEHLSFYFEENPKIVRTIIQKALASQKARLAARRARDLVRKKSVLDNTTLPGKLADCQSSDIEYNEIFLVEGDSAGGSAKGGRDNKFQAILPLRGKILNVEKAHLERVLNSEEIKAMITAFGTGIGKNFDISKLRYGKIVIMTDADVDGAHIRTLLLTFLYRFMKPLVEKGHVYIAQPPLYGIIKGKVMEYCYTEQELEEALEKYGRSNIKVQRYKGLGEMNAEQLWDTTMNPEHRILIKVEIEDENELDNTFDVLMGDNVEPRREFIEQNAVYAQNID. 637
80 0.000e+00gi|517351519|ref|WP_018527011.1| DNA gyrase subunit B [Spirochaeta alkalica]  clstr ali  50  2......PGNYSAENIQILTGLDPVRKRPGMYIGSTGSEGLHHLVYEVVDNSIDEALAGHCETIAVVIEKNNVITVVDDGRGIPVDHHAGENVSALEIVMTRLHAGGKFDKDTYKVSGGLHGVGVSVVNALSEWLEVEVYRDNRIWHQRYERGI-ATKQVESIGET-RLTGTKVTFKPDDQIFETVTFSFDVLSHRLRELAFLNKGIRITIEDRRLPQIKSHDFKFDGGLKEFVQYLNKNKTMIQSEPIWFEAS----------RDEVEVEISMEYNDGFNEILFAFVNNINTREGGTHVTGFRGALTRTFNDYLKRSKFAKKMDESFSGDDVREGLTAVISVKVMNPQFEGQTKAKLGNSEVRGIVESLVNENLTAYFDENPKIIEAILEKSVLXXXXXXXXXXXXDLTRRKSFLESSGLPGKLADCSERNPELAEVYIVEGDSAGGSAKQGRDREFQAILPLWGKMLNVEKTRIDKVLANEKLQPIIASLGAGVGNEFDITKVRYHKVFIMADADVDGSHIRTLLLTFFFRYMPQLIEAGYVYIAMPPLYKISYGKMVAYAYNEAERARIIEEITRGKIGIQRYKGLGEMNPDQLWDTTMNPETRSIMQVRLEDAVEADSVFTTLMGEHVAPRREFIEENALSVSNLDI 639
81 0.000e+00gi|547956186|ref|WP_022356752.1| dNA gyrase subunit B [Ruminococcus sp. CAG:379]  clstr ali  51  1MSETEQAQQYDESQIQVLEGLEAVRKRPGMYIGTTGSGGLHHLVYEIVDNSIDEALAGYCTHIQVEILPGDIIRVTDNGRGIPTGIHPKEGISAATVVYTVLHAGGKFGGGGYKVAGGLHGVGASVVNALSEWLELTVKDGSHVHFQRFERGN-YAEPLKIIGDTT-EHGTSVMFKPDAEIFETTVFDYEVLLKRMREQAFLNAGLTIELSDQRDANPQGEKMCYEGGIRQFIEHIHKTRESLSEQVIYF----------TGSKGDNAVEIAMQYNDSYNELILSFANNVHTIDGGMHELGFRNALTKTLNEYGKRFGLLKD-DSKLMGEDVREGLTAIISVKLTDCQFESQTKVKLGNPEIKPFVESIVSEKLMNYLEENPAVARAIFDKSLAAQRAREAAKKARETARRKTAMESASLPGKLADCSERDIEMTEIYIVEGDSAGGSAKEGRDRRYQAILPLWGKMLNVEKARIDKVYCNEKLMPVVTALGTSIGEDFDISKLRYGKVIIMADADVDGSHIRTLLLTFFFRFMRPLITNGNIYIAQPPLFRVAKGKTFKYAFSDEERDKYIAQFPNAKVEVQRYKGLGEMDAHQLWDTTMNPDTRTMIKVEMADAVKADETFSILMGDKVAPRREFIEKNAKYAQNLDI 649
82 0.000e+00gi|627776067|gb|AHY45288.1| gyrB: DNA gyrase, B subunit [Rubrobacter radiotolerans]  clstr ali  51  6.ARKHPENTYDAGSIQVLEGLEAVKRRPGMYIGSTGPRGLHHLVWEIVDNSIDEALAGHCEEILVTVHPDDSVSVTDDGRGMPVGKMAKYDKSAAEVIMTTLHAGGKFDGSGYKVSGGLHGVGASVVNALSEWLEIEIKRDGYVWTQRYERGFP-KGELERKMKKDEGTGTTIRWRPDGEIFEGLDLSYDTLSRRFRESAFLNRGLRIKLVDER-EEGREVTYQYDGGIKDFVAHINESKNPIHKSVFFLHAEEEAGD----------VEVALQWNDGFHDSVFTFANNINTHEGGTHLSGFRSALTRTVNDYARQKGFLKEKDEPMIGDDIREGLAAVISVKVSEPQFEGQTKTKLGNTEIRGLVETNTNRYLAEFFEENPAEAKIIINKVLQAARVRQAARKVRD-TMRKGYLESSTLPGKLADCSSKDPARSELYIVEGDSAGGSAKQGRDRNFQAILPLRGKILNVEKANINKVLSNVEIQAMISAVGASVGDQFNIADARYNKIIIMTDADVDGSHIRTLILTFLYRNMKDLIENGYVYIAQPPLYKVTHQRKDHYVYTEGQLQELLRSLANGNAAIGRFKGLGEMNPQQLWETTMDPENRTLLQVTVESAAVADELFTALMGDRVEPRKLFIEENAREVKNLD. 645
83 0.000e+00METAHIT O2 GL0055790 [Complete] locus=scaffold20280_2:8215:10152:-  ali  51  1MSENQENQNYDENQIQVLEGLEAVRKRPGMYIGSTGPKGLHHLVYEIVDNSIDEALAGFCSEIRVDILEGNVIRVSDNGRGIPTGIHPKEGISAATVVYTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLELTVKDGSSVHFQRFERGE-YSEPLKIIGETE-ETGTSVMFKADGEIFEDTTYDYEVLLKRLREQAFLNAGIKIVFSDKRDEENKSEVLHYEGGIRQFVEHIHKTKESLSDKVIYV----------SGMQGDSFAEVAMQYNDSYNEVILSFANNIHTVDGGSHETGFKNALTKVINEYGKKFNLLKDGEK-LLGDDVREGLTAIISVKLTDCEFEGQTKGRLGNPEVKGFVEKMVMEKLMCYLEENPVEAKAIFEKSVAAQRAREAAKKARETARRKTAMESASLPGKLADCSEHDTEMTEIYIVEGDSAGGSAKEGRDRRYQAILPLWGKMLNVEKARIDKVYGNEKLMPVVTALGTSIGEDFDISKLRYGKIIIMADADVDGSHIRTLLLTFFFRFMKPLITNGNIYIAQPPLFKVFRGKKVRYAFSDEERDEYIAELNGTKPEVQRYKGLGEMDPEQLWETTMNPETRTMLKIDMEDAVKADETFTILMGDKVAPRREFIEANAKYVENLDI 645
84 0.000e+00gi|515893658|ref|WP_017324241.1| DNA gyrase subunit B [Synechococcus sp. PCC 7336]  clstr ali  51  1MSD-----AYSAQQIQVLEGLEPVRKRPGMYIGSTGPKGLHHLVYEVVDNSVDEALAGHCSSIDVRLNGGGSVTVVDNGRGIPVDKHEKTGKSALETVLTVLHAGGKFGAGGYKVSGGLHGVGVSVVNALSEWLEVKVWRSKKVHEQRYERGVP-MGELKARPDGNK-TGTQVTFKPDPEIFTTTEFDYQVLASRLRELAYLNGGVQIVFADDRIEPAHIETYKYDGGINEYVEYINREKHHIHEDIVYM----------TNEKEGVQVEVALQWCDVYSDNLIGFANNIRTTEGGTHLEGLKTVLTNTINSQARKLNRLKESDKNLSGDNIREGLTGIISVKVPDPEFEGQTKTKLGNPEVRGIVYSLVSEGLAEYLEFNPNVAKSIIDKAIQSFNAAEAARRARDLVRRKSALESSTLPGKLADCSSRDPAESEVYLVEGDSAGGSAKQGRDRQFQAILPLRGKILNIEKAEASRIYKNTEIQAMITALGLGIGEEFDASQLRYHRIIIMTDADVDGSHIRTLLLTFFYRYQRSLLEEGYVYIACPPLYKVERGQRARYCYSDREKDEIIAEFPNAKYNIQRFKGLGEMMPQQLWDTTMNPETRVLKRIEIEDAVEADRIFTILMGDVVAPRREFIETYAADLAALDI 639
85 0.000e+00gi|494161299|ref|WP_007101035.1| DNA gyrase subunit B [Synechococcus sp. RS9917]  clstr ali  49  1MSESKVQAAYGAEQIQVLEGLEPVRKRPGMYIGTTGPRGLHHLVYEVVDNSVDEALAGHCSEIEVVLGDDGSASVTDNGRGIPTDIHPRTGKSALETVLTVLHAGGKFGAGGYKVSGGLHGVGVSVVNALSEWVEVTVRRQGQVHRQRFERGAPIGSPVEEKG----RTGTSVCFKPDLEIFTGIVFDYATLSARLRELAYLNGGVRIVFRDEREGDAHEEVYFYEGGIKEYVAYMNAEKDPLHPEIIYV----------NAEKDGVQVEAALQWCDAYSDSILGFANNIRTVDGGTHIEGLKTVLTRTLNAFAKKRGKRKESDSNLAGENIREGLTAVLSVKVPEPEFEGQTKTKLGNTEVRGIVDSLVGEALSQYLEFNPSVIDMILEKAIQAFNAAEAARRARELVRRKSVLESSTLPGKLADCSSRDPAESEIYIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIEKTDDARIYKNTEIQALITALGLGIGEDFDAKNLRYHRVVIMTDADVDGAHIRTLLLTFFYRYQKELVEGGFIYIACPPLYKVERGKNHTYCYNEQDLQTTLAGFGEKNYNIQRFKGLGEMMPKQLWETTMDPTTRLMKRVEIEDALEADRIFTILMGDKVAPRREFIETTA........ 645
86 0.000e+00gi|557311060|ref|WP_023386791.1| DNA gyrase subunit B [Youngiibacter fragilis]  clstr ali  52  1MTDIEKIENYDESKIQVLEGLEAVRKRPGMYIGTTSSRGLHHLVYEIVDNSIDEALAGFCDHIEVYIHKDNSITVEDNGRGMPVGINKKLNKSSVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEVCIVYVKRDGKLYKQEFRRGIPFDT-LSVVGEST-GTGTRTYFKPDDEIFEELEFDFEILSDRLRELAFLNKGIRITLYDERDE--KTESYFYEGGIKSFVEYLNRNKEVLHKDPIYMEE----------EKDGYSVEVSLQYNDSYNENIFTYANNIDTTEGGTHLEGFKRAMTRVINDYGKKFGHIKENDKNLSGEDIREGLTAVISVKLENPQFEGQTKTKLGNSEVRSIVDNVVGRCVQTILEENPQIGKTVIDKALMXXXXXXXXXXXXXLTR-KSVLERGSLPGKLADCASKDPLECEIYIVEGDSAGGSAKQGRNRQFQAILPIRGKIMNVEKQRLDKILGSETIRSMVTAFGGGIGKDFDKEKLRYSRIIIMTDADVDGAHIRTLLLTFFYRYMKDLIDHGHVYIAQPPLYQVTKGKFVEYTYSDKELETVLEKIGGKSVNIQRYKGLGEMNAEQLWDTTMDPEHRILLRATVEDAKAADEIFTILMGDKVEPRREFIERNSKKVVNLDI 640
87 0.000e+00gi|655440947|ref|WP_028825508.1| DNA gyrase subunit B [Proteobacteria bacterium JGI 0000113-P07]  clstr ali  49  1MSEENKNQEYSASNIQVLEGLEAVRKRPAMYIGDIGVKGLHHLVYEVIDNSIDEALAGHCTHIDCYVNQDNSITVTDNGRGIPTGIHEKEGRSALEVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSSDLRVEVFRDGKVFEQEYKIGVP-QYDVREIGTTDI-NGTSVTFLPDASIFEDTVYHFDILVARLRELAFLNKGIHLSITDKREGEFVKEEFYSEGGLKEFVAFLDETRDSILEDVIYID----------GERDGVPVEVAMVYNTSYTENVHSYVNNINTHEGGTHLSGFRRGLTRTLKKYADGSGLLKKVKFEISGDDFREGLTAVISVKVMEPQFEGQTKTKLGNKEVTSAVSRSVSDMLTFYLEENPEQAKRIVQKVILAATARNAANKAREMVQRKSVLTGSGLPGKLSDCSEKDPSKCEIFLVEGDSAGGTAKQGRDRHFQAILPLRGKILNVEKAMQHKVFENEEIKNMFKALGVSIGTDLNLEKLRYHKVVVMTDADIDGSHIATLLLTFFFRFLKPLVEQGYVYIATPPLYLLKRGKDQRYCWDEDQRDLMISEMKGGKVIIQRYKGLGEMNASQLWDTTLNPEFRTLKRVTIDNAAEADRVFSMLMGDEVPPRRAFIEANAKYA-NID. 648
88 0.000e+00gi|516342191|ref|WP_017732224.1| hypothetical protein [Nafulsella turpanensis]  clstr ali  47  1MSEPKKANNYGANNIQVLEGLEAVRKRPAMYIGDVGIKGLHHLIWEVVDNSIDEAMAGHCDHIKVTINEDNSITVVDNGRGIPTDYHTKEKRSALEVVMTVLHAGGKFDKDTYKVSGGLHGVGVSCVNALSILLHAEVHRDGKVFEQEYSKGIP-QYPVREIGTTD-LTGTTIRFKPDGEIFHDLVYRYETVATRLRELSFLNAGIRIDLTDLREGQPRHEQFFSQGGLKEFVEYLDSTRENLIPEPIFVE----------GEKGGIPVQVAMSYNTSYTENVVSYVNNINTIEGGTHVSGFRRALTRTLKAYADRSGLLDKAKVEIVGDDFREGLTAVVSVKVAEPQFEGQTKTKLGNSDAIGAVDASVSEILNNYLEEHPKEARQIVQKVILXXXXXXXXXXXXEMVQRKNVLSGTGLPGKLADCSDSDPAVSELYLVEGDSAGGSAKQGRDRKFQAILPLRGKILNVEKAQEHRIYDNEEIKNMITAMGVSFGRELNMEKLRYHKIVIMTDADIDGSHIRTLILTFFFRYMRELIEKGYLYIALPPLYLLKKGKDERYAWSEDDRARIVKEMAKEGVGVQRYKGLGEMNPEQLWTTTMNPDTRSMKRVTIDSAAEADHLFSMLMGDEVAPRRDFIERNAKYAK-LDV 652
89 0.000e+00gi|545669498|ref|WP_021775776.1| DNA gyrase, B subunit [Jonquetella sp. BV3C21]  clstr ali  49  27MTEVQTPQSYGESGIVVLEGLEAVRRRPGMYIGDTTVRGLHHCVYEIVDNSVDEALAGHCGHITVTIGTDESVSVTDDGRGIPVEIHHQTGKSTVETVLTVLHAGGKFDNRSYKVSGGLHGVGVSVVNALSEWLEVTVWRDGYEYFQRYERGIPV-APLAKTLPSTR-RGTRVRFLADSQIFDEVQYSAETLVSRFREMAFLIPGLTITVEDQREG--KTWTFCEEGGIAEFVRYLNRDRVVLFPEP----------LVVSGERDGVSVEMAFQYTDDYNERLFSFANLIHTVEGGTHVAGLRSALTRAVNEGARRAGALREKDENLSGEDLREGLTCVVSVKLSNPQFEGQTKTKLGNGTVKGSVDSVIYDGLLGHFDEDSSALKPIVDKAVKARQAREAAKKARELVR-KSAMSGLSLPGKLADCSSKKAEECEVYIVEGDSAGGSAKQGRDRSFQAILPLRGKILNVEKARLDKILSSKEIRVIIQALGCGIGDEFDLSKLRYHKIIIMTDADVDGAHISTLLLTFFFRHMKELVEEGHVYLAVPPLYRVQSGKKVDYLYSDRQLRTLMDEVEGKSPAVQRYKGLGEMNPEQLWETTMDPATRLLKRIQVDDAIAADEYFSILMGDKVEPRRDFIQTHAHEVRNLDV 666
90 0.000e+00gi|501979116|ref|WP_012682302.1| DNA gyrase subunit B [Gemmatimonas aurantiaca]  clstr ali  51  8.EAQEDENEYGAHSITVLKGLEAVRKRPGMYIGSTSARGLHHLVYEVVDNSIDEALAGFAKRVEVTIHADDSISVEDDGRGIPVDVHPIEKLPGVELAMTVLHAGGKFDKNTYKVSGGLHGVGVSVVNALSDVLKVWIKRDGKEHFMDFARGV-TTTKLKTLRNPAKETGTKVWFKPDATIFETTRYEWATLANRLRELAFLNKGIQITLRDERPDEPREEVFFARGGLREFVVFLTGNKKPLHQDVVYLD----------TERDDIGIEMALQYNDSYADNVFSFVNNINTHEGGTHLTGFKSALTSVINKYIERSSNLKDKEIRLSGDDVREGLTAVLSVKVREPQFEGQTKTKLGNSEAEGAVRSVMNELLSQYLEEHPKTANAIIDKAISASRAREAARKARDLTRKKNALDVAALPGKLADCSLSDPALCELYLVEGDSAGGSAKQGRNRNFQAILPLRGKIINVEKARFDKVLSNEEIRTIITAIGTGIKDEFDLGKTRYQKIIIMTDADVDGAHIRTLLLTFFFRQMRELIDAGYMYIAQPPLYRVAKGKEEFYAYSEKERDSFSERLGRGNIMVQRYKGLGEMNPAQLWKTTMDPETRTMLRVTMEDAVLADQTFQTLMGDDVEPRRQFIESNARFVSNLDV 658
91 0.000e+00gi|503452599|ref|WP_013687260.1| DNA-cytosine methyltransferase [Fluviicola taffensis]  clstr ali  50  1MSEEKKNQDYSADNIQVLEGLEAVRKRPAMYIGDIGIKGLHHLVYEVVDNSIDEALAGHCDTIGVWINEDNSITVKDNGRGIPTGITKKEGKSALEIVMTVLHAGGKFDKDTYKVSGGLHGVGVSCVNALSIHLHAVVHRDGKIFEQEYQIG-KPLYEVREIGNSDK-HGTEVTFKPDGTIFENTEYNYDTLCARMRELAFLNKGITITMTDLREGNPTSTIFHSEGGLREFAQYLDRNREPLVADVIYFE----------GEREGIPVEVALTYNTSYTENIQAYVNNINTHEGGTHLSGFRRGLTNTLKKYATDSGMLAREKIEIDGDDFREGLTAVVSVKVQEPQFEGQTKTKLGNREVTAPVSQAVSEMLSIYLEEHPNEAKIIVDKVILXXXXXXXXXXXXEMVQRKNVMTGSGLPGKLADCSEKDPSLCEIYFVEGDSAGGTAKQGRDRHFQAIMPLRGKILNVEKAMHHKIFENEEIKNMYTALGVRIGTELNIEKLRYHKIIIMCDADVDGSHIETLILTFFFRFMKELIELGYIYIATPPLYQVKKGAKSDYAWNEDQRDILINQLKGGGVNVQRYKGLGEMNAEQLWDTTMNPEYRTLRQVTIENAAECDQIFSMLMGDEVPPRREFIEKNAKYAK-IDI 650
92 0.000e+00gi|517181202|ref|WP_018370020.1| DNA gyrase subunit B [Streptococcus marimammalium]  clstr ali  52  1MVKDKKNNEYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFAKQIKVFIEPDNSITVSDDGRGIPVGIQEKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSSQLDVKVYKNGKIYYQEYQRG-QVVADLKIIGETD-LSGTTVHFIPDAEIFETIEFDFNKLAKRIQELAFLNRGLRIAITDKRENNPNDLEFYYEGGIASYVEFINTDKQVIFETPIYTE----------GEMDGIAVEVAMQYTTGYHENVMSFANNIHTHEGGTHEQGFRTALTRVINDYAKKNKILKDNDDNLTGDDVREGLTAVISIKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFNRFLLENPQTAKKIVEKGILASKARIAAKRAREVTRKKSGLEISNLPGKLADCSSNVAAQNELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKATMDKILSNEEIRTIFTAMGTGFGNAFDVEKARYHKLVIMTDADVDGAHIRTLLLTLIYRFMRPVLEAGFVYIAQPPIYGIKVGSEIQYIQQEEELKIAMKKYGRFKPSVQRYKGLGEMDDHQLWETTMDPERRLMAQVSIEDGAEADRVFEMLMGDKVEPRREFIEENAVYST-LDI 648
93 0.000e+00gi|502757658|ref|WP_012992642.1| DNA gyrase subunit B [Clostridiales genomosp. BVAB3]  clstr ali  52  59..DTSNNSKYSESDIQVLEGLEAVRKRPGMYIGDTTLRGLHHLVYEIVANSVDEALAGRCDMIYLTINHDGSITVEDDGSGIPIGIHPTKGIPTVEVVHTILHAGGKFGGGAYSVSGGLHGVGASVVNALSEWMDVYVKREGNIYKISFARGV-VTEPLKIIGHCPNETGTKTVFMPDKEIFPDIHFNYDNMLTRYREMAFLNKEITIVFRDERPEEEVEKVLHYDGGIISFVEYMNLHKEPLFPKPIYFASSI----------NNSYVEVALQYNNTYAENIYSYANNIATPEGGTHLTGFKSAITKVINDYARKYGFLKTNDKNLQGEDCREGLTCIVSVKLPEPQFEGQTKSKLGNSEMRTLVESMINDKFPVFLEENPAIAKIIMEKCISASRARDAAKKAREMTRRKNTFDSVSLPGKLVDCQENDPTLCEIFIVEGDSAGGNAKGGRERKYQAILPLWGKMLNVERSRVDKVYNNSKLSPIVMALGTGIGDEFDLNKLRYNKVIIMADADVDGAHIRTLLLTFFFRHMKPLVEKGHVFIACPPLFKVENDNQVFYAYDEAGVEKIKQEQGWDKPKLQRYKGLGEMDAEQLWETTMNPATRKLLRVDLEDAQSADQTFNLLMGEEVKPRKDFIQANAKYA..... 692
94 0.000e+00JGI.Meta JGI_HUM.0756707 7018788513 SRS022609_Baylor_scaffold_10830__gene_15255 DNA gyrase, B subunit [Human Stool microbiome from visit number 2 of subject  ali  47  1MAEENQPKDYVADNIQVLEGLEAVRKRPAMYIGDISGRGLHHLVYEVVDNSIDEALAGFANHIEVTILEDNSIKVVDNGRGIPVDMHEKMHKPALEVVLTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSDYLRAEIHRDGKIHMQEYAFG-KPTCDLQVIGETDH-TGTTIVFHPDASIFTETVYDYETLANRLRDLAYLNAGITLTLTDMREGKPRSDVFHSDEGLKQFVRYLDQGKEPLIEDIIHL----------NTMKNGVPVEVAMTYNTSFSENIFSYVNNINTIEGGTHLTGFRRGLTSTLKKYADDNHLLDKLKIELSKEDFRDGLTAVVSVKVAEPQFEGQTKTKLGNNDVGGVVQTAVSEALRYYLEEHPKQARAIVDKVMLAAQARHAAYNARMKVQRKSPLSGAGLPGKLADCKSRDAAACELFLVEGDSAGGSAKQGRNPNFQAILPLRGKILNVEKAMDHKVFESEEIVNMFKALGVTIGTEEDMTKLRYHKIIIMTDADVDGAHIATLLMTFFFRRIRPIIENGYLYIATPPLYKCSKTKVQEYAWDEQQVQRFVDTYCDGNRDLQRYKGLGEMNPEQLWETTMDPENRMLKKVNLINAAEADRTFSVLMGEEVGPRREFIEAHATYA-NID. 656
95 0.000e+00gi|652818366|ref|WP_027108144.1| DNA gyrase subunit B [Lacticigenium naphtae]  clstr ali  55  10....ELAREYDASQIQVLEGLEAVRKRPGMYIGSTSAEGLHHLVWEIVDNSIDEAMAGFADTIQIIIESDGSVTVIDDGRGIPVDIQQKTGRPAVETVFTILHAGGKFGGGGYKVSGGLHGVGSSVVNALSEYLEVSVHKEGKVYSQRYERGA-VVTELTVTGETER-HGTVVHFMPDTEIFETIEFDFNKLAIRIRELAFLNRGLNISIEDKREGQEKVKAYYYEGGIKSYVEHLNKTKTVLYEDPIHLE----------GEQEGITVEVALQHTDGYHTLLMSFANNIHTYEGGTHESGFKTALTRILNDYARRKKILKENDENLTGEDVREGLTVVLSIKHPDPQFEGQTKTKLGNSEVRTITDRLFSSHFDRFLVENPSIAKKIVEKGILXXXXXXXXXXXXEVTRKKSGLEISNLPGKLADCSSKDPEKSEIFIVEGDSAGGSAKQGRSRKFQAILPIRGKILNVEKASLDRILANEEIRALFTAMGTGFGEEFEAAKARYHKLIIMTDADVDGAHIRTLLLTLFYRFMRPAVEAGFVYIAQPPLYQVKQGKKEVYLDTEAELEEYLKSIPSPKPSIQRYKGLGEMDAEQLWDTTMNPENRRLLQVTIDDAIEANEVFEMLMGETVEPRRQFIEDNAKYVQNIDI 645
96 0.000e+00gi|651360517|ref|WP_026472871.1| DNA gyrase subunit B [Allobaculum stercoricanis]  clstr ali  53  10.EASHVDHSYTADDIQVLEGLEAVRKRPGMYIGSTSQRGLHHLVWEIVDNGIDECLAGFANQIDVTIEEGDVICVHDNGRGMPVGIHEKTHISAVETIMTVLHAGGKFGGGAYKVSGGLHGVGASVVNALSKWLEVTVEQNGKIYYIRFENGGKTVEPLKEIGTTDK-TGTTVRFKPDSEIFETTVFDFGILNSRIRQLAFLNKKLTLTLTDQRPEHPQSKTYSYEGGIVEYVQYLNKGREVISEKVIYAE----------GEMDQILVEVAIQYNKDFQNQIYSFVNNINTPEGGYHVDGFRLALTRELNKYGRENNLLK-KDETLTQEDVKEGLAAIISVKHPDPQFEGQTKTKLGNSEVRKIVSNIFGKYLERFLLENPKDAKAMVEKGLMAGRARLAAAKAREAVQRKSALDGTSLPGKLTDCSSKDPSECEIYIVEGNSAGGSAKMGRDSRTQAILPLRGKVLNVEKARDSRIFKNAEINSMITAFGCGFREQTDVSKLRYHKIVIMTDADVDGSHIATLMLTFLYRFMRPVIENGYVYIAQPPLYKIEKGKKVAYAYKEQEMDKLRAEFKE-GYKVQRYKGLGEMDAEQLWETTMDPKRRILKRITIDDAMEADSVFSILMGEDVEPRKEFIQNNAEYAT-LDL 646
97 0.000e+00gi|551259414|ref|WP_022879649.1| DNA gyrase subunit B [Microbacterium sp. B19]  clstr ali  49  23....KVPNEYGADAIQVLEGLEAVRKRPGMYIGSTGERGLHHLVQEIVDNSVDEALAGYCDTIDVTILSDGAVRVIDNGRGIPVDMHRTEGKSTVEVVLTVLHAGGKFGGGGYAVSGGLHGVGSSVVNALSTRLEVEVKRQGHVWRQSFRDGGVPQAPLAQ-GEESEETGTSITFWPDATIFDTVDFDYDTLRTRFQQMAFLNKGLRISLRDEREGEPRHDSFLYERGLVDYVEHLNRVRDVVNDEIIEVESEDTDR--------NIALELAMQWTTAYTENVFTFANTINTHEGGTHEEGFRAALTTLVNRYARANNLLKEKDDNLTGEDIREGLTAVISVKLSEPQFEGQTKTKLGNTEARAFVQKVVGDKLGDWFDRNPTQAKNIIRKAIDAATARLAARKARETARRKSVFESAAMPDKLKDCTSKDPSISEIFLVEGDSAGGSAVQGRDPHTQAILALRGKILNVERARLDRALGNKEVQAMIQAFGTGIGEDFDMAKARYHKIVLMADADVDGQHITTLLLTLLFRYMRGLIEAGYVYLAQPPLYRLKWSNHHEYAYSDRERDALLVEGQAAGNGIQRYKGLGEMNDHELWETTMDPETRTLRQVTIDDAASADEIFSVLMGEDVESRRSFIQRNAKDVRFLDI 681
98 0.000e+00METAHIT O2 GL0072605 [Complete] locus=scaffold683_1:3670:5670:-  ali  48  1MTDKEAEREYSADSIQVLEGLEAVRKRPSMYIGDIGPRGLHHLVYEVVDNSIDEALAGFCKNIEVTILPDNSIRVKDDGRGIPTGIHEKEGRSALEVVLTVLHAGGKFSKDSYKVSGGLHGVGVSCVNALSSYLKAEVHREGKVFVQEYSRGVP-QYPVKVTGECD-DTGTIITFTPDSEIFKTTVYDASVLSTRLRELAYLNKGIHLSLTDEREHEPERQEFYSEFGLVEFVQYLDGTREKLTEKPISLE----------TDRTGIPIEIAMQYNTGFSENIHSYVNNINTIEGGTHLTGFRRGLTSTLKAYAEKNGFLSKLKFDLDASDFREGLTAVISVKVAEPQFEGQTKTKLGNSEVDAAVSQATKAALETYLEENPKDAKNIIDKVILAATARHAARKARELVQRKTVMSGAGLPGKLADCSNRDPEKCELFLVEGDSAGGTAKTGRDRTYQAILPLRGKILNVEKAMEHKVLESETIRNIYTALGVTIGTEANLDKLRYHKVIIMPDADVDGAHIATLILTFFFRYMPDMIKNGYVYIAAPPLYKVKKGKEEKYCWTEEERIAAIAEIGKGNIYVQRYKGLGEMNAEQLKETTMDPATRLLRQVTIDNAAEADRIFSMLMGDEVPPRREFIEMNAKYAK.... 663
99 0.000e+00gi|547767177|ref|WP_022179031.1| dNA gyrase subunit B [Firmicutes bacterium CAG:582]  clstr ali  52  2.....NSEHYDASDIQVLEGLEAVRKRPGMYIGTTDVKGLHHLVWEIVDNAIDEALAGYCKNIEVVINKDNSITVKDDGRGIPVDIHPKTHISTVETVYTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSSWCEVRVYKDGKINYIRFENGGHTKEPLHVIGECEHRTGTTVTFKPDPTIFDTDIYDYETLKVRIRELAFLNKGLSINIRDDRDDEDTTETFLYEGGISEYVKFLNKNKTPIHDQIIHLD----------GEEEGVFFEVAMQYNTSYQDNIYSFVNNINTHDGGTHEEGVRRALTRVINNYARKTNMLKEKDESLTGDDVKEGLTMIISCKHPNPQFEGQTKGRLGNSEVRKLADSVFSKGFERFLMENPDNARAILEKCIIASRARMAAKKAREVTRRKTDLDLPGFMGKLSDCKSKDRSECEIFLVEGDSAGGSAKTGRDSMTQAILPLRGKILNVEKARLDRALENAEIRTIITAFGTGIGDEFDLSKLRYDKIIIMTDADVDGSHIRILLLTLFYRFFKPIVEAGHVYSATPPLYKVTCGKTIKYVLDDNEYNEYVESLNGKSYEVQRFKGLGEMNAAELKETTMSKENRILRQITVDDLVAADKVFETLMGEDVEPRRKFIEENAHFVQNLDI 638
100 0.000e+00gi|502568534|ref|WP_012818162.1| DNA gyrase subunit B [Ammonifex degensii]  clstr ali  53  4..EEKEREEYRASSIQILEGLEAVRRRPGMYIGSTGPRGLHHLVYEVVDNSIDEALAGFCTEIEVVIKQDNSVLVKDNGRGIPVDIHPQAGRPAVEVVLTTLHAGGKFGGGGYKVSGGLHGVGVSVVNALSEWLEVEVHREGRIWRQRFERGRPVT-DLEAIGETDR-TGTTVHFKPDHQIFEEVVFSQDYLTQRLRELSFLVPEVRIVLRDERTGE--EFVFHHKGGLRDFVRHLNRAREVLHPDPIYL----------AGEREGMVVEAALQYHDGYAESIFSYANTIRTVDGGTHEAGFKAALTRVVNDYGRRHGIIPEN-FQLAGEDVREGLTAVVAVKVPDPQFEGQTKTKLGNTQVRRVVESIVGEGLASFFEENPSIARLIVEKXXXXXXXXXXXXXXXXXXXXKGLLESTSLPGKLADCSERDPAKTELYIVEGDSAGGSAKQGRDRRFQAILPLRGKILNVEKARLDKILANEEIKALITAIGAGIGEDLDLKKVRYHKLIIMTDADVDGAHIRTLLLTFFFRYMRPLIEAGYVYIAQPPLYRVRKGKESFYAYNDAELEKLLSTLGRNGVTIQRYKGLGEMNAEQLWETTMNPEKRVILQVTLEDAVAADELFSTLMGDKVEPRREFISRYARYVRNLDI 636
101 0.000e+00gi|654392324|ref|WP_027869676.1| DNA gyrase subunit B [Eubacterium sp. AB3007]  clstr ali  50  1MSDQKQGSEYTADQIQVLEGFEAVRKRPGMYIGSTGPRGLHHLVYEIVDNSVDEALAGFCKKIKVIINQDNSVTVIDDGRGMPVDEHPKMKIPAVEVIHTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTRMEVEINRNGKIYEIEFARG-KTTKKLNVIGES-RRTGSKTTFWPDPEIFEDTIYDYDTLQHRLREMAFLTKGLNISLEDKRPGQKRKEVFHYEGGLREFVKHLNTNKDPIHEDIVYFEYADAA--------EGHEVEVAMQYTDRFNELMLSYANNINTNEGGTHLAGFKSALTRAMNDYAKKAGLLKEGD-SLTGDDVREGITAVISVKLEQPQFEGQTKAKLGNTEMRGFVETTCNSNIMAFLEEHPKQAAAIVNKCVSASRAREAARKARALVRRQSALQGLSLPGKLADCSEKDPQLSEIFLVEGDSAGGSAKQGRDRKRQAVLPLRGKILNVEKARQDKMLNSEEIKNMITAFGCGIGSEFDISKLRYHKIIIMTDADVDGAHIRTLLLTFFYRYMTPLIEGGYVYAAQPPLFRVQKGKQTWYTYSDKEQEKLLAEIEDKKVEIQRYKGLGEMDFDQLWETTMDYKTRTMVQITVEDATAADEIFTTLMGDKVPPRRKFIEDNARYAT-LDV 641
102 0.000e+00gi|490977849|ref|WP_004839613.1| DNA gyrase subunit B [Anaerococcus vaginalis]  clstr ali  51  2.....ENSEYNASNIRVLKGLEPVRLRPGMYIGSTSERGLHHLVYEVVDNSVDEALAGRCDYIKISIDENNIVTVEDDGSGIPIEKHPQTGKSTLETVLTVLHAGGKFDDKAYKVSGGLHGVGVSVVNALSEYLIAEVKREGHIHRMTFERG-KPTSDLEIVGDT-KESGTKITFKADPEIFDVTVYDKKTLENRFREMAFLNKGVRLIFEDKRDESEIE--FKYDGGIKEFVEYLNRNKTPIFKEVPYFE----------GRQESTEIEISFQYTDGYSENILTFANNIYTLEGGTHLSGFRSALTRSVNDYARKYNLLKENEDNLQGDDAREGITAIISVKISNPQFEGQTKGKLGNSEVRGAVDAFFSEHMGNFLEENPKIAKTIIQKALASRRAREAARKARDLTRKRSILDSTTLPGKLADCQSQDIGENEIFIVEGNSAGGSAKGGRDNRIQAILPLRGKIMNVEKANLDRILNYEEIKSMITAFGTGIGSEFDISKLRYGKIIIMTDADVDGAHIRTLLLTFFYRYMKPLVDGGHIYIAQPPLYKISSGKKERYCYTDKELDEIVKEWKVDNYKISRYKGLGEMNAEQLWETTMDPENRVLLQVEKEDSMSTDATFSMLMGEKVEPRREFIEENAQYVENLDV 634
103 0.000e+00gi|501258150|ref|WP_012301168.1| DNA gyrase subunit B [Candidatus Desulforudis audaxviator]  clstr ali  52  2...DKNGSGYRAEDIQVLEGLEAVRKRPGMYIGSTGPKGLHHLIFEVVDNSIDEALAGFCDYIEVVIHADNSVTVSDNGRGIPVDIHPQVGRPALEVVLTRLHAGGKFGGTQYKISGGLHGVGVSVVNALSRRMEVEVKREGYRYRQEFERGL-ATGELELLDEAD-ETGTRVTFIPDPDIFEEVEFQYDVVAKRLRELSFLNAGVTLVLRDERTGRDK--VYQYAGGIRDFVRHLNLHKEVLPADPIYVEDH----------KNGVWVEVAVQYVNSDRELIFSYANTIHTVDGGTHEAGFKSALTRTINDYARKYNLVKN--DSLSGEDIREGLTAVINVKVPEPQFEGQTKTKLGNSEVRGLVDWVVSQRLAAYLEEHPTEARQIVQRAVVXXXXXXXXXXXXXLTKRKSLLESATLPGKLADCSRRDPQHSELYLVEGDSAGGSAKQGRDREFQAILPLRGKILNAEKARRDKLLGNEEIRALITAIGTGFGEDFDLAKARYHRIVIMTDADVDGSHIRTLLLTFFYRYMKPLIDAGYVYIAQPPLYRVSKGRKNVYLYSDQQLEQFFRENGRQNWSIQRYKGLGEMNPEQLWDTTLDPENRTMLQVTLEDALAAEQLLSTLMGEQVEPRREFIQQHAREVRNLDI 635
104 0.000e+00gi|497284517|ref|WP_009598734.1| DNA-cytosine methyltransferase [Alistipes sp. HGB5]  clstr ali  48  9...KKQEEEYSASNIQVLEGLEAVRKRPAMYIGDIGEKGLHHLVYEVVDNSIDEALAGYCTDIDVTINEDNSITVRDNGRGIPTDYHEKEGKSALEVVLTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTLLIAEIHRDGKIYRQSYSKGAP-TSQVEVVGECT-DRGTTITFKPDGSIFTTTEYKYEILANRLRELAFLNKGIHLNLTDKRNGEYVHDNFYSEEGLKEFVQYLDATRTPIIDQIIYLD----------TEKNGVPVEVAMQYNDSFSENVHSYVNNINTIEGGTHLTGFRRALTRTLKKYAEDSGMLSKLKFDINGDDFREGLTAVVSVKVQEPQFEGQTKTKLGNDEVSAAVDQAMSSALGHYLEENPKDAKAIVQKVILXXXXXXXXXXXXEMVQRKTVLSGAGLPGKLADCTSRDRSIAEIFFVEGDSAGGTAKSGRDRNFQAIMPLRGKILNIEKAQEHRMWENEEIKNMFTALGVTIGTELNLEKLRYDKIIIMTDADVDGSHIATLMLTFFFRKMKELIENGHVYIATPPLYLVKKGKQERYCWTEKERDTISAEFG-KGVHIQRYKGLGEMNAHQLWDTTMNPDTRILRQVNIENAAEADRIFSMLMGDEVPPRREFIEKNAHYA-NID. 652
105 0.000e+00JGI.Meta JGI_HUM.8008613 7040985061 SRS011105_Baylor_scaffold_1357__gene_2552 hypothetical protein [Human Anterior nares microbiome from visit number 1 of s  ali  52  6.SDVNNTDNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSQDLEVYVHRNETIYHQAYKKGVP-QFDLKEVGTTDK-TGTVIRFKADGEIFETTVYNYETLQQRIRELAFLNKGIQITLRDERDEEVREDSYHYEGGIKSYVELLNENKEPIHDEPIYIHQS----------KDDIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRALTRVLNSYGLSSKIMKEEKDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGIMXXXXXXXXXXXXEVTRRKSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVYNDRELDKLKSELPTPKWSIARYKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYA-NLD. 643
106 0.000e+00gi|651985377|ref|WP_026695790.1| DNA gyrase subunit B [Bacillus kribbensis]  clstr ali  46  1MSTNANQIEYNDDAIQVLEGLEAVRKRPGMYIGSTDARGLHHLVYEIVDNSVDEALAGFGNHITVKIHKDNSLSVEDKGRGMPVGMH-KMGKPTPEIILTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSEWLVVTIKRDGFVYQQRFVNGGKPETTLEKIGKTN-QTGTTISFKPDPSIFSTTNFNYETLSERLRESAFLLKGMKIELIDERD--RQRDIFQFETGIQAFVEYLNEEKDTLHK-VVSFE----------GEQNDIEVDFAFQFNDGYSENILSFVNNVRTKDGGTHEVGAKTAMTRVFNEFARKSGLLKEKDKNLEGSDIREGLAAIISVRIPEEQFEGQTKSKLGTSEARSSVDAMVSEHLAYFLAENPDISSLLVKKAIKAYQAREAARKAREEARKKRKKSEAILSGKLTPAQSRNPQKNEIYLVEGDSAGGSAKQGRDRRFQAVLPLRGKVINTEKAKLQDIFKNEEINTIIHAIGGGVGPDFSVEDINYDKVIIMTDADTDGAHIQVLLLTFFYRYMKPLIEAGKIYIALPPLYKVSKGKKEEYAWSDEELQGAMKKVGR-GYIIQRYKGLGEMNADQLWETTMNPESRTLIRVRIDDIARAERRVTTLMGDKVEPRRKWIESNVAF...... 636
107 0.000e+00gi|669259994|gb|KFD41837.1| DNA gyrase subunit B [Peptococcaceae bacterium SCADC1_2_3]  clstr ali  51  3...KENNVKYGVEEIQVLEGLEAVRRRPGMYIGSTGARGLHHLVYEVVDNSIDEAMAGFCSLIEVTLHQNNKVTVVDNGRGIPVEIHPKTGLPAVETVLTMLHAGGKFGGAGYKVSGGLHGVGLSVVNALSLCLTCEVKRNGFLYQQRYSRG-KVKTSLEVIGES-KTCGTKITFQPDPEIFEELVFKQEEINQRLRELSFLNQSVKIILKDERTG--QEIVHQHDGGIQDFVHYLNKNKTVVHEKPIYINK----------KKDDVQVEIALQYTDSYLESLFSYVNNIHTIDGGTHEIGFKTALTRVVNDYGRKQNLIKNGTVNLTGEDIREGLTGVISVKVPEPQFEGQTKTRLGNSEVRGIVDSVLSEELNTFLIENQPVARRIIEKAVTXXXXXXXXXXXXXLTRRKNFLENSTLPGKLTDCSERNPAETEIYLVEGDSAGGSAKQGRDRRFQAILPLRGKILNVEKSRLDKILANEEIKTLITALGTGISEDFDLSRLRYHRVVLMSDADIDGAHIRTLLLTFFYRYMRPLVEAGYVYIAQPPLFQVIKGKDNHYVYNDIDLENLLKKVGRDKIVIKRYKGLGEMNPEQLWDTTMDPEKRTMLKVSLTDAIEADAIFSMLMGERVKPRREFIQENARAVRNLDV 635
108 0.000e+00gi|228736237|gb|EEL86804.1| DNA topoisomerase 4 subunit B [Bacillus cereus AH1272]  clstr ali  46  11....KHQFQYNEDAIQVLEGLEAVRKRPGMYIGSTDSRGLHHLVYEIVDNSVDEALAGFGDEISVVIHKDNSISVIDKGRGMPTGMH-KLGKPTPEVILTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSEWLVVTIKRDGSIYEQRFENGGIPATTLEKIGKT-KESGTTMHFKPDTTIFSTTNYNYETLCERLRESAFLLKGMKISIKDERND--LEDVFHYETGIEAFVSYLNEEKDSIHP-VVYF----------TGEQNGIEAELAFQFNDGYSENILSFVNNVRTKDGGTHEAGFKTAMTRVFNEYARKVSLLKEKDKNLEGTDIREGVAAIVSVRVPEEQFEGQTKGKLGTSEARSSIDAIVSEHLAYFLEENPDVATLLVRKAVKAAQAREAARKAREEARKKKKKSEGTLSGKLTPAQSRNPQKNELYLVEGDSAGGSAKQGRDRRFQAVLPLRGKVINTEKAKLADIFKNEEINTIIYAIGGGVGNEFAVEDINYDKVVIMTDADTDGAHIQVLLLTFFYRYMKPLIEAGKVFIALPPLYKVSKGKVIEYAWSDEELDGVTKKVG-KGYMLQRYKGLGEMNADQLWETTMNPETRTLIRVKIDDASRAERRVTTLMGDKVEPRRKWIERNVQF...... 642
109 0.000e+00gi|652504250|ref|WP_026898573.1| DNA gyrase subunit B [Pedobacter oryzae]  clstr ali  50  1MSEETDRSNYSADNIQVLEGLEAVRKRPSMYIGDTGFKGLHHLVYEVVDNSIDEALAGYCSDIQVTIHKNNSITVEDNGRGIPTAMHTKEKKSALEVVMTVLHAGGKFDKDTYKVSGGLHGVGVSCVNALSIHLTAVVHRDGQIFTQEYKCG-KPLFDVKVIGETDR-TGTIVNFLPDDSIFTTTEYKFDTIAARLRELAFLNKGIRLSLQDEREGSLLREEFYSEGGLREFVQYLDITRTAIIPEPIYVE----------GIKQGIPVELALQYNDTYAENVHSYVNNINTHEGGTHVAGFRRGLTRTLKAYAEKSGLLKNMKVEITGDDFREGLTAIISVKVQEPQFEGQTKTKLGNNEVMGAVDIAVGEILGNFLEENPKEARLIVNKVILXXXXXXXXXXXXEMVQRKSVMGGSGLPGKLADCANNDPAACELYLVEGDSAGGTAKQGRDRNFQAILPLKGKILNVEKAMEHKIYDNDEIKNMFTAMGVSIGDDLNMDKLRYHRIIIMTDADVDGSHITTLILTFFFRYMKELIEFGYIYIAAPPLYLVKKGREFEYAWNDDQRDSAVQRLKGAGVHIQRYKGLGEMNAEQLWETTLNPQTRTLRKVTIENAVECDRIFSMLMGDEVAPRREFIERNAKYAR-IDI 652
110 0.000e+00gi|556510205|ref|WP_023355104.1| DNA gyrase, B subunit [Catonella morbi]  clstr ali  53  2......SAEYGADQIQILEGLEAVRKRPGMYIGSTSLKGLHHLVYEIVDNSVDEALAGECSHIEVFINEDNSITVVDDGRGIPVGINSKSGLPAVQVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVLVETDGKAYKQRYERG-KVITELTEIGTTER-HGTTVTFLPDKDIFEETVFEYSTIKHRLREMAFLTKGLRISLTDRREEGKKTDSFHYEGGIMEYVSYLNKNQTVLYDKIIYCE----------GKKGTVQVEVALQHNDGYNEGCYSFVNNINTPEGGTHLTGFRNAITKTFNEYAKIMKLVKDSDPALTGEDIREGMTAIVSIKIPEPQFEGQTKQKLGNSEARGAVETIASEQIMIFLEQNPAVGKMIVEKALLAQRARDAARKARDLTRRKTALEYMNLPGKLADCSDKNPDNCEIYLVEGDSAGGSAKDARDRATQAILPLRGKILNVEKSRLDKILENKEIQSMITAFGTGIHDDFDISKLRYKKIIIMTDADIDGAHIDTLMLTFIYRFMPELIKQGHVYLAQPPLYKVEKGNKIWYAYNDKELENIMSEIGRDNNKIQRYKGLGEMDAEQLWETTMDPERRVLLKVMMENASEIDLTFNTLMGDKVEPRREFIEQNAKYVRNLDI 636
111 0.000e+00JCVI_PEP_1096679719299 /source_dna_id=JCVI_ORF_1096679719298 /offset=0 /translation_table=11 /length=657 /full_length=657  ali  49  3MNENK--SSYSAESIKVLEGLEAVRKRPAMYIGDVGKRGLHHLVYEVVDNSIDEALAGHCTRITVYFNKDGSVTVEDNGRGIPVDMHKDEKKPAVEVVMTVLHAGGKFDKDTYKVSGGLHGVGVSVVNALSDWLWVEVKRDGKVYKQDYKIGV-TQNKLKEIGKT-KKSGTKVCFLPDTSVFNTTLFEYDIIAERLRELAYLNQGLEINLKDLREEDGQNDSFRFKGGLSDFVKYLDEKNNPLHNKVI----------TVTKEDGEIPVDVALRYGNTYNDNILTFVNNINTIEGGTHLSGFRSALTRAMNNHASKNNLIKTKKTELTGEDFREGLTAIVSVKVPEPQFEGQTKTKLGNGEVKGLVDKVVYEGILDFLEENPSIGRKVIEKALLAARSRSAAKKARELIRRKSALGSSSLPGKLADCSNKDPVFCELYLVEGDSAGGSAKQGRDRKNQAILPLRGKVINSEKARVDKLLSNNEIQSIITALGTGFGGDFNIEKIRYHKIIIMTDADVDGSHIRTLLLTFFYRKMRQLIDGGYLYLAMPPLYRLHQGKKAYYAYDDNERDLIMERMKKDKIGLQRYKGLGEMNPEQLWDTTTDPEKRTLLQVTVESAEAAAVTFQNLMGSDVEARRSFIEKNAKFVANLDI 656
112 0.000e+00JGI.Meta JGI_HUM.0601994 7003267536 SRS024132_Baylor_scaffold_15133__gene_29123 DNA gyrase, B subunit [Human Stool microbiome from visit number 2 of subject  ali  51  2.....KETHYTDNDIQVLEGLEAVRKRPGMYIGSTGERGLHHLVWEIVDNAVDEALAGFCDDIEVIIDKGDIIEVRDDGRGIPTGINSKTGLSTVETIFTVLHAGGKFGGEGYKVSGGLHGVGASVVNALSKWLEVRIYRDGNVYYQRFENGGHPVDALKIVDTCDERTGSTIRFKPDEEIFETTVYNYDTLYKRLQEIAFLNKGLRINLYDLRVQPEKHDTFLYNGGIVEYVEMLNKSKTPIHDDIIYMD----------GSENGIELEVACQYNETYSPSIYSFTNNINTYEGGTHEDGVKAALTKVINNYAKSAKLLKDNDNPLIGEDCREGLTMIISCKHPDPQFEGQTKTKLGNSEVRKIASDVFSQGFERFLMENPAEARIIVEKCISASRGRIAAKRAREATRRKSDLDIVNFGGKLVDCKEKDPSVCEIFLVEGDSAGGSAIKGRNSMTQAILPLKGKVLNVEKARLDRALGNDEIKTIITAFGTGIGQEFDLSKMRYHKVIIMSDADVDGSHIRVLLLTLFYRFFKPIVEAGYVYAAQPPLFCIKHGQTIKYVLNEDERDEYIKNLNEKKYDVSRMKGLGEMDAEELNETTMDIEHRILRKITVEDAISADAAFSKLMGEEVEPRRKFIEENATYAKNLD. 639
113 0.000e+00gi|493939945|ref|WP_006884144.1| DNA gyrase subunit B [Halosimplex carlsbadense]  clstr ali  51  1MSRE--PEEYGAQQIQALEGLEAVRKRPAMYIGSTDDRGLHHLVYEVVDNSIDEALAGYCDSISVTIHDDGSVSVSDDGRGIPVDTHEKYDKPAVEVVMTILHAGGKFDNKSYQVSGGLHGVGVSVVNALSERLDVEVKRDGAVYRESFEQGAPQDG-LERVRDADEGTGTTIRFWPDTEIFEADEYDYSTLESRLRELAFLNSGVEITLTDERDGTA--DTFRYEGGIREFVEYLNETKEPLHQEVVYFED----------EDQDIHVEVALQATNELQGSIHAFANNINTREGGTHLTGFKTALTRIVNDYAEENSLLGEIDGTLKGDDIREGLTAVISVKHPDPQFEGQTKTKLGNSEVRGIVESAVHDGLGTYFEEHPDTAEVIVQXXXXXXXXXXXXXXXXELTRRKSALDSTALPGKLSDCQTRDPEDAELFITEGDSAGGSAKQGRNPEFQAILPIRGKILNVEKHRLDRILENNEIRAMITAIGTGIGDEFDIEEARYEKIVLMTDADVDGAHIRTLLLTFFYRHMRPLLEAGYVYAAQPPLYRVRYRGETYDAMSDEERDRIVEEKCDGNPTVQRFKGLGEMNPQQLWDTTMDPQQRILKQITIEDAAAADKMFSVLMGDAVEPRKQFIKDHAPEAEWVDI 638
114 0.000e+00METAHIT MH0040 GL0107741 [Complete] locus=scaffold5858_3:177:2132:-  ali  47  1MDNTNSAENYSASNIQVLEGLEAVRKRPAMYIGDISEKGLHHLVYETVDNSIDEALAGFCTHIEVTIGTDNSITVQDNGRGIPVDEHKKEHKSALEVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTHMMSQVFRDGKIYQQEYAKG-KALYPVKVVGETE-LRGTRQQFWPDPEIFTTTVYKYDILANRMRELAFLNAGLKITLTDMREGNTQQEVFYSEKGLREFVKYIDSSRSHLFDDVIYL----------STEKQGIPIEAAIMYNTSYSENIHSYVNNINTIEGGTHLQGFRQALTRVLKKYAEETKQIEKAKVEIAPEDFREGLTAVISVKVAEPQFEGQTKTKLGNSEVAGAVNSAVGEALSNYLEEHPKEAKMIVDKVVLXXXXXXXXXXXXESVQRKSPMSGGGLPGKLADCSSKDPAECELFLVEGDSAGGSAKQGRARATQAILPLRGKILNVEKAMWHKAFESDEINNIIQALGVRFGKEANIDKLRYHKIIIMTDADVDGSHIDTLIMTLFFRYMPKLIEDGYLYIATPPLYRCKKGKIEEYCYTEADRRRFMDKYNNGGVTTQRYKGLGEMNPEQLWDTTMDPEKRLLKQVTIENAANADYVFSMLMGEDVGPRREFIEKNATYA-NID. 650
115 0.000e+00METAHIT V1 GL0003782 [Complete] locus=scaffold18271_1:7085:9034:+  ali  51  9.TKMELASEYDASQIQVLKGLDAVRKRPGMYIGSTSAQGLHHLVWEIVDNGIDEALAGFCDEINVVVNPDNSITVKDNGRGIPVDTQKETGKSALETVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELDVKVARQGKRYYMDFDHG-HVKSAMKVIGLPETEHGTTVHFKPDPEIFETTTYNIKTLTDRLRELAFLNKGLKITIEDLRQADHERKEFHYEGGIRHYVEYLNEDQNVLFDPPIYVE----------GKENDITVEVSLQYTDSYRSNLLTFTNNIHTYEGGTHETGFKMALTRVINDYGHKAGILKSNE-TLSGDDVREGLTAVVSIKHPDPQFEGQTKTKLGNSDARTATDHVFAATFNRFLLEHPDEARQIIEKGQLASKARVAAKRAREVTRKKSGLEISNLPGKLADNTSKDPEISELFIVEGDSAGGSAKQGRSRLTQAILPIRGKILNVEKATLDRVLANDEIRSLFTALGTGFGDDFDITKANYHKLIIMTDADVDGAHIRTLLLTLFYRFMKPMITHGYVYIAQPPLYQVRQGKFVKYIDSDEELEQVVSSLPSPKPVIQRYKGLGEMDAEQLWETTMDPENRHLLRVKLDDAEQADKIFPMLMGTKVGPRRDFIEQNAKFVENLDL 649
116 0.000e+00JGI.Meta JGI_HUM.3963119 7030380552 SRS024081_LANL_scaffold_75490__gene_124575 DNA gyrase, B subunit [Human Tongue dorsum microbiome from visit number 2 of  ali  49  1MSEETT--NYGADQIQILEGLEAVRRRPGMYIGTTASRGLHHLVYEIVDNSVDEAIAGYCSRIDVTINPDNTVCVQDNGRGIPVGINHKAGLPAVEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVQVFHDGKVYEQRYERG-KVCYPLRIKEECEPKTGTRVVFKPDAQIFETTEFEFSVLRQRLREMAFLTKGLTIFLTDLRIGENQEEKYHYEGGIKEFVAYLNRSKSALYNPIMYFE----------GDRNKVHVEVSMQHNDSFTESTYTFVNNINTPDGGTHLEGFKTALTNVFNRYARDGKMLKDADENLSGEDIREGLTSIISVKIEDPQFEGQTKQKLGNSEARGAVLSVVSEQLTYFLEQNPTVAKIILDKAITAQHAREAARRARDLTRRKSAMDGMGLPGKLADCSDKDPKNCEIFIVEGDSAGGSAKSARSRATQAILPLRGKILNVEKARDERIYGNAEIKAMITAFGCGIHDDFDISKLRYDKIIIMTDADVDGAHIATLMLTFLYRFMPELIKQGHVYLAMPPLYKLEKNKKVWYAYSDEELNQIIAEVGRDNNKIQRYKGLGEMDPEQLWETTMNPDSRTLKRIGFDEETESDVTFTTLMGDQVEPRKEFIEKNARFVKNLDI 646
117 0.000e+00gi|576320107|gb|ETZ19821.1| DNA-cytosine methyltransferase [Pedobacter sp. V48]  clstr ali  48  33MSEEKDPNNYSADNIQVLEGLEAVRKRPSMYIGDTGVKGLHHLVYEVVDNSIDEALAGHADTIYVNILEDNSIRVEDNGRGIPTGINTKEQKSALEIVMTVLHAGGKFDKDTYKVSGGLHGVGVSCVNALSTHLRAEVHREGKIWVQEYNIG-KPLYEVKSIGDTDK-RGTIVTFTPDATIFTTTEYRYDTLASRLRELSFLNKGISLTLTDEREGTFRTELFHSEGGLKEFVQFLDGNRPSLIAEPIYVE----------GIKNGIPVELALQYNDSYAENVHSYVNNINTHEGGTHIAGFRRGLTRTLKAYADKSGLLKGVKFEITGDDFREGLTAVISVKVQEPQFEGQTKTKLGNSEVMGAVDIAVGEALGIYLEEYPREAKSIVNKVILXXXXXXXXXXXXEMVQRKSVMGGSGLPGKLADCSDSDPEKCELYLVEGDSAGGTAKQGRDRNFQAILPLKGKILNVEKAMEHKIYENDEIKNMFTALGVSIGDDLNLTKLRYHKIVIMTDADIDGSHITTLILTFFFRYMKALIEAGYVYIAAPPLYQVKKGKEFEYCWNDQQRDAAVQRLKGAGVHIQRYKGLGEMNAEQLWDTTLDPAKRTLMQATIENAAECDHTFSMLMGDDVAPRREFIERNAKYAK.... 681
118 0.000e+00gi|503112677|ref|WP_013347408.1| DNA gyrase subunit B [Arthrobacter arilaitensis]  clstr ali  48  21MT-SKVEHTYGAQDITVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEVVDNSVDEALAGYCDTINVTLQADGGVRCEDNGRGIPVDVHPTEGKPTVEVVMTILHAGGKFGGGGYAVSGGLHGVGISVVNALSEKVNTIVRRQGHAWRIGFGNGGHTTQQLTK-GEETDRTGTSQTFYPDPEIFETVEFDFETLRARFQQMAFLNKGLRITLTDERPQKPRTVDYLYKDGLLDYVKHLNAAKELVHDEVIAFESEDS--------KRGISLEIAMQWTNAYAESVHTYANTINTHEGGTHEEGFRAALTGLLNRYARDNKILREKDDNLTGEDAREGLTAVISVKLSEPQFEGQTKTKLGNSMARGFVQGVVNEELGDWFERNPNVARDIIRKAQLASQARMAARKARDNARRKSPMESFGMPGKLSDCSSKNPAECEVFIVEGDSAGGSAKRGRDPHTQAILPLRGKILNVERARLDRALGNAEVQAMITAFGTGIGEEFDMAKLRYHKIVLMADADVDGQHITTLLLTLIFRFMRPLIEHGYVYLAAPPLYRIKWSNAHDYVFSDKERDDALKRLPKDN-GIQRYKGLGEMDYSELWDTTMDPERRTLRQVTMDDAAAADEVFSVLMGEDVESRRNFIQQNAKDVRFLDI 687
119 0.000e+00gi|548577643|ref|WP_022528847.1| GyrB [Lactobacillus shenzhenensis]  clstr ali  53  19...EELAKSYNASQIQVLEGLEAVRKRPGMYIGATSSQGLHHLVWEIIDNGIDEALAGFATKIEVTVEEDGSVTVEDDGRGIPVDIQKKTGKPALETVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSTHLAVTVARDGKKYYMDFHRG-KVSTPMKLVGDPEHEHGTIVHFVPDPEIFETTTFDDKILVTRIRELAFLNKGLKLTFTDKRQETHEKLVFHYEGGIKSYVEYLDHGKDVLFQDPIYVE----------GQEKGITVEVALQYTTGYHSILMTFANNIHTYEGGTHEAGFKAALTRVINDYAHKQNIIKDPDEKLSGDDVREGLTAVVSIKHPDPQFEGQTKTKLGNSDARTVTDRTFAEMFTKFLMENPNEARAIVDKGMVASKARVAAKRAREMTRKKSGLEISNLPGKLADNTSKDPEISELFIVEGDSAGGSAKSGRSRLTQAILPIRGKILNVEKASMDRILANDEIRSLFTAMGTGFGGDFDISKARYHKVIIMTDADVDGAHIRALLLTLFFRYMRPLVDAGYIYIAEPPLYQVRQGKYVKYVDSDEELQEVLQTLPSPKPAIQRYKGLGEMDASQLWDTTMNPENRRLERVNVQDAIEADAVFDMLMGDKVEPRREFIEKNATYA---DI 654
120 0.000e+00gi|502628390|ref|WP_012865054.1| DNA gyrase subunit B [Sanguibacter keddieii]  clstr ali  50  19....TVDGGYGASDITVLEGLEAVRKRPGMYIGSTGERGLHHLVYEVVDNSVDEALAGYCDHIEVTLLDDGGVRVVDNGRGIPVDIHPTEGRPTVEVVMTILHAGGKFGGGGYAVSGGLHGVGISVVNALSTRVETVVRRQGFTWHQSFADGGKPVGELRK-GDATDQTGTQQTFWADGSIFETTRYDFETLRARFQQMAFLNKGLQISLTDERSDQARTVVYKYDRGLLDYVAHLNSAKEIVHEDIIAFESEDTERR--------ISLEVAMQWTNAYSESVHTYANTISTTEGGTHEEGFRAAMTSLVNRYARAKGIIKEKDDNLTGDDIREGLTAVISIKLGEPQFEGQTKTKLGNTEAKTFVQSVVNEQLGDWLDSHPVEAKDIIRKAIQASQARLAARKAREATRRKGLLESGGMPGKLRDCQSNKPEECEVYIVEGDSAGGSAVRGRNPRTQAILPIRGKILNVERARLDKALGNQEVQALITAFGTGIGEDFDIAKLRYHKIVLMADADVDGQHICTLLLTLLFRYMRPLIEHGMVYLAQPPLYRIKWSNEHDYVYSDRERDEYIAAGLANGNGIQRYKGLGEMDYSELWDTTMDPDHRTLLQVTLDDAAAADEIFSVLMGEDVESRRNFIQRNAKDVRFLDI 683
121 0.000e+00gi|522157862|ref|WP_020669070.1| DNA gyrase subunit B [Amycolatopsis nigrescens]  clstr ali  47  1MAANT--NNYGASSITVLKGLEAVRKRPGMYIGSTGERGLHHLIQEVVDNSVDEAMAGYASKIEVTLLADGGVRVVDDGRGIPVAMHPVENKPTLEVVLTQLHAGGKFDGESYAVSGGLHGVGVSVVNALSTRLDVEIHLEGKIWTQRYEMSEPV-APVQEQGPTSK-TGTTITFWADPEIFETTTYNAETISRRLQEMAFLNKGLTIVLRDERTARVKERVYHYPGGLEDFVRHINGSKDPIHQTVVSFDAKG----------DGLEVEVAMQWNNGFTPSVYTFANTINTHEGGTHEEGFRAALTRVVNAYAREKKLLKEKDTNLTGDDVREGLAAIVSIKLAEPQFEGQTKTKLGNSEAKSFVQTKTNEWLADWFERNPTEAKIVINKAVSSAQARMAARKARDLVRRKGALDIGGLPGKLKDCRSTKPEECELYIVEGDSAGGSAKEGRDSMYQAILPIRGKIINVEKARIDRVLKNTEVQSLITALGTGIHDEFDVTKIRYHKIVLMADADVDGQHINTLLLTLLFRFMRPLIEHGHVYLSQPPLYKIKWPREPEYAYSDKERDGLIKAGAEAGDSIQRYKGLGEMNAAELWDTTMDPAHRILRQVNLDDAATADELFSVLMGEDVEARRSFIVRNAKDVRFLDV 656
122 0.000e+00METAHIT MH0083 GL0000441 [Complete] locus=scaffold14197_4:10558:12489:+  ali  48  1MSE--KEEEYSASNIQVLEGLEAVRKRPAMYIGDISVKGLHHLVYEVVDNSIDEALAGFATHIDVTVNEDNSITVVDNGRGIPVDMHEKEHKSALEVVLTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTYLRAEVHRDGKAYVQEYSCG-KPITELRVVGDSNH-TGTMITFKPDASIFTVTVYDYGTLANRLRDLAYLNAGITLTLKDMREGEPRSETFFSENGLMEFVQYIDSNKEPLIEDVIHL----------NTERSGIPVEVALTYNTSYNENVYSFVNNINTIEGGTHLTGFRRGLTMTLKKYAEDAKMLEKEKVEVASDDFREGLTAVVSVKVMEPQFEGQTKTKLGNNEVMGAVQTAVSDALRTYLEEHPREAKTIVEKVILAAKARYAARNAREKVLRKSPLTGGGLPGKLADCSSRHAEDCELFLVEGDSAGGTAKQGRDRQFQAILPLRGKILNVEKAMDHKIFDNQEITSLFRAMRVSIGMEVNISKLAYHKIIIMTDADVDGSHIATLLMTFFFRRMRPVIENGYLYLATPPLFKCMRGKTEEYCWTEQQVQKFIMEHGD-KTKVQRYKGLGEMSAQELRDTTMSPEHRLLKQVRISDAAEADRIFSMLMGEDVAPRRDFIEANANYA-NID. 642
123 0.000e+00JGI.Meta JGI_HUM.0479504 7058273575 SRS049959_WUGC_scaffold_59299__gene_124526 DNA gyrase, B subunit [Human Stool microbiome from visit number 1 of subject  ali  46  9MSEEQTNNEYSADSIQVLEGLEAVRMRPSMYIGDVNTKGLHHLVYEVVDNSIDEALAGYCKNIDVTINEDNSISVSDDGRGIPTGMNQKENRSALEVVMTILHAGGKFDKGSYKVSGGLHGVGVSCVNALSTKLVATIYREGKIWRQEYSKGFP-LADVQVIGETDR-TGTTIYFKPDDSIFYVTEYKYDILAARLRELAYLNRGIRLSLTDKRTNEFKSEVFYSEKGLSEFVEYLDETREKLIDETIHI----------TTEKNGIPIEVAMHYNTEFKENVYSYVNNINTIEGGTHLAGFRRGVMQTLKTYADNSGMLSKLKFDISGEDFREGLTAIISVKVAEPQFEGQTKTKLGNTEVGSAVAQAVSVALANYLEEHPKDARAIVDKVILAAQARHAARKARELVQRKTVLSGSGLPGKLADCSDNNPENCEIFLVEGDSAGGTAKQGRDRKFQAILPLRGKILNVEKALAHRVWESEEIKMIFQALGITIGEDVNLEKIRYHKIVIMADADVDGAHIATLIMTLFFRYMRSVIENGYLYIATPPLYSVKKGKEQRYCWTEEQRLQLIQEMGAGKLHIQRYKGLGEMTAEQLWDTTMSPDGRTLRQVTIENAAEADRIFSMLMGDDVPPRRQFIEQNATYA-NID. 659
124 0.000e+00gi|655548948|ref|WP_028912118.1| DNA gyrase subunit B [Prevotella sp. MA2016]  clstr ali  47  9.SQAEGESNYSASNIQVLEGLEAVRKRPAMYIGDISEKGLHHLVNETVDNSIDEAMAGYCTHIEVTINEDNSITVQDNGRGIPVDEHEKMHKSALEVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTHMMSQVFRNGHIYQQEYEKG-KPLYDVKIVGDTDK-TGTRQQFWPDGSIFTTTEYKYDIIAKRMRELAYLNAGITITLSDLRPDDEQPEVFHAKEGLKEFVRYVDRHRTSIIGDPI----------CLKTEKDGVPIEVALLYNSDYSENIHSYVNNINTIEGGTHLTGFRIALARALKKYADERKQIEKAKIEVAQDDFREGLTAIISVKVAEPQFEGQTKTKLGNSEVNGAVQKAVGEAMNNYLEEHPKEAHTICEKVILAATARIAARKARESVQRKNPMSGGGLPGKLADCSNKDPKECEIFLVEGDSAGGSAKQGRDRHFQAILPLRGKILNVEKVQWHRVFEAESVMNIIQSIGVRFGKDANIDKLRYDKIIIMTDADVDGSHIDTLIMTLFYRFMPQVIQGGHLYIATPPLYKCTYKKTSEYCYTEQQRQAFIDKYDDKALHTQRYKGLGEMNPEQLWETTMNPENRLLKQVTIENAAEADEIFSMLMGDDVEPRREFIEKNATYA-NID. 662
125 0.000e+00gi|493397372|ref|WP_006353487.1| DNA gyrase subunit B [[Clostridium] methylpentosum]  clstr ali  50  2...EKLNQNYDENQIQVLEGLEAVRKRPGMYIGSTGPKGLHHLVYEIVDNAIDEALAGFCTQIDVEILPGNIIHVVDNGRGIPTGIHQKEGISAATVVYTILHAGGKFGGGGYKVAGGLHGVGASVVNALSEWLELKVYDGENIHYQRFERG-HYDKQMEVIGKTDR-TGTEVAFKADPEIFSETEYDYDTLLTRLREQAFLNAGVKIVMADRRQPEPVVENLHYEGGIISFVEFIHKRKETLHPDVIYLKA----------QEGDSVAEVALQYNDSYNELILSFANNIHTAEGGTHEIGFKNALTRVFNDYGRKNNLLKEADKNLSGDDVREGLTAIISVKLTECEFEGQTKSKLGNIEVRALVDRMVSEKLTNFFEENPSVARSIFDKALNAQRAREAARKARELTRRKSALETASLPGKLADCSERDPALTELYIVEGDSAGGSAKSGRERKYQAILPLWGKMLNVEKARLDRVYGNDKLMPVVTALGTSIGDDFDITKLRYNKIVIMADADVDGSHIRTLLLTFFFRFMRPLIDQGHVYIAQPPLYKLSRGKQHRYAYSDKERNQYLSELPDAKVDIQRYKGLGEMDPEQLWETTMNPENRVMIKVEMEDAVAADEVFTILMGDKVGPRREFIEKNAQYVQNLDV 642
126 0.000e+00gi|505138671|ref|WP_015325773.1| DNA gyrase, B subunit [Halobacteroides halobius]  clstr ali  52  2....REEVNYDADQIQVLEGLEAVRKRPGMYIGSTEKKGLHHLVYEVIDNSIDEALAGYCDEVEIKIEPGEIITVRDNGRGIPVASHAKLDRPAVEVVMTVLHAGGKFEGEGYKVSGGLHGVGVSVVNALSEWLEVRVHRNGKIYYQKYHRGVP-DNDLEVIGNTE-ETGTEIRFKADEEIFESVRYNYDTLSQRFKELAYLNKEVKIKILDERED-LIEDEFKYDGGIISFVEEINEHNTPIHEDVIFFEEQI----------DNTEVEVAIQYNTDYADKIFTFANNINTHEGGTHLSGFKSALTRTINDYARQNDFLKDDDNNLSGDDIREGIVAIINVRLTDPQFEGQTKTKLGNSEIRGMVDSIVSKGLSTILSENPKLGKQIVKKSIXXXXXXXXXXXXXELTKRKNALVSTALPGKLADCSSRNAEESEIYIVEGDSAGGSAKQGRDREFQAILPLKGKILNVEKARLDRVLSNKEIKSLITALGTGIADEFDMNNLRYRKIIIMTDADVDGAHIRTLLLTFFYRYMRPLLEEGLVYIAQPPLYKVKKGRREEYVYKDRQLQDLLEEIGKKRTSIQRYKGLGEMNPIQLWKTTMDPENRTLLQVQISDEVIADDVFTKLMGDKVKPRREFIQRHAKEVQNLDV 634
127 0.000e+00gi|512137299|ref|WP_016406086.1| dNA gyrase subunit B [Clostridium sp. CAG:1013]  clstr ali  48  6MTDTKSEKAYDGDQIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNAIDEALAGFCDKIDVRLLPGNIVYVSDNGRGIPVGVQHKTGLPAVTVVFTILHAGGKFGGGSYKVSGGLHGVGASVVNALSTWLEVEVVQDGILYFQRFERG-HAVTQLENRGPVNDGRGTVVRFQADPEIFETTVYEYDVLQKRLREQAFLNAGVNIHLTDERPQEDRPESYCYEGGVSSFVEYINANKDVIHPDVIHFSAVA--------EDENSTAEIAMQYTDSYQEQILSFANNIHTTDGGTHEDAFKRTLTRVMNDYARKYNILKDNDKNLSGEDVREGLTCVISVKLKEAQFEGQTKAKLGNTEMGPLVSSMVYNKLMTYLEENPATARTIFDKALSASRAREAARKARDLARRKTALENTTLPGKLADCQSRDVNETEIYIVEGDSAGGSAKGGRDRKFQAILPLWGKMLNVEKARLDKVYSNEKLMPVVMALGTGLGEDFDLSKLRYGKIIIMADADVDGSHIRTLLLTFFFRFMRPLVEEGHVYLAQPPLFRITKGKRHYYAFSDQQRDQIMAELG-TGYDIQRYKGLGEMDSEQLWETTMNPATRTMRRVEVDDAIEADEVFTVLMGDKVEPRRDFIMKRAKEA-NWDV 659
128 0.000e+00gi|655902586|ref|WP_028973373.1| DNA gyrase subunit B [Spirochaeta cellobiosiphila]  clstr ali  50  2......QDNYSAQNIQVLKGLEAVRKRPGMYIGSTGPDGLHHLVYEIVDNSIDEALAGHCSHIKVVIEHEDIIRVEDDGRGIPVDLHPIENVSAMEVVLTKLHAGGKFEKDAYKVSGGLHGVGVSVVNALSTWCEVTVHQMNHVYFQSYKIGVP-DEPVKVIGDTDR-TGTMVRFKADPNIFDMTVYSFDVLAQRLRELAFLNKGIRITLEDKRSAHEKKHDFFFEGGVKSFVEFLNKNKTKVHGEPIYLE----------GEKDDVFLEIALEWNDGFAENIFSFVNNINTRDGGTHLSGFRSALTRTLNDRLKESKHVKKMDESFSGEDAREGLTAVVSVKVPNPQFEGQTKGKLGNSEVRGIVESFLNDQLSDFFEKNPKVLEQVLEKVVLXXXXXXXXXXXXDLTRRKSVLESAGLPGKLADCSEKDPSKCEIYIVEGDSAGGSAKMGRDRSFQAILPLWGKMLNVEKTRFDKVISNEKLLPVIGALGTSAGPNFDLEKLRYYKVIIMADADVDGSHIRTLLLTFFFRYMQPLVEAGHVYIAMPPLYKIAYGKEVHYVYNDDERKILLKEMPEEKINVQRYKGLGEMNPEQLWETTMNPDSRNMMQVKLEDLVEADEIFTTLMGDNVPPRRKFIEDNALAVSNLDV 639
129 0.000e+00gi|501799368|ref|WP_012642217.1| DNA gyrase subunit B [Thermomicrobium roseum]  clstr ali  52  2...TNSTTRYDASAIQVLEGLEAVRRRPGMYIGSTDIRGLHHLIYEIVDNSVDEALAGYCDRIEVTIHRDGSVRVWDDGRGIPVDIHPKVGKSALEVIMTTLHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVTVRRDGKIYHQRYERGVPVT-PVETIGETTDDHGTETVFLPDRLIFRSLDYQSDVLLQRFREVAYLTSGLTIHFVDERTDLDM--TFYFEGGIVSFVRHLNRTKEVLQPQPFYVKR----------EQNGCLVEVAIQYTDGYAESTHAFANNINTIDGGTHVTGFKAALTRAINEYARRHGLLKENDPNLSGEDVREGLTAIISVMLPEPQFEGQTKTKLGNAEVAGIVQSIVYESFTSYLEEHPAIARRIIEKCLTXXXXXXXXXXXXXLVQRKGALDTFSLPGKLADCTERDPAKAELYIVEGDSAGGSAKQGRDRRFQAVLPLRGKILNVEKARLDRMLHNEEIRALITALGTGIGDQYDRSKLRYHRVILMTDADVDGAHIRTLLLTFFFRYLEGLIIDGHLYIAQPPLYRLQSGKEVHYVYSDEERDAILNRGDGKTWDIQRYKGLGEMNPEQLWETTMDPARRTLLQVTIEDAVRADETFNMLMGSAVPPRKRFIQAHAREVRNLDI 636
130 0.000e+00T2D.3905628 [EC:5.99.1.3][KEGG:K02470] DNA gyrase subunit B;|[COG0187] Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit  ali  50  7MSDEKVTNVYNEDSIQVLEGLEAVRKRPGMYIGTVSVRGLHHLIYEIVDNSVDEALAGYCTEINITINKDNSVTVVDNGRGIPIGIHHKMGIPTVEVVYTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSDWLVVEVSNGEGIYTQRYERG-KTKTKLERIGDTNK-TGTKVTFLPDSTIFETLNYELDTLVQRIREMAFLNKGLKLTLEDRRPEEPIKYDFHYEGGLTSFVEFLNKNKEVINKAPIYIEGGT-----------DVPVEVAIQYTTSYSENVYSFVNNINTPEGGTHLEGFKRSLTKCFNDYARKYNILKEKDNNLQGEDIREGITAVISVKVSDPQFEGQTKTKLGNSNVAGIVSGVMNDKLASFLEENPQIAKAILEKCISASRAREAARKARDLARRKTPLESNTLPGKLADCSSKNPDECELYLVEGDSAGGSAKQGRDRKFQAILAMFGKMINVEKTRIDKVYNNEKLLPVITAIGAGIGSDFDISKIRYGKIIMMADADVDGAHIRTLLLTFFFRYMRPLLEEGRVFAAQPPLYKISKKKEDIYCYSDEELAQKLEEVGKDNTTVQRYKGLGEMNPEQLWETTMNPATRILMKVELADAAKADQIFTVLMGDEVQPRREFIEQNAHTVTNLDI 646
131 0.000e+00gi|685629762|gb|AIO18274.1| DNA gyrase subunit B [Mollicutes bacterium HR1]  clstr ali  53  3......NNTYDSSNIQILEGLEAVKKRPGMYIGSTGPRGLHHLVWEILDNSIDEALAGVATHIKVDILEGNIVCVVDDGRGIPVDIHPKTGLPAVETILTTLHAGGKFDNSSYKVSGGLHGVGASVVNALSEWMEVEIHKDGRKYTQRYEYGF-TKTKLIDHGPSTK-SGTITTFKADPLIFETTEYEYEILRNRVQQMAFLNRGVRIQINDLRTIEPIMNEYHYEGGIIEYVQYLNRSTDVLHDKVIFCE----------GEIDSIVIEIAMQYNTAYRPNIFSFTNNINNVEGGTHEEGFRMTLTRVLNNYGKANNIFK-KDEALVGDDTREGLTCIISVKHPDPQFEGQTKSKLGSTEVRKIVASVLSDGLDRFLMENPNDSRIIIEKALMASRARLAAKKAREATRRKSPLDGLGFASKLADCRSKNPKKSEIYIVEGDSAGGSAKQGRESEFQAILPLRGKVINVEKSRLDKVLGNKEILSMIQAFGTGIGDEFNIDDARYHKIVIMTDADVDGAHIRTLLLTFIFRHLKPLIEKGYVYIAQPPLYKVQQGKKVEYAYIEEELEPLLKEFG-PRVTIQRYKGLGEMNPVQLWETTMDPSTRTLLQVTLEDAIEANEVFSMLMSEEVAPRREFIQKNAIYVQNLDV 633
132 0.000e+00gi|522026046|ref|WP_020537258.1| hypothetical protein [Lewinella cohaerens]  clstr ali  50  1MSTKENQRNYGADNITALEGLEAVRKRPGMYIGSTDSKGLHHLVWEVVDNSIDEHLAGYCSQIDVVIEEDNSITVKDDGRGIPTGMHAKLKKSALEVVMTVLHAGGKFDKDTYKVSGGLHGVGVSCVNALSSMLRAEVHREGKIYEQVYHQG-KPAEDVKVIGDTT-ERGTRVTFLPDPEIFEERVYKYETLAHRLQELAYLNSGLTLTLMDMRNGEHRNETFYSEGGLKEFVLFLDQSKQPITENPIHV----------TGKEDNVEVEVAMQYNTSYSENIYSFVNNINTREGGTHVNGFRRAVNRIFAKYGEENGMFKKLKFKITGEDFREGLTAIVSVKVPEPQFKGQTKGELGNSEVTGIVSRAVGNAIGIFLEENPNEAKRIVDKVILAATARHAARKAREMVQRKNVLTGSGLPGKLADCSSRSPEASELYLVEGDSAGGTAKQGRDRTFQAILPLRGKILNVEKALEYKIYENEEIKNMFTALGVRIEENLNIEKLRYHKVIIMCDADVDGSHIVTLILTFFFRYMHRLIQNGYIYIAKPPLYXVRKGKQFQYCWSEEERQASVNHYTEAGIKIQRYKGLGEMNAEQLWETTMDPDTRILEQVTIEDARGADEVFSMLMGDEVPPRRAFIEANAKYAK-IDV 660
133 0.000e+00gi|652372102|ref|WP_026768058.1| DNA gyrase subunit B [Sediminibacterium sp. OR53]  clstr ali  49  6MTKEEQNKNYGADSIQVLEGLEAVRKRPAMYIGDVGVKGLHHLVYEVVDNSIDEALAGYCKNISVTIHEDNSISVQDDGRGIPTAMHSKEKRSALEVVMTVLHAGGKFDKNTYKVSGGLHGVGVSCVNALSTTLHVTVHREGKIFEQEYHIGVP-QYPVREIG-TSNITGTIVHFWPDTTIFQETVYKKDILEGRLRELAYLNKRISITLTDLREKDEEGNVFYSEGGIVEFVTMLNGNRTPLIANPLYVEGHD--------ESTNVTVEVALSYNDDFKEHIFSYVNNINTIEGGTHVTGFRQALTRVFKNYGDKEGLFEKAKVTVEGDDFREGLSAIISVKVPEPQFEGQTKTKLGNSEVSGVVQTTVSRVLEAYLEENPKEAKYVISKIILAAQARVAAKKARDMVQRKTVLSGGGLPGKLADCSERDAEKCELYLVEGDSAGGTAKQGRDRSYQAILPLRGKILNVEKAMEHKIYENEEIRNMYTALGVTVGEDLNITKLRYHKIIIMTDADVDGSHIATLILTFIFRYMKELVEQGYVYIAQPPLYLVKKGKEQEYAYNEEQRKLLVEKLAGGGVTIQRYKGLGEMNADQLWETTMDPARRTLKQVTIESAYEADRIFSMLMGDEVAPRREFIESHAKYAK-IDV 660
134 0.000e+00gi|495099668|ref|WP_007824491.1| DNA gyrase subunit B [Streptomyces sp. Tu6071]  clstr ali  50  106......EPSYDANAITVLEGLDAVRKRPGMYIGSTGERGLHHLVQEVVDNSVDEALAGHADTIDVTILSDGGVRVVDNGRGIPVGIVPSEGKPAVEVVLTVLHAGGKFGGGGYAVSGGLHGVGVSVVNALSTRVEVEVKTDGHVWTQQYERGVP-IAPLHK-GEATQEHGTSVTFWADGDVFETTEYSFETLARRFQEMAFLNKGLTIKLTDERDSEARTVTYHYEGGIVDFVKYLNSRKEVIHPSVIDVEAEDKEKLL--------SVEVAMQWNAGYTEGVYSFANTIHTHEGGTHEEGFRGALTTIVNKYARDKKLLREKDGNLTGDDIREGLTAIISVKLGEPQFEGQTKTKLGNTEARTFVQKIVYERLADWFDRNPNEASDIIRKGISAATARVAARKARDLTRRKGLLETASLPGKLSDCQSNDPTKCEIFIVEGDSAGGSAKSGRDPMYQAILPIRGKILNVEKARVDKILHNQEIQALISAFGAGVHDDFDIEKLRYHKIILMADADVDGQHINTLLLTFLFRFMRPLVEAGHVYLSRPPLYKIKWGKDVDYAYSDRERDALITLGRENGKAVQRFKGLGEMDAEELRVTTMDQDHRVLGQVTLDDAAQADDLFSVLMGEDVEARRQFIQRNAKDVRFLDI 765
135 0.000e+00gi|547248427|ref|WP_021984095.1| dNA gyrase subunit B [Clostridium sp. CAG:127]  clstr ali  52  3...NQNESNYDANQIQILEGLQAVRKRPGMYIGSTSTRGLHHLVYEIVDNSVDEALAGFCTEIDVSINEDGSVTVIDNGRGIPTGIHKKAGIPAVEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSNWLEVEISRDGKVYKQRYERGN-VIYKLKEIGKTDK-TGTKVTFMPDDTIFDDVIFDYKVLRTRLREMAFLTKGLKINLEDKREGKEQRESFHYEGGIKEFIAYLNKTKTALYDKIIYIE----------GNKDDIYVEVAMQHNDSYNELTLSFVNNINTPEGGMHLTGFKSAITKVFNDYARSNKILRDKEENLSGDDLREGLTAIVSIKIPEPQFEGQTKQKLGNAEARTAVEGLVTEKLTYFLEQNPQVAKAIVGKAVVAQRARMAARKARDVAR-KSTLENMALPGKLADCSDPNPKNCEIYIVEGDSAGGSAKTARSRATQAILPLRGKILNVEKARIDRILENAEIKAMITAFGTGIRENFNIEKLRYDKIIIMTDADVDGAHIATLMLTFFFRFMPDLIKEGHVYLAQPPLYKLEKNKKTWYAYSDEELADILNEVGRDNNKIQRYKGLGEMDAEQLWDTTMDPEKRVLLRVAIDEESELDLTFDTLMGERVEPRREFIETNAKFVKNLDI 640
136 0.000e+00METAHIT MH0066 GL0059282 [Complete] locus=scaffold8665_1:4397:6412:+  ali  48  21..DTVVTDDYNEDSIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNSIDEALAGVCTHIETEILPGNIISVKDNGRGIPTGINEKTGLPAVTVVLTVLHAGGKFGGSGYKVSGGLHGVGSSVVNALSEWLEVEVTQNGHVYAQRFERG-KPVDDLHIIKDSETEHGTLIRFKADADIFETTKYSFDILQRRLREQAFLNAGLSISLCDKREDEEHTSVYCYEGGIRSFVEWINESRTPIQEEVIHI----------STTKDDRSAEVALCYTDGYTETLLSFANNINTIDGGTHETGFKTALTRVFNDYGKKFNILKDSDKKFSGDDVREGITAVISVKLTEAQFEGQTKGKLGNTDITGLVSSLVYDKLMTYFEEHPQVAKTLLGKALDASRAREAARKARENARRKSPLESNSLPGKLADCTSKDPTKCEIYIVEGDSAGGSAKEGRDREHMAILPLWGKMLNVEKARVDKVITNEKLVPVVMALGTGIGEDFDISKLRYHKIIIMADADVDGAHIRTLLLTFFFRYMPQIIEDGYVYLAQPPLFKISKGKKSAYAFSEEQRDAEIAEFGGD-CDIQRYKGLGEMDPQQLWETTMDPEFRTMLRVTIDDAQRASENFSILMGDNVEPRREFIEKNAKFVQNLDI 671
137 0.000e+00T2D.2899921 [EC:5.99.1.3][KEGG:K02470] DNA gyrase subunit B;|[COG0187] Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit  ali  46  1MSEEEKPEEYSADSIQVLEGLEAVRKRPSMYIGDVNTDGLHHLVYEVVDNSIDEALAGYCTHIQVYINEDNSITVRDNGRGIPTARHAKENKSALEVVLTVLHAGGKFNKDSYKVSGGLHGVGVSCVNALSVKLVAEIYREGKIWRQEFCRGV-ALKDVEIIGDTDR-TGTTITFKPDDSIFYVTEYKYDTLSTRLRELAYLNKGIRLSLTDKRDKEPRHEVFYSEFGLREYVEFIDGSREKLIENTIDI----------CTEKNGIPVEIAMHYNTSFTENVFSYVNNINTKEGGTHLAGFRRGLTQTLKNYAETTGMLSKLKFDINGDDFREGLTAVVSVKVQEPQFEGQTKTKLGNTEVGTAVAQAVSTALSNYLEEHPKDAKSIVDKVILAATARHAARKARDMVQRKSVLSGSGLPGKLADCADNNPANCEIFLVEGDSAGGSAKQGRDRQFQAILPLRGKILNVEKAMRHRVYESDEIVMIFKALGITPGTDVDLEKIRYHKIIIMADADVDGAHIATLIMTLFFRHMKSVIEHGYLYIATPPLYLVKKGKDHRYCWNEEERIRLIQEWGGGKLHIQRYKGLGEMNPEQLWETTMAPEGRTLRQVSIENAAEADRIFSMLMGDDVPPRRQFIEQNATYAT.... 651
138 0.000e+00gi|503174155|ref|WP_013408816.1| DNA-cytosine methyltransferase [Leadbetterella byssophila]  clstr ali  49  1MSENNK-QDYSASNIQVLEGLEAVRKRPAMYIGDIGIKGLHHLIWEVVDNSIDEAMAGYCNRIETTINTDNSITVKDNGRGIPTGWHEKEQKSALEVVLTVLHAGGKFDKDTYKVSGGLHGVGVSCVNALSTHLRAEVHRDGKITEQEFSIG-KPLYPAREIGTTDY-RGTIIHFKPDDSIFQVTEYKYETVANRLRELSFLNKGITLTLTDLREGKPKYEEFHSEGGLIEFVEYLDKSRERLITTPMYME----------GQRDGVPVEVSMTYNTSYSENVSSFVNNINTPEGGTHVSGFRMALTRTLKSYAEKSGLLAKEKIEISGDDFREGLTAVISVKVAEPQFEGQTKSKLGNSEVTAAVSGCVQEMLENYLEENPKDAKIIVDKVILXXXXXXXXXXXXEMVQRKNVLVGSGLPGKLADCSEHDPALCEVYLVEGDSAGGSAKQGRDRNFQAILPLRGKILNVEKAQEYKIYENEEIKNIFTALGVQIGKELNLEKLRYHKIIIMTDADIDGSHIRTLILTFFYRFMREIIENGYLYIAQPPLYLVKKGKDEIYAWTEEQRYAAVKKLAGGGVGVQRYKGLGEMNPEQLWETTMNPQHRTLKQVTIESAAEADMLFSMLMGDDVPPRRDFIEKNARYA-NVD. 648
139 0.000e+00gi|499507501|ref|WP_011194141.1| DNA gyrase subunit B [Symbiobacterium thermophilum]  clstr ali  52  2..NTHGTEQYTGEQIQVLEGLEAVRRRPGMYIGGTSQRGLHHLIWEIIDNAVDERLAGFCDKIVVTLHSDGSVSVSDNGRGIPVDIHPKTGISTVETVYTMLHAGGKFGGGAYKVSGGLHGVGAAVVNALSRKLYIQVKQNGGVYEVEFANGGKTLYPLRRVGDT-KEHGTYVRFWPDPEIFESVEFDSEAIVTRLRDTAFLNQGLFIQFIDEKAGAEYR--FKYNEGLQTFVQYLNRSREPLHAKPIYVFKAT----------DTQEMELAIQYTDAYSENILSFANNIRTVEGGTHETGLKTALTRVINSYARKYKLLKDNEDNLSGEDIREGMTAILSVKLQEPQFEGQTKTKLGSSEMETFVAAAVSEGLSDFLEENPAIAKRIVEKALSXXXXXXXXXXXXXLVRRKSALEITALPGKLTDCTSRDPSESELFLVEGDSAGGSAKMGRDRRIQAVLPLRGKILNVEKARLDKILSNEEIRTLITAVGAGIGDDFDISKCRYHKVIIMTDADVDGSHIRTLLLTFFFRFMRPLIEAGYLYIASPPLYMIRKGKQVYYAYSEQEKDQVIARIGGVTDKPQRYKGLGEMNPEQLWETTMDPSKRILYKVTMEDAAEATALFETLMGEKVEPRREFIQRNAHLVQNLD. 635
140 0.000e+00gi|575459148|gb|AHG90265.1| DNA gyrase B subunit [Gemmatimonadetes bacterium KBS708]  clstr ali  52  20.............SIQVLKGLEAVRKRPGMYIGSTGPRGLHHLVYEVVDNSIDEALAGYADTVSVTIHADNSITVDDNGRGIPVDIHPVERKPGLEVAMTVLHAGGKFDKNSYKVSGGLHGVGVSVVNALSERLRVWVKRDGKEHYMDFVRGD-TKTKLKVLGDPKKQTGTKVWFKPDHEIFETTVFTYETLRDRLRELSFLNKGVKITLRDERETPAKEELFHAKGGLREMVQYLNGTKKTLHPEVVYIE----------TERDDIGIELALQYNDSYSESVFSFVNNINTHEGGTHLTGLKSALTSVINKYIEKSGALKDKDIRLSGDDVREGLTAVLSVKIREPQFEGQTKTKLGNSEAEGAVRSVVNELLTQYLEEHPRTANGIIEKAVSXXXXXXXXXXXXDLTRKKSALDVGNLPGKLADCSLSDPKMCELYLVEGDSAGGSAKQGRDRMFQAILPLRGKIINVEKARIDKVLSNEEIRTIITAIGSGIKEEFELEKTRYHKVIIMTDADVDGAHIRTLLLTFFFRQMPELIEAGMIYIAQPPLFRVAKGKEEYYAYGAEERDAIASRLNKANLNIQRYKGLGEMNPEQLWRTTMDPETRTLLKVTQEDALMADQIFQTLMGDAVDPRREFIEANAKFVSNLDV 656
141 0.000e+00gi|503791037|ref|WP_014025031.1| DNA gyrase subunit B [Lactococcus garvieae]  clstr ali  54  1MNEENKEQEYDASQIQVLEGLEAVRMRPGMYIGSTSNEGLHHLVWEIVDNSIDEALAGFASHIEVFIEPDNSITVVDDGRGIPVDIQEKTGRPAVETVFTILHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVTVHKDGQKYYQEYHRGV-VVEDLAIIGETDK-RGTVVHFTPDPTIFTETVFDYDKLVTRVRELAFLNRGLRISITDKREGQENNHAFHYEGGIQSYVSFINENKEVIFDTPIYTE----------GELEGITVEVAMQYTGTYHSTIMSFANNINTHEGGTHEQGFRTALTRAINNYAKAQKLLKDNEENLTGDDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVTGIVNKLFSEALQTFMLENPQVAKKIVEKGILASKARIAAKRAREVTRKKSGLEISNLPGKLADCSSNDPKQTELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKATMDKILANEEIRSLFTAMGTGFGADYDLSKARYHKLVIMTDADVDGAHIRTLLLTLFYRYMRPVVEAGYVYIAQPPIYGIKVGSETEYIQQERELKLALEKWGRAKPTVQRYKGLGEMDDHQLWETTMDPDARLMARVSVEDAAEADKIFDMLMGDRVEPRREFIEANAQYST-IDV 652
142 0.000e+00gi|502934295|ref|WP_013169271.1| DNA gyrase subunit B [Arcanobacterium haemolyticum]  clstr ali  49  1MSDEQKTTEYNASNITVLEGLEAVRKRPGMYIGSTGERGLHHLVYEVVDNSVDEALAGYASEITVTLLDNGGVKVEDDGRGIPVDIHPTEGVAAVQVVMTVLHAGGKFGNGSYAVSGGLHGVGISVVNALSTRMDTEVRRDGYVWRISYENGVPV-APLEQ-GEPTDKTGTTQTFWPNADIFETVEFDFDTLRQRFHQMAFLNKSLKITLIDERETKHTQVTYQYDNGLHDYVTHLIKTKEPVHEHPIYFEAEDKERV--------ISVEVAMQWTNAYSESLHTFANTINTTEGGTHEEGFRTALTSIINKYARDKAILKEKDANLTGDDIREGLTAVISVKLGEPQFEGQTKTKLGNTEARTFVQQTTYAQLTDWLDMHPSEGKEIIRKAMQAQTARLAARKAREATRRKSVLESAAMPGKLKDCTSRKPEECEIFIVEGDSAGGSAVNGRDPNHQAIMPIRGKILNVEKARLDRALSSDSIQSLITAFGTGVGEEFDIDKLRYHKIVFMADADVDGQHIATLLLTLVYRYMRPLIEHGYIYLAMPPLYRLKWTNEHEYVFSDKERDIKLEEGKAEGQGIQRYKGLGEMNDHELWDTTMNPETRTLKRVSIGEAAATDESFSVLMGEDVASRRSFIQRNAHDVRFLDI 682
143 0.000e+00gi|493676480|ref|WP_006626748.1| DNA gyrase subunit B [Bulleidia extructa]  clstr ali  56  20..DMKVDHAYEDEDIQVLEGLEAVRKRPGMYIGSTSSVGLHHLVWEIVDNGIDEAMAGYASQVEITVDEDNIVSVEDDGRGMPTGMNEKTGISTIETIFTVLHAGGKFGGGAYKVSGGLHGVGASAVNALSEFLEVTVYHEGSVYFVRFENGGHPVEPLKVIGTCDDKHGSLVRFKADPTIFETTVYDFNILRNRIRQLAFLNKGIRIKFHDLREVEKRDHDYFFEGGLKEYVKFINENKDKVHEDVIYSE----------GYEDNIQVEVACQYNTSYNPSIYTFCNNITTVDGGTHEEGFRMALTRIVNKYARENNFLKEKDENVTQEDCKEGLTAIISVKHPDPQYISQTKSKLTNSEVRKIVSDIFGTQFERFLMENPNQAKAIMEKIVIASQARLAAKRAKEITR-KSSIKVGSLPGKLSDCSSKDPSISEIYLVEGDSAGGSAKNGRDSHFQAILPLRGKILNVEKTRPEKAFENQEIRSMITAFGAGVQDEVDTSKLRYHKIVIMTDADVDGAHIRTLLLTFFYRFLRPVLEQGYVYIAQPPLFKVQKGQSVRYAYTDRQLEELKAEMGE-RLSIQRYKGLGEMDASQLWETTMDPKSRTLIRVTIEDAEYADQNFSMLMGEEVEPRKNFILENAHFVENLDI 659
144 0.000e+00gi|496077594|ref|WP_008802101.1| DNA gyrase subunit B [Fusobacterium gonidiaformans]  clstr ali  51  2.......NNYGAQNITVLEGLEAVRKRPGMYIGTTSARGLHHLVWEVVDNSVDEALAGYCNTITVSILPDNIIQVEDNGRGIPVDIHPKYGKSALEIVLTVLHAGGKFENDNYKVSGGLHGVGISVVNALSEWTEIKVKRDGNVYYQKYLRG-KPIEDVKIISEAGDTTGTTVTFKPDAEIFETVIFEYEVLQHRLKELAYLNRGLEINLLDCRNEIGKKEKFQFEGGISDFLKEVTHENQVLLSKQIHVE----------GQAEQVGVDIAFTYTTSQSETIYSFVNNINTTEGGTHVTGFRTCLTKVINDIGKSQGFLKEKDGKLQGGDIREGIVAIISVKVPQPQFEGQTKTKLGNSEVSGIVNSVLSVDLKIFLEDNPNDTKLIIEKILNSKKAREAAQRAREAVLRKSVLEVGSLPGKLADCSSKKSEECEIFLVEGDSAGGSAKQGRDRYFQAILPLKGKILNVEKAGLHKALESEEIRAMVTAFGTNIGEEFDLNKLRYGKIILMTDADVDGAHIRTLILTFLYRYMVDLIHNGNVYIAQPPLYKISFGKSIRYAYTDAQLKEILQEGENKKYTLQRYKGLGEMNPEQLWETTMDPEARLLLKVSIDNAREADMLFDKLMGDKVEPRREFIQEHAEYAKNIDI 638
145 0.000e+00gi|547320717|ref|WP_022052029.1| dNA gyrase subunit B [Firmicutes bacterium CAG:631]  clstr ali  54  2..DDKKMTHYNESDIQVLEGLEAVRKRPGMYIGTTSKTGLHHLVWEIVDNAIDEAMAGYGKEINIRILKDNVIEVVDHGRGVPTGIHPKTGISTVETIYTVLHAGGKFGEGGYKVSGGLHGVGASVVNALSEYLEVWVKRDGHLYYQKFINGGHPDGHLKIIGDIDNDTGTTVRFKADPQIFEETEYDYEILKERTRQLAFLNEGIKITVSDSRGEQEIKDEFLYESGLEEYIRFINANKTPIHDHIIHIKGEEETEVRGKTEL--ISVEGVIQYNEGYLPSLYSFCNNINTKEGGTHEEGFRLAIVRVINNYAREKKFLKDNEENLQYDDVKEGMTAIISIKHPDPQYEGQTKGKLGNSEVRKIVSSIFGEQIQRFLLENPNEAKIIVEKALLANKARLAAKRAREQTRRKGALEFSTLPGKLADCSSKDASLCEMFIVEGDSAGGSAKQGRVREYQAILPLRGKIINVEKANPHRVFENAEIGNIITALGTGIHDEFDISKLRYHKVIIMTDADVDGSHIRILLLTFFYRYMQPLIEAGHVYIAQPPLYKVEYGKTVEYAYNDAQLEEIRAR-ATGKMSIQRYKGLGEMDYQQLSETTMDPAYRTLLRVSLDDAIEADRVFDMLMGEKVEPRKKYILDNAKFVTNLD. 648
146 0.000e+00gi|515069205|ref|WP_016699084.1| DNA gyrase subunit B [Actinoalloteichus spitiensis]  clstr ali  50  1MAANK--NEYNASSISILEGLDAVRKRPGMYIGSTGERGLHHLIQELVDNSVDEAMAGYASRVEVTLLADGGVRVVDDGRGIPVDMHPVEKRPAVEVILTVLHAGGKFDSKSYAVSGGLHGVGASVVNALSHTFEVEIHRDGHVWRQRYSK-SKPVHPLEK-GETTDRTGTSQTFWADPEIFETTTYNAETVARRLQEMAFLNKGLTIVLRDERVDEQEERVFHYPGGLEDFVGHINATREAVHRKIIAFEAQG----------DGLQVEVAMQWNNGYTPSVYTFANTINTHEGGTHEEGFRAALTRVVNEYAREKRLLKEKDSNLTGDDVREGLAAIVSIKLAEPQFEGQTKTKLGNSEAKGFVQRTCNEHLADWFERHPTEAKSIVSKAVSSAQARMAARKARELVRRKGALDIGGLPGKLKDCRSRNPEECELYIVEGDSAGGSAKEGRDSQFQAILPIRGKIINVEKSRLDRVLKNNEVQSLITALGTGIHDEFDLGKLRYHKIVLMADADVDGQHIRTLLLTLLFRFMRPLVEHGHVYLASPPLYKVKWSRAEEYAYSDRERDGLIEAGVAAGDGVQRYKGLGEMNAEELWETTMDPANRLLRQVTLDDAATADELFSVLMGEDVEARRSFITRNARDVRFLDI 656
147 0.000e+00JGI.Meta JGI_HUM.7273939 7009695134 SRS018149_Baylor_scaffold_24644__gene_30328 DNA gyrase, B subunit [Human Buccal mucosa microbiome from visit number 1 of  ali  48  1MSEKQ----YTASSIQALEGIEHVRMRPSMYIGDVGERGLHHLVYEVVDNSIDEALAGHCDTIKVTIHEGNAISVSDNGRGIPVDFHEKEQKSALEVVMTKIGAGGKFDKDSYKVSGGLHGVGVSCVNALSTDMTTKVYRDGKIYQQKYQKG-KAVTPVEVVGESDR-RGTEQFFQPDGSIFTELVYKYDILSERLRELSFLNKGITITLTDEREGNPRSETFHSEGGLREFVEYLDGNRVGLMAKPIHIESK---------EDDEIPVEVAMRYNDTFNENLYSYVNNINTREGGTHLTGFRSALTRTFKKYADEVITGKDKDIEVKAEDFREGLTAIVSVKVMEPQFEGQTKTKLGNSEVSGAVSRVVSEMLSTFLEENPAEAKLIVQKVILAAKARLAAQKAREQVQRKNPMSGGGLPGKLSDCSSKDPAECELFLVEGDSAGGTAKQGRDSKFQAILPLKGKILNVEKSMLHKVYDNDEIKNIYTALGVSVGTELNLSKLRYHKVVIMTDADVDGSHIATLILTFFFRYMRELIEKGYVYIASPPLYLLKKGKTQVYAWDENDRKAKLEQLSGRGVEIQRYKGLGEMNDEQLWETTLNPENRYLKQVNIENAVEADRIFSMLMGDEVPPRREFIEKNAIYA-NID. 644
148 0.000e+00gi|504842617|ref|WP_015029719.1| DNA-cytosine methyltransferase [Emticicia oligotrophica]  clstr ali  48  1MAENKSKADYGAENIQVLEGLEAVRKRPAMYIGDIGAKGLHHLIWEVVDNSIDEALAGHCDTINVTINPDNSVTVKDNGRGIPTGMHSKEKKSALEVVMTVLHAGGKFDKDTYKVSGGLHGVGVSCVNALSTHLRVEVHREGKVFEQEYSIG-KPLYPVREIG-TAEDTGTQVTFKPDNSIFTVTEYKYETVANRLRELSFLNKGITIVLTDLREGNALTDTFYSVGGLAEFVSYIDAGRERLIPEPMFME----------GNKDGVPVDVAMLYNTSYSENVYSFVNNINTHEGGTHVSGFRMALTRTLKSYAEKSGILAKEKIDISGDDFREGLTAVISVKVAEPQFEGQTKTKLGNSEVTSAVSACVAEMLENYLEEHPKEARIIVDKVILXXXXXXXXXXXXEMVQRKNVLVGTGLPGKLADCSESDPSICEVYLVEGDSAGGSAKQGRNRAFQAILPLRGKILNVEKAQEFRIYENEEIKNIFTALGVQIGRDLNTDKLRYHKIIIMTDADIDGSHIRTLILTFFYRYMKELIERGYIYIAQPPLYLVKKGKEEEYCWTEEQRELAVKRLAGAGVGIQRYKGLGEMNPEQLWETTMRPDKRTLKQVTVESAAEADHLFAMLMGDEVGPRRDFIERNAKYAK-VDI 657
149 0.000e+00gi|548184792|ref|WP_022405840.1| dNA gyrase subunit B [Prevotella sp. CAG:485]  clstr ali  48  10.STEEQSRHYAADNIQVLEGLEAVRKRPSMYIGDTGTRGLHHLVYEVVDNSIDEALAGFANHIEVTILADNSIRVVDNGRGIPVDMHPKLHKPALEVVLTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSDMLRAEICRDGKIYMQEYSKG-KPTTELTVTGQASH-TGTTITFHPDAEIFTETIYDYDTLANRLRDLAFLNAGITLSLTDEREGNPRKQVFHSDEGLKEFVRYIDQGKDPLIADVIHL----------NTVRNGVPIEVAMTYNTSFNENIFSYVNNINTIEGGTHLTGFRRGLTSTLKKYADENHLLKLKNVELSKEDFRDGLTAVISVKVAEPQFEGQTKTKLGNNDVMGVVQTAVSEALRNYLEEHPKEARVIVDKVVLAAQARHAAYNARMKVQRKSPLGGAGLPGKLADCNSRDAAECELFLVEGDSAGGSAKQGRNPHFQAILPLRGKILNVEKAMDHKVFESEEIVNMFKALGVTIGTEEDMSKLRYHKIIIMTDADVDGAHIATLLMTFFFRRIRPIIEQGYLYIAAPPLYKCSRNKIEEYAWDDRQVQQFIDRHCGGKMVLQRYKGLGEMMPAQLWETTMDPAHRLLKQVHINDAAEADRIFSILMGEQVGPRREFIESNAKFA-NID. 660
150 0.000e+00gi|495985634|ref|WP_008710213.1| DNA gyrase subunit B [Synergistes sp. 3_1_syn1]  clstr ali  49  16.....NASDYTAKDIHVLEGLEAVRKRPGMYIGDQSQRGLHHLVYEVVDNSIDESLAGFCDTIDVTINIDGSVTVVDNGRGIPTEMHE-SGKSAAEVVLTVLHAGGKFDKSAYQVSGGLHGVGVSVVNALSVWLELTIWRNGKEYHQRYERGIPMTG-LEAVGDTE-LRGTRVQFMPDEEIFSTTEFQADILKQRLRELAFLNSHITINFEDLRPEKPEKKSYNYPGGISSFVEYLNKGKEVLFKGPM----------IISGEKDQTQVDVAIQYNDTYLERLYGFVNLINTIEGGTHVAGFRSAMTRAINDEARKLKILKEKDNNLSGDDLKEGLTAVISVKVMEPQFEGQTKTKLGNNDVKGIVDSIVYEGLKNALDERPEILKPIVESALRARQAREAAKKAKELVRRKSIMSGLTLPGKLSDCSNRNPADCEIYIVEGDSAGGSAKQGRNREFQAILPLRGKILNVEKARLEKILSSETIRNIILALGCGVGDDFNDEKLRYHKIFIMADADVDGAHIRTLLLTLFFRYMPQIIEKGYLYVAQPPLFRVQCGKDVTYCFSEKEMKEAQNKANGKKVDVQRYKGLGEMNAEQLWETTMNPENRIINRVEVQDAVEADELFGILMGDVVEPRRKFIEQFGKEVKNLDI 647
151 0.000e+00gi|503396597|ref|WP_013631258.1| DNA-cytosine methyltransferase [Pedobacter saltans]  clstr ali  50  1MSEAEKNSNYSADNIQVLEGLEAVRKRPAMYIGDTGVKGLHHLVYEVVDNSIDEALAGYCTDILVTIHKNNSITVEDNGRGIPTGINKKENKSALEIVMTVLHAGGKFDKDTYKVSGGLHGVGVSCVNALSTHVITVVHREGKIFTQEYERG-KPLFDVKVIGESDR-TGTIQTFQPDPEIFTTTEYRFDTLAGRLRELAFLNKGIRLVLTDEREGSFLSEEFYSEGGLREFVTFLDSTRTPLIPDAIYIE----------GEKNGIPVELAFTYNNSYNENIHSYVNNINTIEGGSHVAGFRRGLTRTLKSYAEKSGLLKNLKVEITGDDFREGLTAVISVKVQEPQFEGQTKTKLGNTEVTGAVDIAVGEALGNFLEENPKEAKLIVNKVILXXXXXXXXXXXXEMVQRKNVMGGSGLPGKLADCANKDPHVCELFLVEGDSAGGTAKQGRNRDFQAILPLKGKILNVEKAMEHKIYENDEIKNIFTALGVSIGKELNLEKLRYHKVIIMTDADVDGSHITTLILTFFFRYMKQLIEAGNIYIAAPPLYQVKKGKEFEYCWNDVQRDAAVQRLKGGGVHIQRYKGLGEMNAEQLWETTLNPETRTLKRATIESAAEADRIFSMLMGDEVAPRREFIEKNARYAK.... 649
152 0.000e+00T2D.3475701 [EC:5.99.1.3][KEGG:K02470] DNA gyrase subunit B;|[COG0187] Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit  ali  51  9...KKMSNNYDAEQIQVLEGLEAVRKRPGMYIGSTSTRGLHHLVYEIVDNSVDEALAGYCNHIEVFINPDNSITVVDNGRGIPVGIQEKTGKSALEVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVEVTRDGHVYKQTYKRGN-VDSTLQIIADAEDKSGTKVTFLPDKTIFDDWIYDYDTLRTRLRETAFLTKGLKITLTDLRVDPPKERHFHYEGGIKEFVEYMNRHREALYDKVIYCE----------GLKDGVYVEVAMQHNDSYNEMIHSYVNNINTPEGGTHLTGFKSAITKIFNDYARKNNLLKEKEDNLSGEDLREGMSAIVSVKIGEPQFEGQTKQKLGNSEVRPVVENIVSEQLTYFLEQNPNIAKIIINKSVMXXXXXXXXXXXXXXXXKANLADNMALPGKLADCSDKDPKNCEIYIVEGDSAGGSAKKARSRATQAILPLRGKILNVEKARIDRILENAEIKAMITAFGTGIHENFDIDKLRYNKIIIMTDADVDGAHIATLLLTFFYRFMPDLIRKGHVYLAQPPLYKLEKNKKIWYAYSDDELNSILNEVGRDSNKIQRYKGLGEMDAEQLWETTMDPEKRILLKVDDDDESEIDMTFNVLMGDKVEPRRQFIETNAKFVKNLDI 648
153 0.000e+00JGI.Meta JGI_HUM.3008069 7036511752 SRS015217_WUGC_scaffold_31562__gene_68617 DNA gyrase, B subunit [Human Stool microbiome from visit number 1 of subject 7  ali  51  1MQEEQIEDTYDENQIQVLEGLEAVRKRPGMYIGSTSSRGLHHLVYEIVDNSIDEALAGFCSRILVEIEEDNSITVTDNGRGIPTGIHPKMGISTVEVVFTQLHAGGKFGGGGYKVSGGLHGVGASVVNALSEYLEVEIKNGEHIFYQKYERG-QGVGSLKQIGETT-ETGTKVHFKPDGEIFEGLVYDYDVLRRRLREQAFLNAGINITLVDKRPEDKKMVELKYDGGIREFVEYLNRNKEVIHEDVIYVNSV----------REDSEAEVAMQYNDGYNEMIMSFANNINTTEGGTHETGFKSALTKVINDYARKTGMLKEADANLKGEDCREGLSCVISVKVTEAQFEGQTKTKLGNSEIRTIVEKMVNEKLGEFFEENPTIAKIVVDKAMTASRAREAAKRARESTRRKSALESSSLPGKLADCSDRDNTYTEIYIVEGDSAGGSAKQGRDRRFQAILPLWGKMLNVEKARIDKIYGNDKLTPVITALGAGIGDEFDLNKLRYGKVVIMADADVDGAHIRTLLLTFFFRYMRPLIEDGHVYIAQPPLYKISRGKIEKYAYTDQELQDILTEMGDGRPSVQRYKGLGEMNPSQLWDTTMNPDTRIMLRVDLEDAQQADETFTILMGDKVEPRRKFIEERGTSVINLDI 649
154 0.000e+00gi|655464464|ref|WP_028847417.1| DNA gyrase subunit B [Thermocrispum agreste]  clstr ali  50  1MAAKK--NEYSASSITVLEGLEAVRKRPGMYIGSTGERGLHHLIWEVVDNAVDEAMAGYATRVEVTLLADGGVRVEDDGRGFPVDEHPTMKKPGVEVALTVLHAGGKFDSKSYAVSGGLHGVGVSVVNALSKRLEVEIHRGGVIWTQKYVNSEP--GPLQKEGTTDR-TGTILSFWPDETIFETTYFNTETVARRLQEMAFLNKGLTMVLRDERKQXXTERTYYYPGGLVDFVKHINASRDTVHDKVISFEAKG----------DGMQVEVAMQWNTGYTPSVYTFANTINTHEGGTHEEGFRAALTRVVNAYARDKKLLKDKDANLTGDDVREGLAAIVSVKLAEPQFEGQTKTKLGNSEAKSFVQTTTNEWLADWFERNPSEAKLIISKAISSAQARLAARKARELVRRKGALDIGGLPGKLKDCRSTNPEECELYIVEGDSAGGSAKEGRDSRYQAILPIRGKIINVEKARIDKVLKNAEVQSLITALGTGIHEEFDISKLRYHKIVLMADADVDGKHITTLLLTLLFRFMTPLIEHGHVYLAQPPLYKIKWQRAEEYAYSDRERDGLLERGLNKDDGIQRYKGLGEMNADELWETTMDPANRILLQVTLDDAATADELFSVLMGDDVESRRAFITRNAREAGLLDI 653
155 0.000e+00gi|503420407|ref|WP_013655068.1| DNA gyrase subunit B [Cellulosilyticum lentocellum]  clstr ali  51  2......AATYDENQIQILEGLQAVRKRPGMYIGSTSSKGLHHLVYEIVDNAVDEALAGFCSFIKVTIHADNTISVIDNGRGIPVGIHPQKGISTVEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLTVEVYTDGKVHQEKFSRGD-VVQPLTVIGDTNKV-GTYVRFKPDTEIFEEVIFDYKVLEQRLKETAFLTKALKIQLVDEREGQEQNKTFHYEGGIKEFVQHLNKHKTPIYDEIFYCE----------GEKDGIAVEVAFQHNDSYVENLFSFVNNINTPEGGTHLSGFRTAITKNLNDYARKMGLLKDSDKNLTGDDIREGMTAVISIKIGDPQFEGQTKTKLGSSEAAGAVQSVFGDQLTYFLEQNPNVGKVIVQKGVMXXXXXXXXXXXXELTRRKSALEGNALPGKLADCSEKDASKCEIYIVEGDSAGGSAKSARSPKTQAILPLRGKILNVEKVRIDKMLENQEIRNMITAFGAGISDDFDISKLRYGKIILMTDADVDGAHIRTLLLTFLYRYYRELIEQDHVYIAQPPLYLVEKNKKKHYAFDDKELEKLLEEVGRTGITMQRYKGLGEMNAEQLWETTMDPESRVLVKVNIDDAAAADEIFTKLMGDDVEPRRQFINEHAHKVTYLDI 634
156 0.000e+00gi|499642726|ref|WP_011323460.1| DNA gyrase subunit B [Natronomonas pharaonis]  clstr ali  51  1MS---QDSEYSAGQIQVLEGLEAVRKRPAMYIGSTDTRGLHHLVYEVVDNAIDEALAGYCDTIEVVINDDGSVTVRDDGRGIPVDTHEDHDRPAVEVIMTVLHAGGKFDSKSYQVSGGLHGVGVSVVNALSKWLEVEIKRDGHVWHHRFDHGEPENG-LEQVREPNESTGTEIRFWPDDDIFETTDFTFSTLESRLRELAFLNPGVGITIRDERPEEPDASTFEYDGGIREFVAYLNETRDVLHENIIYFED----------EEDDIHVEVAMQATAGVQGSIHAFANNINTREGGTHLTGFKTALTRVINDYATSNGMLKDLDGNLKGEDIREGLTAVISIKHPDPQFEGQTKTKLGNGEVRGIVESAVHEELATHLEEHPDTAEAIISXXXXXXXXXXXXXXXXXLTRRKSALESTSLPGKLSDCQTRDPEESELFVVEGDSAGGSAKQGRNPEFQAILPLRGKILNVEKHRLDRILENNEIRNLITAVGTGIGEEFDIEEARYQKIIILCDADVDGAHIRTLLLTFLYRHMTPLIEAGYVYAAQPPLYRVRDGGDTYDAMTEAERDRIVEEVCDGSPDVQRFKGLGEMNPKQLWDTTMNPENRILKQITIEDAAAADRMFSVLMGDAVEPRKQFIKEHADEAEWIDI 639
157 0.000e+00METAHIT MH0063 GL0055526 [Complete] locus=scaffold98055_1:84:1997:-  ali  50  1MA--TAEKNYSSKNIQVLEGLEPVRTRPGMYIGSTGSAGLHHLVYEVVDNSIDEAMAGYCKNITVTIKKDNIIEVQDDGRGIPVDLHPKLKVSALEVVMTKLHAGGKFDNETYKVSGGLHGVGVSVVNALSKELIAEVSKDGKLYKQIYHKGVP-EAPVKEVGKSSK-NGTKVTFKADDEIFETTEYDYKILANRLRELAFLNRGIRITLIDKRESKTVSNEFYYEGGIEMFIAHLNENKKLLHDKPIYLHKT----------EDKTDIEVSMQYVDAYNENIFTYCNNINTTEGGTHLVGFRTALTRIYTDFAKKLELDKKNKVTFMGEDTREGLVAVVSVKIPNPQFEGQTKTKLGNTEVRAITEKLVFEGLNDYFSQNPKVIKVILEKIISAAQAREAARKARDLARRKNALESDSLPGKLADCSEQEVDKCEVYLVEGDSAGGTAKGGRDRHFQAILPLRGKVLNVEKARLDKIIDNESLKPIIAALGCGVGSSFDISRIRYGRVIIMADADIDGSHIRTLLLTFFFRYMRPLIDLGHIFIAVPPLYKISFDKKNFYAYSDEQRDKILEENKGKNSDIQRYKGLGEMNADQLWDTTMNPETRLMYQVLTEDAEKADQLFTMLMGDEVKPRRDFIEANARYVKNLDV 637
158 0.000e+00gi|551008725|ref|WP_022753294.1| DNA gyrase subunit B [Butyrivibrio fibrisolvens]  clstr ali  51  1MSNNEEVQ-YGADQIQILEGLEAVRKRPGMYIGTTAARGLHHLVYEIVDNSVDEALAGACDHIEVTITPGNTIIVKDNGRGIPTGINHKSGLTGVEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVKVKQGGKIYMQRYERG-HVCYPLKEIGTCEEDTGTCVEFKPDAEIFETTVFDYNVLRQRLREMAFLTRGLKISLTDERIKEPRVEHFHYEGGISEFVAYLNKSKTPLYDQIMYFE----------GDKNEVHVEVSVQHNDAYNESIYTFVNNINTPEGGTHLEGFKIATTKIFNDYAKAQKLVKETDENLTGEDIREGMTAIISVKIGDPQFEGQTKQKLGNSEARGAVASIVSEQLTYFLEQNPQIAKTIIEKAVLAQRARDAARKARDLTRRKTALDGLGLPGKLADCSDKNPENCEIFIVEGNSAGGSAKNARSRATQAILPLRGKILNVEKASVDRIYGNAEIKTMITAFGTGIHEDFDISKLRYGKIIIMTDADVDGAHIATLMLTFLYRFMPELIKQGHVYLAQPPLYKLERNKKTWYAYSDEELNNIIAQVGRDNNKIQRYKGLGEMDAEQLWETTMNPETRTLLRVNMDDDAESDVTFTTLMGDKVEPRREFIEANAKFVQNLDI 649
159 0.000e+00gi|503324206|ref|WP_013558867.1| DNA gyrase subunit B [Anaerolinea thermophila]  clstr ali  51  1MA-TPVNTSYGAKDIQVLEGLEAVRRRPGMYVGGTDLKALHHLVYEVVDNSIDEALAGACDHIQVTIHPDSSVTVEDNGRGIPVDIHPEKQKSALEVVMTVLHAGGKFGSGSYKVSGGLHGVGVSAVNALSEWCEVEVRRDGKVHFQRYERGVPV-EPVKVIGKCPNETGTKTTFRFDPTIFKDLDYKFDTLVQRFREMAFVTRKVTIRLIDERA--SREMSFYFEGGITSFVRYLNRNREVLHP-VVYAEK----------EVEGVGIEAAIQYTDAYAESVYSFANTINTIDGGTHLTGLRAAITRVINDYARRNNFLKDGDPNFSGDDTREGLTAIVSVKHPDPQFESQTKVKLMNPEVQTYVQQVVGEAFSTFLEENPQAAKAIIQKCLTSXXXXXXXXXXXXLVIRKSTLESLTLPGKLADCSERDPSKTELYIVEGDSAGGSAKQGRDRHFQAVLPLRGKILNTERARLDKILSNNEVKALISALGTGIGDSFDLSGLRYGRVIIMTDADVDGSHIRTLLLTFFFRYMLPLIEDGHLFIAQPPLYRIAYKNQVRYAYTDADRDRILKELGPEKASIQRYKGLGEMNPTQLWETTMNPENRTLLMVTVEDAAAADRTFDMLMGAAVPPRTKFIQTHARDVRNLDI 639
160 0.000e+00gi|548314142|ref|WP_022504158.1| dNA gyrase subunit B [Mycoplasma sp. CAG:776]  clstr ali  52  2......PNEYSDNDIQVLEGLEAVRKRPGMYIGSTSEKGLHHLVWEIVDNAVDEALAGYCDDIEVVIHKDNSVSVRDDGRGMPVGINAKTGLSTIETIFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSSWLEVRVYREGEVHYQRFENGGHPVAPMKVTEKCSERTGTTVTFKADPTIFETTEYSYEILENRLRELAFLNKGLRIILIDERVD-GKKATFCYNGGIIEYVAMLNKNKQPLHDDIIYVE----------GEENGVNIEVAMQYNDSYNSSLYSFTNNINTYEGGTHEDGVKFALTKIINNYARSNKMLKDNDDSLTGDDCREGLAMIISCKHPDPQFEGQTKTKLGNSEVRKIANDVFSEGFERFLMENPSVAKTIIEKCMTASRARIAAKKAREMTRRKGDLEVTNFFGKLVDCKSKDASISEIFLVEGDSAGGSAIKGRDSLTQAILPLRGKILNVEKARLDRALSNEEIRTIITAFGTGIGDDFNLDKLRYHKIIIMTDADVDGSHIRVLLLTLFYRFFKPIVEAGHVYAAQPPLFVIKHGKTIKYVLNEQERDEYLASLPTTKYDIARMKGLGEMDAEELNETTMDINKRVLRQITVDDTIAADEIFSKLMGEEVDPRREFIAENAQFAENLDI 637
161 0.000e+00gi|547185128|ref|WP_021927110.1| dNA gyrase subunit B [Alistipes sp. CAG:831]  clstr ali  48  3....EAEREYSADSIQVLEGLEAVRKRPSMYIGDIGPRGLHHLVYEVVDNSIDEALAGFCRNIEVTILPDNSIRVKDDGRGIPTGIHEKEGRSALEVVLTVLHAGGKFSKDSYKVSGGLHGVGVSCVNALSSYLKAEVHREGKIFVQEYSRGVP-QYPVKVVGECD-DTGTTITFTPDGEIFRTTVYDASVLATRLRELAYLNKGIHLTLIDEREHEPVRQEFYSEHGLVEFVQYLDGTREKLTDKPISLE----------TDKTGIPIEIAMQYNTGFSENIHSYVNNINTIEGGTHLTGFRRGLTSTLKAYAEKNGYLSKLKFDLDASDFREGLTAVISVKVAEPQFEGQTKTKLGNSEVDAAVSQATKAALETYLEENPKDAKNIIDKVILAATARHAARKARELVQRKTVMSGAGLPGKLADCSNRDPEKCELFLVEGDSAGGTAKTGRDRTYQAILPLRGKILNVEKAMEHKVLESETIRNIYTALGVTIGTEEDLDKLRYHKVIIMTDADVDGAHIATLILTFFFRYMPDMIKNGYVYIAAPPLYKVKKGKEEKYCWTEEERIAAIAEIGKGNIYVQRYKGLGEMNAEQLKETTMDPATRLLRQVTIDNAAEADRIFSMLMGDEVPPRREFIEMNAKYAK.... 656
162 0.000e+00gi|653090617|ref|WP_027340854.1| DNA gyrase subunit B [Halonatronum saccharophilum]  clstr ali  50  3.....VNKEYNAEQIQVLEGLEAVRKRPGMYIGSTGTKGLHHLVWEVVDNSIDEFLAGYGDKIEVSIEQGDIVTVRDYGRGIPVDIHPKKGLPAAQLVLTTLHAGGKFDGGGYKVSGGLHGVGISVVNALSEWLELEIHRGGYIYRQSYKQGIPV-SKFKK-GERTKETGTQIRFKADKEIFDKIDYKFDTLSTRLQESAFLNKNLKLVLTDNREDKQNEVEYCYSGGLEAFVKHLNESQTSLVDDIVYIEE----------EVDDTYVEVAFQYNKSYNESIYTFANNINTHDGGYHLTGFKAAITKAFNNYAKDNNLLKKKDPSLTGRDLREGLTAVVSVKLTEPQFEGQTKTKLGNSEIRSIVEKVVYDFLGYYLDTNPKLAKAVVEKALEAVRARKASKKARELARRKGILNNNSLPGKLSDCSSRKPEECELYLVEGDSAGGSAKQGRNREFQAILPLKGKIMNVERARLNKILKNTEIASVVTALGAGIGEEFDIEKLRYHKIVIMTDADVDGAHICTLILTLFYRYMPQLIEEGHVYIAQPPLYKVKYGKKEKYLYSDVQLKEHLKGKDRSRVTIQRYKGLGEMNPEQLWDTTMDPKNRKLQKIEVEDEIMADDIFNRLMGSKARLRREFIMKNANLADNIDI 635
163 0.000e+00gi|547962420|ref|WP_022362656.1| dNA gyrase subunit B [Eggerthella sp. CAG:298]  clstr ali  48  1MA--TKDSHYDGSDIQILEGLEAVRKRPGMYIGSTGPRGLHHLVYEVVDNAVDEALAGYCTDIVVTIHEDNSITVDDNGRGIPVDKHPKEKIPTVEVVLTILHAGGKFGGEGYKVSGGLHGVGVSVVNALSTKVVVQVRRDGTEYEISFDHG-KTKEKLHKIGSA-KHTGTTVTFWPDPEIFETTVYDYNTLAARFREMSFLNKGLKITLIDERDGKPTKEVFQALGGLQDFVKYINTGKETLNK-PIYFEVENADG----------MVEIAMQWTTSYSTNVLSFANNIHTIDGGTHLDGFKQGVTRTINDYARNKGILKDKDANLSGDDTREGLAAVISVKLRDPQFEGQTKGKLGNTEIRGLVQGAVTQGLAEYLEENPAPAKRIINKASQAFKAREAARKAREMTRRKGVLDSFSLPGKLADCSSKSPADSEIFIVEGDSAGGSAKMARDRKYQAIMPLRGKILNVERAGLNRSLSSDTISSLITAIGTNIGADFNADNARYHRIIIMTDADVDGAHIRCLLLTFFYRYMPELIQRGYIYIAQPPGLKKKGGKKLEYIFNDDALTKRLEEIPRDSISLQRYKGLGEMDPEQLWETTMEPKSRTLLQVSIEDAAEAERVVSELMGDQVEPRKEFIQKHAHDVRFLD. 645
164 0.000e+00METAHIT O2 GL0078602 [Complete] locus=scaffold17967_2:265:2187:-  ali  51  2.....KETHYTDNDIQVLEGLEAVRKRPGMYIGSTGERGLHHLVWEIVDNAVDEALAGFCDDIEVMIDKGDIIEVRDDGRGMPTGINAKTGLSTIETIFTVLHAGGKFGGEGYKVSGGLHGVGASVVNALSKWLEVRVYRDGNVYYQRFENGGKPVEDLKIIDSCDERTGTTVRFKPDEEIFETTVYNYDTLYKRLQEIAFLNKGLRINLYDLRDTVEKHDTFLYNGGIIEYVAMLNKSKTPIHDDIIYMD----------GSENGIELEVACQYNETYSPSIYSFTNNINTYEGGTHEDGVKAALTKVINNYAKNAKILKENDAPLIGEDCREGLTMIISCKHPDPQFEGQTKTKLGNSEVRKIASDVFSQGFERFLMENPNEAKIIVEKCISASRGRIAAKKAREATRRKSDLDIVNFGGKLVDCKEKDPSVCEIFLVEGDSAGGSAIKGRNSMTQAILPLKGKVLNVEKARLDRALSNDEIKTIITAFGTGIGQEFDLSKMRYHKVIIMSDADVDGSHIRVLLLTLFYRFFKPIVEAGYVYAAQPPLYCIKHGQTIKYVLNDDERDEYIKGLNEKNYDIARMKGLGEMDAEELNETTMDIEHRILRKITVEDAISADAAFSKLMGEEVEPRRKFIEENATYAKNLD. 639
165 0.000e+00JGI.Meta JGI_HUM.1873463 7079584188 SRS064276_LANL_scaffold_71076__gene_166038 DNA gyrase, B subunit [Human Stool microbiome from visit number 2 of subject  ali  50  12....ENANHYNENDIQVLEGLEAVRKRPGMYIGSTSARGLHHLVYEIVDNSIDEALAGRCDTVKVIINSDNSITVEDNGAGIPVGIHKQMGIPTVEVVHTVLHAGGKFGGGGYHVSGGLHGVGASVVNALSEYLEVEVSRDGKIYYQRYEKGN-TVTELKVIGEASH-TGTKTTFKPDGEIFEVLEFDYNILLSRFREMAFLNKGIKIILIDNRAEHPEEVTLHYEGGIISYVEYLNRKETVLHQPPIYI----------YGEKDGSSVEIAMQYNDSYVENIYCYANNIINHEGGTHLTGFRSALTKVFNDYARKYNFIKDNDKNLAGEDVREGLTAIISVKLENPQFEGQTKEKLGNSEIRTLVEGIVNDKLEAFLEENPSTSKLIFEKCLTXXXXXXXXXXXXXMTRRKSALEGTSLPGKLSDCSERDPALCEIYIVEGDSAGGSAKMGRQRETQAILPLWGKMLNVEKSRIDKVYGNEKLLPVITALGANVGPDFDVEKLRYHKIIIMADADVDGSHIRMLLLTFFYRYMRPLIEHGYLYIAQPPLYKVEKGKEFFYAFDDNELDQKVQEKGDKNLTIQRFKGLGEMKPEQLWDTTMNPATRIMLKVHLEDALIANEIFSDLMGEKVEPRKEFIQENAKFVQNLDI 649
166 0.000e+00gi|489624816|ref|WP_003529256.1| MULTISPECIES: DNA gyrase subunit B [Clostridiales]  clstr ali  52  1MENNQTNEEYGASDIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNAIDEALAGYCDKIDVRILPGDIIVVEDNGRGIPVGIQPKMGIPAVTVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTWLEVEVSDGAHIYRQRFERG-KTITDLEMIGDTTK-TGTKVTFQADPEIFESTVYEYETLETRLREQAFLNAGIHIELVDERDENRVQKNFLYEGGISSFVEFLHKRKEVIHPDIIHVKGALTDGSA--------EAEVAMQYNESYNELLISFANNIHTTDGGTHEEGFKRALTRIMNDYARKYNILKDGDKNLSGEDVREGLTAIISVKLKEAQFEGQTKAKLGNTEIRTLVDNLISEKLSAYLEENPATARAIFEKAMAASRAREAARKARELVRRKSALESAALPGKLADCQSRNPEETEIYIVEGDSAGGSAKGGRDRKFQAILPLWGKMLNVEKARLDKVYGNDKLMPVITALGCGIGDEFDLAKLRYGKVIIMADADVDGSHIRTLLLTFFFRFMKPLIEEGHIYIAQPPLYRLTKGKNHYYAYSDKERDQMLKEMTVTAP-IQRYKGLGEMDSEQLWETTMNPETRIMLKVELEDAAAADETFTILMGDKVEPRREFIEKNAKYVQNLDV 646
167 0.000e+00gi|504862081|ref|WP_015049183.1| DNA gyrase subunit B [Thermacetogenium phaeum]  clstr ali  51  13......DRDYDAAQIEVLEGMEAVRRRPGMYIGNTGARGLHQLVFELIDNSVDEHLAGYCDLIEITLHRDGSVTVRDNGRGIPVDIHPRTGRPAVEAALTMLHAGGKFGGNGYEISGGLHGVGLSVVNALSRWLLVEVRRDGRRYQQRYERG-QVKSPLKDAGAAE-GTGTTVRFLPDGQIFSERKFNREYITARVRDLSYLNKGLRFVLVDEVTGD--RQEFYHEGGIADFVRSLNKNKEVLHQDPLYF----------SDKKDGVVIEVALQYHTGYTEGIYSYVNNIHTQEGGTHEAGFKAALTRIINDYAKKSGYLKENMEKLSGEDTREGLTAVLSVKLKEPQFEGQTKTKLGNSEVRGIVESVVSEHLEEFFEENPGPSKLIVEKAVQXXXXXXXXXXXXXLTRRKTALDHISLPGKLADCTSKDPRECELYIVEGDSAGGSAKQGRDRRFQAILPLRGKIINAEKARLDKMLSNEEIKSIITAVGTGILDDFDLKKARYHRIIIMSDADVDGSHIRTLLLTFFYRYMRPLIEAGYVYIAQPPLYKVQKGKRIEYAYSDRELEKLLRNWKTDNVTIQRYKGLGEMNPEQLWETTMDPERRTMLQVTLTDAMLADEIFTILMGEKVEPRREFIQAHARDVRNLDI 642
168 0.000e+00gi|501115473|ref|WP_012164790.1| DNA gyrase subunit B [Acaryochloris marina]  clstr ali  50  2......ATNYSADQIQVLEGLEPVRKRPGMYIGSTGPRGLHHLVYEVVDNSVDEALAGHCKHIHIYLNEDGSVRVTDDGRGIPTDKHPTTGKSALETVMTVLHAGGKFDGDSYKVSGGLHGVGISVVNALSEWVEAKVWRNGKVHTQRFERGIP-KSELVVEPTDRKESGTAITFLPDDTIFTTTEFDYKTLASRLRELAYLNAGVEISFHDNRADEPKVETYRYDGGIKEYVDYMNRDKEPIHEECIYVE----------GERNNVQVEVALQWCDAYSDNLLGFANNIRTIDGGTHLEGLKTVLTRTMNSLARKRSKLKDGDSNLGGEHIREGLTAVISVKVPEPEFEGQTKTKLGNTEVRGIVDSLVGEVLTEYLDFHPNVADSVIEKALQAFNAAEAARRARELVRRKSVLESSTLPGKLADCSSRDPSTSEIYIVEGDSAGGSAKQGRDRGFQAILPLRGKILNIEKTDDAKIYKNNEIQSLITALGLGIGEEFDVSQLRYHRIILMTDADVDGAHIRTLLLTFFYRYQRELIDQGYIYIACPPLYKIERGRSHYYCYSDRELQNLVQEFPNANYTIQRFKGLGEMMPTQLWDTTMNPETRTLKQIDIEDAAEADRIFTILMGDRVAPRREFIETHGPNLAELDI 646
169 0.000e+00gi|551048356|ref|WP_022791690.1| DNA gyrase subunit B [Weissella halotolerans]  clstr ali  52  10....TQPDAYDASQIQVLEGLEAVRKRPGMYIGATSAQGLHHLVWEIVDNGIDEALAGFADHITVTVEQDNSITVTDNGRGIPTDTQKKTGKSALETVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSTFLDVTVVRDGQAYSMKFARG-HVVQEMQVTGQ-DISRGTIVHFLPDPDIFETTEFDIKTLTNRVRELAFLNKGLRISITDRRPAEPVVNSFHYEGGIKEYVEYLDVHKDVLFKDPVYVE----------GAENGIEVEVSLQYTDDYHINMMSFTNNIHTYEGGTHETGFKAALTRVINDYARKHGQLKENDEALTGEDVREGLTAIVSVKHPDPQFEGQTKTKLGNSDARTAVERTFSETFARFMMENPDVAKQIVEKGMLASQARKAAKRAREATRKKSGLEISNLPGKLADNTSKDPKISELFIVEGDSAGGSAKQGRERLTQAILPIRGKILNVEKASLDRILANDEIRSIFTAMGTGFGEDFDVEKANYHKFIIMTDADVDGAHIRTLLLTLIYRYMRPLLEAGYVYIAQPPLYQVRQGKFMQYIDSDEELATILPTLASPKPVIQRYKGLGEMDAEQLWETTMDPNKRRLLRVEMDDAVQADLVFSMLMGDKVEPRREFIEENAQYAE-LDV 647
170 0.000e+00gi|658522015|ref|WP_029716783.1| DNA gyrase subunit B [Atribacteria bacterium SCGC AAA255-G05]  clstr ali  50  2......DNQYTAKQIQVLEGLEAVRKRPSMYIGSTSSRGLHHLLDEVVDNSIDEAMANYCKKIEVIIHLDNSVTVTDDGRGIPVDIHKETKLPAVTIVMTKLHAGGKFGGSGYRVTGGLHGVGISVVNALSEWLEVEVYRDSGIFFQRFERGD-AVSELKKIGKSSR-TGTKITFKPDPTIFEDTTFNFDSITHRLREIAFLNAGVKINLKDEREEN-KEVSYKYTGGISEYVRHLNKNKDLLFPSPICF----------TGKKDDIEVEVALQYNDGYTENILSFANNINTEEGGTHLAGFKATITRIINDYARTNLLLKEGENNLSGNDVREGLTAVISVKLLNPQFEGQTKTKLGNSEVRGVVSYVVGEGLNNFLNENPSVTKKILAKSVSALNAREAARKARNLIRQKNGLGLGTLPGKLADCSEKDPLFREIFLVEGDSAGGSAKQGRDRRFQAILPLRGKILNVEKARLHKILDNNEIKSMVTALGINIGEDLDIEKLRYYKIIIMTDADVDGAHIKTLLLTFFFRYMKPLIERGNIYIAQPPLYKIEHNKESCYLYDEQELKDKLKEI-DGNPRIQRYKGLGEMNPEQLWETTMNPGNRVLKRIELEDNIDAETMFTVLMGDKVEPRREFIYKHSLEVKDLD. 639
171 0.000e+00gi|504365100|ref|WP_014552202.1| DNA gyrase subunit B [Halanaerobium praevalens]  clstr ali  52  2..DIKDRGNYEAEHIQVLEGLEAVRKRPGMYIGSTSLEGLHHLVYEVVDNSIDEAMAGYCSEVIVEIKPGNIIKVQDDGRGIPVEIHPKVDKPAVEVVMTTLHAGGKFGGEGYKVSGGLHGVGISVVNALTEWMEVEIWKDGKVYKQKYERGIP-QHELQLIGNCDNCTGTTIEFKPDPLIFEEIDFDFKLLAKRLKELAFLNKGINIKIVDNRKEEVQQEDFHFDGGLISFVEYLSQSKKPLLSEPIYIED----------EAEEGSIEVAIMYHQGYNTSLYTFANNINTKEGGTHLSGFKSATTRTFNDYARNKNLLKDGDDNLKGQDIREGMIAIISVKLSEPQFEGQTKTKLGNSEMRGFVDSAVSSFLKTYLEENPKVGKAIIEKAISXXXXXXXXXXXXDLTRRKSALTSTALPGKLADCSKRKADDTEVYIVEGDSAGGSAKQGRNREFQAILPLKGKILNVEKSRLNKILNNDEIRALITAIGTGVGEEFDLTNIRYDRIIIMTDADVDGAHIRTLLLTFFYRYMRPLLENGNIYIAQPPLYKVKKGRREEYVYNDKALKELIEEIGKDRVSMQRYKGLGEMNPSQLWDTTMDPENRILLQVDIEDAIRADETFSILMGDKVAPRREFIQKHAREVKNLDV 640
172 0.000e+00gi|512185244|ref|WP_016411867.1| dNA gyrase subunit B [Prevotella sp. CAG:1031]  clstr ali  49  1MSEEEGHEEYGASSIQVLEGLEAVRKRPAMYIGDISEKGLHHLVYEVVDNSIDEALAGFCTHIEVTINKDNSITVVDNGRGIPVGLHEKEHKSALEVVLTVLHAGGKFNKDSYKVSGGLHGVGVSCVNALSTYLRAEVRRDGKRYVQEYSCG-KPTTELRIEGEAS-DTGTSITFRPDPSIFTVTVYDYNTLANRLRDLAFLNAGITLALTDLRGEEPRKEVFYSKNGLREFVEYIDKNKEPLINDVIHL----------QTERSGIPVEVALTYNSTYNENIYSFVNNINTIEGGTHLTGFRRGLTQTLKKYAEDNKLLEKVKVEISGDDFREGLTAVISVKVMEPQFEGQTKTKLGNSEVIGAVQTAVSEALRDYLEENPRQAKAIVEKIVVTAQARYAARNAREKVLRKSPLVSGGLPGKLADCSSRHAEDCELFIVEGDSAGGTAKQGRNRTFQAVLPIRGKILNVEKAMEHKIFDNQEITSLFRALRVTVGDDVNINKLAYHKIVIMTDADVDGSHIDTLLMTFFFRRMRPVIENGYLYIATPPLYKCKCGKVEDYCWTEAQVQQFIERNGS-RTKVQRYKGLGEMSAEELRDTTMDPEQRLLKQVTISDAAEADRIFSMLMGEDVGPRRDFIEANA-NIANVD. 641
173 0.000e+00JGI.Meta JGI_HUM.5060993 7010462700 SRS018817_WUGC_scaffold_2072__gene_4730 DNA gyrase, B subunit [Human Stool microbiome from visit number 1 of subject 765  ali  47  1.........YSASNIQVLEGLEAVRKRPAMYIGDISEKGLHHLVYEVVDNSIDEALAGYCDHIEVTINEDNSITVQDNGRGIPVDFHEKEKKSALEVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTHMTTQVFRGGKIYQQEYSCG-HPLYSVKEVGTADI-TGTKQTFWPDDTIFTVTEYKFDILQARMRELAYLNKGITISLTDRRDGSFKKEIFHSDEGVKEFVRFLNRNNEALINDVIYL----------NTEKNNTPIECAIMYNTGYRESLHSYVNNINTIEGGTHEAGFRSALTRVLKKYAEDTKALEKAKVEISGEDFREGLIAVISVKVAEPQFEGQTKTKLGNSEVSGAVNQAVGEALTYYLEEHPKEAKQIVDKVILAATARIAARKARESVQRKSPMGGGGLPGKLADCSSRNPEECELFLVEGDSAGGSAKQGRSRAFQAILPLRGKILNVEKAMWHKAFESDEVNNIITALGVRFG--------------------VDGSHIDTLIMTLFYRYMPEIIENGHLYIANPPLYKCSKGKISEYCYTEEARQAFIQKYGDGGIHTQRYKGLGEMNPEQLWETTMNPETRILKQVTIDNAANVDYIFSMLMGDDVAPRREFIEKNATYA-NID. 620
174 0.000e+00gi|489652274|ref|WP_003556660.1| DNA gyrase subunit B [Lactobacillus buchneri]  clstr ali  51  1MADQKETNEYDASQIQVLEGLEAVRKRPGMYIGTTSSQGLHHLVWEIVDNGIDEALAGFATKITVTVEKDNSITVTDDGRGIPVDIQKKTGKPALETVYTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEELDVAVTRNGKVYYMDFSRG-HVTTPMKVIDHSDDLHGTKVHFLPDPDIFETTTFDIKVLTARLRELAFLNKELRIIVRDMRPEKPTEQDFLYEGGIRHYVEYLDKDKETLLKEPIYVE----------GMDNGITVEVAIDYSEDYHSTLMTFTNNIHTYEGGTHEEGFKRALTRVINDYARKNNLLKDNEANLSGEDVREGTTAVVSIKHPDPQFEGQTKTKLGNSDARTVTDRIFSDHFSKFLMENPKLARKIIDRGLLASKARSAAKRAREVTRRKSGLEISSLPGKLADNTSKDPKISELFIVEGDSAGGSAKQGRARLTQAILPIRGKILNVEKASMDRILANEEIRSLFTAMGTGFGDDFDLSKINYHKLIIMTDADVDGAHIQTLLLTLIYRYMRPLIDAGYVYVAQPPLYQVRQGKMQRYIDSDDDLNQFLGTLPSPKPVIQRYKGLGEMDAEQLWDTTMNPENRHLLRVESSDAAEANHVFSMLMGDKVEPRREFIEDNATFVENLDI 647
175 0.000e+00gi|502613446|ref|WP_012850399.1| DNA gyrase subunit B [Thermomonospora curvata]  clstr ali  50  3.........YDASSITVLEGLEAVRKRPGMYIGSTGERGLHHLVYEIVDNSVDEALAGYADTIEVTLLADGGVRVADNGRGIPVDEHPVEKRPAIEVVLTTLHAGGKFDGKSYAVSGGLHGVGSSVVNALSTRLDAEVRQKGYVWRQSYTRG--PIAPLAK-GEPTDETGTTITFWPDPEIFETVEWNFETLSRRLQEMAFLNRGLSITLTDERPGEPRRVVYCYEGGISDFVRYLNAKKDAVHPDVISFEEHT----------EGMSVEVAMQWSGSYTESVHTFANTINTAEGGTHEEGFRSALTSVVNRYARDKGLLREKDDNLTGEDVREGLTAIISIKLTNPQFEGQTKTKLGNTEARSFVQKTVHEHLKDWFDREPGQAKEIINKASXXXXXXXXXXXXXDLTRRKSLLESTSLPGKLADCQSTDPAKCELYIVEGDSAGGSAKGGRNPHFQAILPIRGKILNVEKARIDKILKNAEVQAIITALGTGVHDEFDISKLRYHKIILMSDADIDGHHINTLLLTLLFRFMRPLIEAGHVYLSQPPLYKIKWGQDAEYAYSDAERDAIIEAGPRPRDGVQRFKGLGEMNAQELWDTTMDPSRRVLLQVTLDDAAQADELFSVLMGEDVEPRREFIQRNAKDVRFLDI 649
176 0.000e+00gi|490486616|ref|WP_004355449.1| DNA-cytosine methyltransferase [Prevotella disiens]  clstr ali  48  28MADNENENNYSASNIQVLEGLEAVRKRPAMYIGDISEKGLHHLINETVDNSIDEAMAGYCSHIEVTINEDNSITVEDDGRGIPVDEHEKLHKSALEVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSSHMMSQVFRNGKIYQQEYEKG-KPLYSVKIVGDTDK-TGTRQQFWPDASIFTTTIYQWDIVARRMRELAFLNAGIKITLTDLRPNEEKQEVFHAQEGLKEFVRYVDRHRTHLFDDVIYL----------KTEKQGIPIEVAIMYNNDYNENIHSYVNNINTIEGGTHLTGFRTALTRTLKAYADNAKQIEKAKIEITGEDFREGLTAVISIKVAEPQFEGQTKTKLGNSEVSGAVQQAVGEALSYYLEENPAEAKLICDKVILAATARIAARKARESVQRKNVMTGGGLPGKLADCSNKDPKECEIFLVEGDSAGGSAKQGRDRYTQAILPLRGKILNVEKVQRHRVFEAESVMNIIQSIGVRFGSDFNTDKLRYDKIIIMTDADVDGSHIDTLIMTLFYRYMPRVIEEGHLYIATPPLYKCTFKKVSEYCYTEQQRLQFLEKYENKALHTQRYKGLGEMNPEQLWDTTMNPKTRLLKQVTIENATTADEMFSMLMGDDVEPRREFIEQNATYA-NID. 682
177 0.000e+00JGI.Meta JGI_HUM.1382202 7016840105 SRS052697_LANL_scaffold_27067__gene_47852 DNA gyrase, B subunit [Human Stool microbiome from visit number 1 of subject 7  ali  48  1MSEENTSTEYSADSIQVLEGLEAVRKRPSMYIGDTSEKGLHHLVYEVVDNSIDEALAGFCTQVDVVINEDNSISVTDDGRGIPVDIHEKEGVSALEVVLTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTYLRAEVRRDGKVHMQEFSCG-KPLHSIEVIGETD-VTGTTIMFKPDGSIFSVTEYKYEILAARLRELAFLNAGITLSLTDKRDGSYKSEIFRSEEGLKEFVRYIDRSKEQLIPDVIHI----------VTEKQGIPVEVAMTYNTSFNESVFSYVNDINTIEGGTHLAGFRRGLTRTLKKYADDSKLLEKAKVEISGDDFREGLTAVISIKVAEPQFEGQTKTKLGNNEVTGAVDQAIGEALGYYLEEHPKEAKIIVDKVILXXXXXXXXXXXXELVQRKSPMTGGGLPGKLADCSSKDAALCELFLVEGDSAGGTAKQGRDRNFQAILPLRGKILNVEKAMDHKVFESEEIQNIFRAMGVTIGKELNLSKLRYHKVIIMTDADVDGSHIATLILTFFFRRMRALIENGYVYLATPPLYLCKKGKVEEYCWTDQQRQAFIDKYGGGNIHTQRYKGLGEMNDHQLWDTTMNPENRTLKQITIDSAAEADQIFAMLMGEDVGPRREFIEENATYA..... 647
178 0.000e+00gi|167043616|gb|ABZ08310.1| putative DNA gyrase B, partial [uncultured marine microorganism HF4000_APKG2M17]  clstr ali  47  10MAENEASNQYGASNIQVLEGLEAVRKRPAMYIGDIGPRGLHHLVNEVVDNSIDEALAGHCDAIDVIIHEDGSISIKDNGRGIPVDMHPIEKRSALEVVMTTLHAGGKFDKDTYKVSGGLHGVGVSCVNALSEKLEASIWRDGALWKQTFEYGDPVGAVAKVRDMKDESTGTLVRFWPDGGIFQTTEFRFDRLADRLREMAYLNRHVYISIEDLREAEGLRDEYHFEGGIIEFVEYLDEARTPIHDETIYI----------ADEDAEVPVEMAMRYNSGYTENVLSFVNNINTHEGGTHVSGFRRALTRTLKSYADKNNLLKNVKVDLSGDDFREGITVILSIKVAEPQFEGQTKTKLGNSEVQGAVESLVFLKLGEWLDDHPKESKRIVEKVIIXXXXXXXXXXXXXLVQRKNAFSSGGLPGKLADCSSKNAEECEIYLVEGDSAGGSAKQARDRHFQAILPLRGKILNVEKARLDRILANEEIRNIVTALGTGLGDDFDPEKLRYHKIIVMTDADVDGAHIRTLLLTFLYRHMHALVEAGYIYIAQPPLYKAKKGKQEEYCWTDKQLKEVIERIGGDKVTIQRYKGLGEMNPDQLWDTTMNPETRLLQRITIDDAAAADRIFSTLMGDAVEPRRKFIERNAKYAT-IDV 655
179 0.000e+00gi|504615614|ref|WP_014802716.1| DNA gyrase subunit B [Turneriella parva]  clstr ali  51  35.....VSEEYNASKIQVLEGLEAVRKRPGMYIGSTDLPGLHHMVYEVVDNCIDEAMAGHCDTIEVEISKGNIISVSDNGRGIPVDIHPKVGVSTVEVVLTKLHAGGKFGDGAYKVSGGLHGVGVSVVNALSEWVEVDVHRDGKQHHIAFNRG-KTRAPLKAKGPS-KKRGTTVTFLADSQIFDTLEYRYDTLSSRLRELAFLNKNVKITIRDTREKEVKEHVFQYKGGIVEFVKMLTEKKNPLQKKPIY----------AIQQKDGIQVELAIEYCDTYSEQIFTFANAIHTREGGTHLEGFRTALTRALNEYKKKLGYDKKVEEPLTGDDVREGLVLVLSILIPNPQFEGQTKMKLGNGEVKGIVTSVVYEKLCEYFEENPQDAKRVIEKCMQAALARIAARKAKELVRRKSALEGAGLPGKLADCSAREPKDCELFIVEGDSAGGSAKQGRNRHFQAILPLKGKITNVEKTKLDKILGDGEVAALISAIGCGIGAEFNIDKLRYHKIVIMTDADVDGAHIQTLLLTFFFRHMPLLIEKGGLYIARPPLYLVSHGKEKFYAYSDQEKDKIIKGFKESKYVIQRYKGLGEMNPEQLWETTMDPARRVLMQVSVDDAVIADETFIILMGDEVEPRRRFIEDNAKKVEELDL 668
180 0.000e+00gi|492761199|ref|WP_005955350.1| DNA gyrase subunit B [Peptoniphilus harei]  clstr ali  50  1MAKDKR--HYDASDIQVLEGLDPVRKRPGMYIGSTGPRGLHHLVYEIVDNSIDEALAGICDHIIIKINKNGSVEITDNGSGIPVDIHPQTGKSTVETVLTILHAGGKFDNSAYKVSGGLHGVGVSVVNALSNKLVATVKRNGKIYRQEFARGIR-KSDLEVIGETNDETGTTIYFEPDDTIFETVEFSDEVLAKRFREMAFLNKGIKIEFIDERKD--LNEVFHYEGGIKSFVEFINAKKKPVHDEIIYIDEI----------REETAVEIAIQYTDSYSEVVLSFANNINTEEGGTHLSGFRSALTRTLNDYGRKNNIIKEKEENLSGEDVREGISAVISVKLPDPQFEGQTKGKLGNSETRGIVDSVLSEDLAVFLEENPRVGKQILDKALSXXXXXXXXXXXXDLTRKKNNLESMTLPGKLADCQNDDPKRNEIFLVEGNSAGGSAKDGRDSAYQAILPLRGKIMNVEKARLDRMLNSSEIRAMITAFGTGIGEEFDLEKLRYDKIIIMTDADVDGAHIMTLLLTFFFRYMKPLIEEGHVYVAQAPLYGIEKGKILRYCHNEKELRLALKEYKDSKVNIKRYKGLGEMDPEQLWETTMNPDNRLLLKVNIDDLAEADDTFSILMGTEVEPRRDFITENAVYADYID. 636
181 0.000e+00gi|499958741|ref|WP_011639475.1| DNA gyrase subunit B [Syntrophomonas wolfei]  clstr ali  50  3......EREYNASDIQVLEGLEAVRKRPGMYIGSTGPKGLHHLVFEIVDNSIDEAVAGFCKKIEVTINQDNSITVCDDGRGIPVDIHPAMGIPALQVILTTLHSGGKFGGSGYNISGGLHGVGLSVVNALSRRMEVRVKRDGHIYQQDYERGNPV-NEIRIIGES-KETGTSICFFADDEIFEEINFEREILLQRLRELSFLNRNLKISLRDEREEEVFYQEFHYSHGLKDFVAYINKNKEVINDNPIYFEN----------KKDDVIVQVAIQYNNSYSENLYSFANNIRTQEGGTHEIGFKNALTRVINDYAKKNNILKENDNNLSGEDIREGIAAIISVLVKDPQFEGQTKTKLGNTYIRGIVESIVFEHVEDYLNENPAAARKLLDKAISXXXXXXXXXXXXXLTRRKNALESTALPGKLADCSNKNPAESELFIVEGDSAGGSAKQGRDRTYQAILPLRGKILNVEKARLDRVLSSEEIRNLITAMGTGIGEDFDIKKARYHKLFIMTDADVDGSHIRVLLLTFFYRYMKELIEEGYLYIAQPPLYGLKRGKEIKYFYNDADLNAFLSQT-EQKWSIQRYKGLGEMDPEQLWTTTMDAESRTVLKVTIEDAIKANDIFSALMGDNVQPRREFIESNARYVANLDI 633
182 0.000e+00gi|406883600|gb|EKD31155.1| hypothetical protein ACD_77C00384G0005 [uncultured bacterium]  clstr ali  48  1MKENESTFDYSADSIQVLEGLEAVRKRPSMYIGDIGSRGLHHLVYEVVDNSIDEAMGGFCTHIDVVINPDNSVSVSDDGRGIPTDMHEKEGRSALEVVLTVLHAGGKFSKDSYKVSGGLHGVGVSCVNALSSHLTAEVYREGKYFIQEFAKGIP-MYPVKTVGESDR-RGTVITFKPDVEIFNGTTYNYDILATRLRELAFLNKGVVLSLTDLREETARQETFVSQLGLLEFVQYLDGTREKLTEKPIYLE----------GDKGGIPIEIAMQYNTGFSENIHSYVNNINTIEGGTHLSGFRRGLTTTLKAYADKNGLLSKLKFDIDATDFREGLTAIISVKVAEPQFEGQTKTKLGNSEVMAAVSQATTVALENYLEENPKDAKNIVDKVILAATARHAARKAREMVQRKTVMSGSGLPGKLADCSDRDPSKCEIFLVEGDSAGGTAKTGRDRAFQAILPLRGKILNVEKAMEHKVFENEEIRNIYTALGVTIGTELNISKLRYHKVILMTDADVDGSHIDTLILTFFFRYMQDLIKNGYVYIATPPLYLVKKGKQEQYCWSEDDRKEAIEQIGRGKLHVQRYKGLGEMNAIQLWDTTMDPGTRLLRQVTIDNAAEADRIFSMLMGDEVPPRREFIETHAKYA-NIDV 667
183 0.000e+00METAHIT V1 GL0071369 [Lack 5`-end] locus=scaffold1672_6:2:1954:+  ali  50  14.AGENGKSDYGAKDIRVLEGLEAVRLRPGMYIGSTSARGLHHLVYEVVDNSIDEALAGFCTHIEVTLNDDGSCTITDNGRGIPTGIHE-TGKPAMEVVLTVLHAGGKFGGDGYPISGGLHGVGISVVTALSEWTTVTVKREGHFHEMKLARGV-VTQHMKTFGETTETG-TQVTFKPDGEIFEGTDFDYDTLKVRMRELAFLNKGLTITLTDVRDGATHQDVFCYAGGIVEFIKFLNEGKDLVDPGVISFE----------GEKDRVIVDIAMQYQAGYSESMYTFVNNINTVEGGMHLTGFRNALTRTINDYARSNNLLKPNEENLSGDDVREGLTCVISVKVPNPQFEGQTKTKLGNQDVKGIVDTIVSDGLRTYLEEHPAEAKEIISKSITXXXXXXXXXXXXXLTRRKNALEVSSLPGKLADCSEKDPKFTEIYIVEGDSAGGSAKSGRDRRYQAILPLRGKILNVEKARLDKVLNSDAIRTMITAFGTGVAEDFDIKKLRYYKIIIMTDADVDGAHIRTLLLTFFYRYMKPLITEGHVYIAQPPLYQVRKGRQKYYTYDDVEQDKLLNEIGRDGCAIQRYKGLGEMNPEQLWDTTMNPEQRVMLKVELTDAVEADRLFTILMGDKVEPRRKFIEDNAKNVSNLDL 650
184 0.000e+00JGI.Meta JGI_HUM.3711132 7067050650 SRS062544_LANL_scaffold_69498__gene_88044 DNA gyrase, B subunit [Human Tongue dorsum microbiome from visit number 3 of s  ali  53  2......SAEYGADQIQILEGLEAVRKRPGMYIGSTSLKGLHHLVYEIVDNSVDEALAGECSHIEVFINEDNSITVVDDGRGIPVGINKKSGLPAVQVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSKWLEVLVETDGKAYKQRYERG-KVVTPLEEIGPTDR-HGTTVTFLPDEEIFEDTVFDYATIKQRLREMAFLTKGLRISLTDKREDGKKTDSFHYEGGIMEYVSYLNKNQTVLYDKIIYCE----------GKKGTVQVEVALQHNDGYNEGCYSFVNNINTPEGGTHLTGFRNALTKTFNEYAKLMKLVKENDPALTGEDIREGMTAIVSIKIPEPQFEGQTKQKLGNSEARGAVESIAGEQIMIFLEQNPAIGKMIVEKALLAQRARDAARKARDLTRRKTALEYMNLPGKLADCSDKNPDNCEIYLVEGDSAGGSAKDARDRATQAILPLRGKILNVEKSRLDKILENKEIQSMITAFGTGIHEDFDINKLRYKKIIIMTDADIDGAHIDTLMLTFIYRFMPELIRKGHVYLAQPPLYKVEKGNKIWYAYNDKELENIMSEIGRDNNKIQRYKGLGEMDAEQLWETTMDPERRVLLKVMMENASEIDLTFNTLMGDKVEPRREFIEQNAKYVRNLDI 636
185 0.000e+00JGI.Meta JGI_HUM.6250042 7036961222 SRS021954_Baylor_scaffold_55432__gene_62719 DNA gyrase, B subunit [Human Tongue dorsum microbiome from visit number 2 of  ali  51  1MEENM---SYEAQNITVLEGLEAVRKRPGMYIGTTSERGLHHLVWEIVDNSVDEALAGYCNKIEVKILPDNIIEVVDNGRGIPTDIHPKYGKSALEIVLTVLHAGGKFENDNYKVSGGLHGVGVSVVNALSEWLEVEVRKEGNVYYQKYHRG-KPEEDVKIIGSCESEHGTTVRFKADGDIFETLVYNYFTLSNRLKELAYLNRGLTITLSDLRKDEKKEETYKFDGGILDFLNEIVKEETTIIDKPFYVSA----------EQDNVGVDVTFTYTTSQNEVIYSFVNNINTHEGGTHVQGFRTALTKVINDVGKAQGLLKDKDGKLMGNDIREGVVAIVSTKIPQPQFEGQTKGKLGNSEVSGIVNTIVSNSLKIFLEDNPAITKIVVEKILNSKKAREAAQKARELVLRKSVLEVGSLPGKLADCTSKKAEECEIFIVEGDSAGGSAKQGRDRYNQAILPLRGKIINVEKAGLHKSLESSEIRAMVTAFGTSIGETFDISKLRYGKIILMTDADVDGAHIRTLILTFLYRYMRDLITEGNIYIACPPLYKVASGKQIIYAYNDLELKNILAQMNNKKYTIQRYKGLGEMNPEQLWETTMNPDGRLLLKVSIDNAREADMLFDKLMGDKVEPRREFIEEHAEYVKNIDI 639
186 0.000e+00gi|652829666|ref|WP_027114673.1| DNA gyrase subunit B [Lachnospiraceae bacterium NK4A144]  clstr ali  52  2......SQEYGADQIQILEGLEAVRKRPGMYIGSTSARGLHHLVYEIVDNSVDEALAGFCTNIHVWIKPDNSIVVEDDGRGIPVGINHKSGLPGVEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSTWLTVNVYSEGKIYEEKFARGQK-LSDLTVVGECDEKHGTRVSFLPDPEIFETQVYDFSVLRQRLREMAFLTKNLRIELHDERPGQEKDEKYHYEGGIKEFVKYLNKSTTSLYDDIIYCE----------GARGNVYVEVAMQHNDSYNESSYSFVNNINTPEGGTHLTGFRNAITKTFNEYARKNKILKDSEDNLSGEDIREGLTSIVSIKIEDPQFEGQTKQKLGNTEARNAVESLFTEQLTYYLEQNPNVAKIICEKSIQSQRAREAARKARDLTRRKSALDGLSLPGKLADCSDKNPKNCEIFIVEGDSAGGSAKTARSRATQAILPLRGKILNVEKARLDRVYGNEEIKAMITAFGTGIHDDFDISKLRYDKIIIMTDADVDGAHIATLMLTFIYRFMPELIKQGHVYLAQPPLYKLEKNKKVWYAYSDEELAKIIDEVGRDNNKIQRYKGLGEMDAEQLWETTMDPAKRVLLRVAMDEESVSDLTFMTLMGDKVEPRREFILENAKYVKNLDI 639
187 0.000e+00gi|662568114|gb|KER09263.1| DNA gyrase subunit B [Chlorobium sp. GBChlB]  clstr ali  48  1MAKDNSKQNYGADNIQVLSGIEHVRKRPAMYIGDVGVRGLHHLVYEIVDNSVDEALAGHNDFIYVSINQDGSVTVTDRGRGIPTGIKKDTGKSALELVMTVIGAGGKFDKNSYKVSGGLHGVGASVVNALSEWCEVEVRREGKIFYQKYKRGVP-EAPVKEVGKTESDHGTKTTFMPDSQIFKNREFRYDTLADRLRELAYLNRELKIIIEDKRSD--KRDEFHFKGGIQEFVVDLDKNRMALFKKPIYME----------GEKDGTFVDIALQYNNSYQENVFSYVNNINTHEGGTHLTGFRKAFTRTMNTYATKNDLLKSKNIQLTGDDYREGLTAIVSVKVPEPQFEGQTKTKLGNGETQTIVETIVNEKLAEFIEQNPSTAKIIIEKAIGAATAREAARKAKELTRRKSALDSYSLPGKLADCSISDPEHCELYIVEGDSAGGSAKQGRDRRFQAILPLKGKILNVEKARLNKMLENEEIRTIITALGTGIGDDFDPTKIRYGKLILMTDADIDGAHIRTLLLTFLFRYMRALIEAGRVYIAQPPLYLVKRGKEQVYAWDDEERDDAIKRFGKDNIMVQRYKGLGEMNPEQLWTTTMDPENRTLLKVSIDSALEADKIFSTLMGDEVEPRRKFIESNAKYVRRLDV 650
188 0.000e+00JGI.Meta JGI_HUM.1621528 7023454748 SRS022602_Baylor_scaffold_122708__gene_167976 hypothetical protein [Human Supragingival plaque microbiome from visit num  ali  50  1MSAIMSQSNYSASNITVLKGLEAVRKRPGMYIGSTGPNGLHHLVYEVVDNCIDEAMAGFCNKIIVVLEAGNVVRVEDNGRGIPVDVHAEEGVSALELVMTRLHAGGKFDKGSYKVSGGLHGVGVSVVNALSNWLEARVYRDGGEYYAKFEKGE-IVTPVKKIGSSSR-RGTVVRWAADPSIFETVTYNFDVLSSRLRELAFLNSSISIVLRDERLTTPKEVTFAFEGGISHFVSYLNESKQILPKEPIYVE----------GEKSDVVSEIALQYNDGYNENILSFVNDINTHEGGTHLDGFKHALTRVMNDFLKKNPKLLEKEEKLAGEDVRAGLTAIISVKVPEPQFEGQTKTKLGNSEVRSIVDSIFSEKITLYFEQNPQTIEKILEKCVAEATARIAARKAKEATRRKSGIDSFGLPGKLADCSMKDPAMCEVYIVEGDSAGGSAKKGRDSKTQAILPLWGKMLNVEKTRLDKVISNEKLQPIIATLGTGIGDDFNIEKIRYHKIIIMADADVDGSHIRTLLLTFFFRYMPKLIEEGYVYLAMPPLYKVSHNKKEWYVYDDNEREALLKKIGSGNVAVQRYKGLGEMDGTQLWDTTMDPAKRKMMRVTLPDALEADRTFSTLMGEEVEPRRKFIEENAVYA-NLDV 642
189 0.000e+00gi|501491649|ref|WP_012500095.1| DNA gyrase subunit B [Chloroherpeton thalassium]  clstr ali  49  1MSEEEKSLEYGASNIQVLDGIEHVRRRPAMYIGDVGVRGLHHLVYEIVDNSVDEALGGYNDYIFVQIKSNGSILVRDKGRGIPTDIHPQKNTSALQLVMTVIGAGGKFDKGAYKVSGGLHGVGASVVNALSEWCEVEVYREGKIFFQGYEKGIP-KAPVSVIGTTS-ENGTKTTFLPDESIFKNREFRYDTLADRMRELAYLNKNLTIVIEDERDG--RRDEFHFKGGIQEFVTFMDSTRLKLIKEPIYFE----------GEKDGTVVEIAFQYNDSYQENAFSYVNNINTHEGGTHVTGFRKALTRTLNYYGQKNDLFKNLKISLTGEDFREGLTAILSVKVPEPQFEGQTKTKLGNSETQSIVESIVNEKLAEYIEQHPNEVKIILEKVVSAAIARDAARKAKDLTRRKSALESSSLPGKLADCSINDPEHCELYIVEGDSAGGSAKQGRDRRFQAILPLKGKILNVEKARLNKMLENEEIRTLIMALGTSIGEDFDASRLRYGKIILMTDADVDGAHIRTLLLTFFFRYMRGLVEGGRVFIAQPPLYLIKSGKQQWYAWDDDERDDILKQFGKENYGIQRYKGLGEMNADQLWSTTMDPEKRTLLMVTIENAMEADKIFSTLMGDQVEPRRAFIETNAKYVRRLDV 644
190 0.000e+00gi|551064027|ref|WP_022796106.1| DNA gyrase subunit B [Bavariicoccus seileri]  clstr ali  52  1MSEEELAHEYNASQIQVLEGLEAVRKRPGMYIGSTSSTGLHHLVWEIVDNSIDEALAGFATKIMITINKDNSITVLDDGRGIPVDIQQHTGRPAVETVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSSKLTVQVFKDGIIYQQEYERGV-VKYDLKKVGETT-EHGTKVHFIPDKEIFETTEFDYNTLMTRVRELAFLNKGLNLTLTDLRGEEPVSEKFHYEGGIKSYVSYLDRNVDVLFDEPIYLE----------GEQDSILVEVSLQYTNTYKTTLMSFTNNIHTYEGGTHEAGVKTALTRVINDYARKNNLMRDNEANLSGEDVREGMTMVLSIKHPDPQFEGQTKTKLGNSEARTITDRLFSVHFDRFMMENPTIARQIVDKGLLASKARLAAKRAREVTRKKSGLEISNLPGKLADCSSNDPSINEIFIVEGDSAGGSAKTGRSRHFQAILPIRGKILNVEKASIEKILANQEIRSLFTAMGTGFGGDFDVSKARYHKVIIMTDADVDGAHIKTLLITLFYRYFRPIVEKGYLYIAQPPLYKVKQGKNEEYLNSDEELTELLKTLPKPKPLINRYKGLGEMNAEQLWETTMDPENRYLSQVDIGDAEEANQVLDMLMGDRVEPRREFIEDNAVYVDNLDI 645
191 0.000e+00METAHIT V1 GL0107692 [Complete] locus=scaffold15858_6:6253:8178:-  ali  51  1MTMEN--DNYGAEQIQVLEGLEAVRKRPGMYIGSTSSTGLHHLVYEIVDNSVDEALAGYCTHIQVYINEDNSITVVDDGRGIPVGIHKKQGIPAVEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSTWLEVEITRDGKVYKQRYEKG-KVMYKLQVIGEAPEGSGTKVTFLPDHTIFEDNIYDYDILRNRLREMAFLTKGLKISLTDKRLIPEKVRSFHYEGGIKEFVTYLNRHRDPLYNEVIYCE----------GVRDGISVEVALQHNDSYNESTYSFVNNINTPEGGTHLTGFKSAITKVFNDYARKNNIIKDKDDNLSGDDLREGLAAIVSIKISDPQFEGQTKQKLGNSEARPAVESVVTEQLTYYLEQNPQIAKIIVNKAAVAQRARIAARKARDVARKANLSDNMALPGKLADCSDKDPKNCEIYIVEGDSAGGSAKTARSRATQAILPLRGKILNVEKARIDRILGNEEIKAMITAFGTGIHENFNIEKLRYNKIIIMTDADVDGAHIATLLLTFFYRFMPDLIRKGHVYLAQPPLYKLEKNKKVWYAYSDDELNSILDEVGRDNNKIQRYKGLGEMDAEQLWETTMDPEKRILLRVDDDDESEIDMTFNVLMGDKVEPRREFIETNAKYVKNLDI 641
192 0.000e+00JGI.Meta JGI_HUM.1375160 7016802350 SRS052697_LANL_scaffold_7057__gene_10097 DNA gyrase, B subunit [Human Stool microbiome from visit number 1 of subject 70  ali  46  1....................LEAVRKRPAMYIGDISIKGLHHLVYEVVDNSIDEALAGYCDHIEVTINEDNSITVQDNGRGIPVDFHEKEQKSALEVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTHMTTQVFRNGKIYQQEYECG-HPLYSVKEVGVTEI-TGTRQQFWPDDTIFTETVYNYDILATRMRELAYLNAGIKITLTDLRDGNYKQEIFYSVEGLKEFVRYIDSSREHLVNDVIYI----------NTEKQGTPVEVAIMYNTSYNENIHSYVNNINTIEGGTHLAGFRRALTRTLKKYAED