current user: public




Query: gi|13507742|ref|NP_109691.1| DNA gyrase subunit B MPN003 [Mycoplasma pneumoniae M129], from M.pneumoniae

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650
# E-value Template Links and tools%idFirst MEDNNKTQAYDSSSIKILEGLEAVRKRPGMYIGSTGEEGLHHMIWEIIDNSIDEAMGGFASTVKLTLKDNFVTIVEDDGRGIPVDIHPKTNRSTVETVFTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSSFKVWVAREHQQYFLAFHNGGEVIGDLVNEGKCDKEHGTKVEFVPDFTVMEKSDYKQTVIASRLQQLAFLNKGIQIDFVDERRQNPQSFSWKYDGGLVQYIHHLNNEKEPLFEDIIFGEKTDTVKSVSRDESYTIKVEVAFQYNKTYNQSIFSFCNNINTTEGGTHVEGFRNALVKIINRFAVENKFLKETDEKITRDDICEGLTAIISIKHPNPQYEGQTKKKLGNTEVRPLVNSIVSEIFERFMLENPQEANAIIRKTLLAQEARRRSQEARELTRRKSPFDSGSLPGKLADCTTRDPSISELYIVEGDSAGGTAKTGRDRYFQAILPLRGKILNVEKSHFEQIFNNVEISALVMAVGCGIKPDFELEKLRYNKIIIMTDADVDGAHIRTLLLTFFFRFMYPLVEQGNIYIAQPPLYKVSYSNKDLYMQTDVQLEEWKQQHPNLKYNLQRYKGLGEMDAIQLWETTMDPKVRTLLKVTVEDASIADKAFSLLMGDEVPPRREFIEQNARNVKNIDILast
1 0.000e+00gi|501115473|ref|WP_012164790.1| DNA gyrase subunit B [Acaryochloris marina]  clstr ali  50  4........NYSADQIQVLEGLEPVRKRPGMYIGSTGPRGLHHLVYEVVDNSVDEALAGHCKHIHIYLNEDGSVRVTDDGRGIPTDKHPTTGKSALETVMTVLHAGGKFDGDSYKVSGGLHGVGISVVNALSEWVEAKVWRNGKVHTQRFERGIPK-SELVVEPTDRKESGTAITFLPDDTIFTTTEFDYKTLASRLRELAYLNAGVEISFHDNRADEPKVETYRYDGGIKEYVDYMNRDKEPIHEECIYVEG----------ERNNVQVEVALQWCDAYSDNLLGFANNIRTIDGGTHLEGLKTVLTRTMNSLARKRSKLKDGDSNLGGEHIREGLTAVISVKVPEPEFEGQTKTKLGNTEVRGIVDSLVGEVLTEYLDFHPNVADSVIEKALQAFNAAEAARRARELVRRKSVLESSTLPGKLADCSSRDPSTSEIYIVEGDSAGGSAKQGRDRGFQAILPLRGKILNIEKTDDAKIYKNNEIQSLITALGLGIGEEFDVSQLRYHRIILMTDADVDGAHIRTLLLTFFYRYQRELIDQGYIYIACPPLYKIERGRSHYYCYSDRELQNLVQEFPNANYTIQRFKGLGEMMPTQLWDTTMNPETRTLKQIDIEDAAEADRIFTILMGDRVAPRREFIETHGPNLAELDI 646
2 0.000e+00gi|551008725|ref|WP_022753294.1| DNA gyrase subunit B [Butyrivibrio fibrisolvens]  clstr ali  51  1MSNNEEVQ-YGADQIQILEGLEAVRKRPGMYIGTTAARGLHHLVYEIVDNSVDEALAGACDHIEVTITPGNTIIVKDNGRGIPTGINHKSGLTGVEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVKVKQGGKIYMQRYERG-HVCYPLKEIGTCEEDTGTCVEFKPDAEIFETTVFDYNVLRQRLREMAFLTRGLKISLTDERIKEPRVEHFHYEGGISEFVAYLNKSKTPLYDQIMYFEG----------DKNEVHVEVSVQHNDAYNESIYTFVNNINTPEGGTHLEGFKIATTKIFNDYAKAQKLVKETDENLTGEDIREGMTAIISVKIGDPQFEGQTKQKLGNSEARGAVASIVSEQLTYFLEQNPQIAKTIIEKAVLAQRARDAARKARDLTRRKTALDGLGLPGKLADCSDKNPENCEIFIVEGNSAGGSAKNARSRATQAILPLRGKILNVEKASVDRIYGNAEIKTMITAFGTGIHEDFDISKLRYGKIIIMTDADVDGAHIATLMLTFLYRFMPELIKQGHVYLAQPPLYKLERNKKTWYAYSDEELNNIIAQVGRDQNNIQRYKGLGEMDAEQLWETTMNPETRTLLRVNMDDDAESDVTFTTLMGDKVEPRREFIEANAKFVQNLDI 649
3 0.000e+00gi|772543281|ref|WP_045247911.1| DNA topoisomerase IV subunit B [Microbacterium ginsengisoli]  clstr ali  48  17.APASTPGEYGADAIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNSVDEALAGYCDTIDVTILADGAVRVIDNGRGIPVDIHKTEGKSTVEVVLTVLHAGGKFGGGGYAVSGGLHGVGSSVVNALSTRLEVEVKRQGHVWRQSYTSGGAPVAPLAK-GEETDETGTTITFWPDPEIFETVVFDYDTLRTRFQQMAFLNKGLTIALRDERADEAYEEVYLYERGLVDYVQYLNSVREAVNDEIIDFDSEDTEKK--------IALEIAMQWTTSYTENVFTYANTINTHEGGTHEEGFRAALTTLVNKYARAQGLLKEKDDNLSGDDVREGLTAVISVKLSEPQFEGQTKTKLGNTEAKAFVQKVVGDQLGDWFDRNPAQAKNIVRKAIDAATARIAARKARETARRKSVFESASMPEKLKDCTSKDPSISEIFLVEGNSAGGSAVQGRNPHTQAILALRGKVLNVERARLDRALGNKEITEMIQAFGTGIGEDFDITKARYHKIVLMADADVDGQHITTLLLTLLFRYMRGLIEAGYVYLAQPPLYRLKWSNDHQYVYSDRERDALLKRIPKDN-GIQRYKGLGEMNPKELWETTMDPVTRTLLQVTIEDAAAADEIFSTLMGEDVESRRSFIQRNAKDVRFLDI 678
4 0.000e+00gi|653182890|ref|WP_027419371.1| DNA gyrase subunit B [Crocinitomix catalasitica]  clstr ali  48  1MSEEKNNGGYSADSIQALEGMEHVRMRPSMYIGDVGYRGLHHLVYEVVDNSIDEAMAGHCDEVEVVILEGNGVRVTDNGRGIPIGMHAKEKVSALEVVMTKIGAGGKFDKDSYKVSGGLHGVGVSVVNALSRHLKAEVRREGKLYVQEYERGKP-LYPVKEDGVST-ENGTTVTFFADGQIFDELDYTYDILASRMRELSFLNKGLRLIIRDEREGNFKEDNFFSEIGLSEFVRFLDESREPLIEEVIHVSG----------EKNGVPVEVAMIYNTSYAENLHSYVNNINTHEGGTHLSGFRRGLTSTLKKYADESGMLDKLKFEIAGDDFREGLTAVISVKVAEPQFEGQTKTKLGNREVNAPVSQAVSEMLSDYLEENPKDARRIIEKVILAATARHAARKAREMVQRKSVLTGTGLPGKLADCSSKDPAESEVYLVEGDSAGGTAKQGRDRHFQAIMPLRGKILNVEKAMVHKIFENEEIKNIYTALGVRIGTELNLEKLRYHKIIIMCDADVDGSHIETLILTFFFRYMRELIELGYIYIATPPLYQVKKGKKSHYAWNDDQRDKLVMDMKGAGVNVQRYKGLGEMNAEQLWDTTMNPEFRTLRQVQIENAIESDRTFSMLMGDEVAPRRAFIEKNAKYA-NID. 650
5 0.000e+00gi|684288556|gb|KGA08218.1| hypothetical protein GM45_6205 [actinobacterium acAMD-5]  clstr ali  49  2........SYDASAIQVLEGLDAVRKRPGMYIGSTGERGLHHLVYEVVDNSVDEALAGHCTHIEVTILSDGGVRVVDNGRGIPVDIVPSEGKPAVEVVLTVLHAGGKFGGGGYAVSGGLHGVGVSVVNALSKKVDVEVGREGFTHTQSYKYGVPV-APLKK-GKKVSTTGTTITFWADGDIFETTVYDFETLSRRFQEMAFLNRGLTLSLTDERPATPRHVSYMYEGGITDFVKYLNTRKTPVHNDIVEF--------FLEDSKRGLSLEVAMQWNSTYSESVHTFANTINTVEGGTHEEGFRTALTSLVNKFAREWNILKEKDTNLSGEDVREGLTAIVSIKLHEPQFEGQTKTKLGNTEAKTFVQKVVNEELAAWFEKNPAQGKDIARKSLQAATARLAARKARDLARRKGLLGSSSLPGKLKDCSSNQPAECEVYIVEGDSAGGSAGQGRDPRTQAILPIRGKILNVEKTRIDRVLANTEVQAIISAFGTGIQDEFDINKLRYHKLILMADADVDGQHIRTLLLTFLFRYMRPLVDGGFIYLAQPPLYKVKWSREAGYAYSDRQRDELIETGLTAGEDVQRYKGLGEMNADELWETTMNPATRVLLQVSVDDAAQADQLFSTLMGEDVESRRNFIQRNAHDVRFLDI 655
6 0.000e+00gi|736186287|ref|WP_034298906.1| DNA gyrase subunit B [Alkalibacterium sp. AK22]  clstr ali  54  1MADEQLTEEYDASQIQVLEGLEAVRKRPGMYIGSTSSEGLHHLVWEIVDNSIDEAMAGHAESIEVIIEPGNVIVVKDDGRGIPIDIQAKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSEYLEVDVHKNGKIYNQRYERGA-VMYDLKEIGTTD-LSGTEVRFKADDEIFETTVYDFNKLATRVRELAFLNRGLAISIEDRREEEPVRLDYQYDGGIKSYVEYLNQSKTALYDEPIYLE----------DEQEGITVEVALQHTDGYHMNIMSFANNIHTYEGGMHESGFKTALTRIVNDYGRRNKLIKENEDNVTGEDVREGLTVVLSIKHPDPQFEGQTKTKLGNSEVRTITDRLFSEHFDRFLMENPKTSKKIVDKALLXXXXXXXXXXXXEVTRKKSGLEISNLPGKLADCSSKDPSQSEIFIVEGDSAGGSAKQGRSRLFQAILPIRGKILNVEKASIDRILANEEIRSLFTAMGTGFGEEFQIDKARYHKLIIMTDADVDGAHIRTLLLTLIFRYMRPVVEAGFVYIAQPPLYQVKQGKKEVYLDSDRELDEYLKEIPTPKPSIQRYKGLGEMDAEQLWSTTMNPENRRLLQVTVEDAIEADLVFDMLMGEKVEPRRDFIEDNAQYVENIDI 648
7 0.000e+00gi|524267180|emb|CDA28086.1| dNA gyrase subunit B [Eubacterium sp. CAG:156]  clstr ali  51  4..NTNVENEYGADQIQILEGLEAVRKRPGMYIGTTSTRGLHHLVYEIVDNAVDEALAGYCSEIDVQINKDNSITVKDNGRGIPVGINEKTGLPAVQVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSQWLEVKVCREGKIHYQKYEYG-HVVSELKVIGECDSDTGTEVTFLPDNTIFEDTVYQFKVLEERLRETAFLTKNLKIILRDVREEEPKEEIFHYEGGIKEFVSYLNEGKTALYDDILYCEGT----------VNNVYVEVALQHNDGYNENTISFVNNINTPEGGTQVEGFKRALTKTFNSYARTKKVLKDNEENLSGEDIREGLTAIISVKIEDPQFEGQTKQKLGNSEARAAVENVMSEQLTYFLEQNPNVGKIICEKAVLAQRARFAARNAREATRRKTALDVAALPGKLADCSDKDPKKCEIFIVEGDSAGGSAKKARTRATQAILPLRGKILNVEKARIDKIMANAEIRAMITAFGTGIQDDFDISKLRYDKIIIMTDADVDGAHIDTLMLTFFYRFMPELIKDGHVYLAMPPLYQVTRNKKNYYAYNDDELNKILTEIGRDNQNIQRYKGLGEMDASQLWETTMDPNTRILKQVKIDDETEIDKTFTTLMGDEVEPRREFIEANAKFVQNLDV 644
8 0.000e+00gi|406883600|gb|EKD31155.1| hypothetical protein ACD_77C00384G0005 [uncultured bacterium]  clstr ali  48  1MKENESTFDYSADSIQVLEGLEAVRKRPSMYIGDIGSRGLHHLVYEVVDNSIDEAMGGFCTHIDVVINPDNSVSVSDDGRGIPTDMHEKEGRSALEVVLTVLHAGGKFSKDSYKVSGGLHGVGVSCVNALSSHLTAEVYREGKYFIQEFAKGIP-MYPVKTVGESDR-RGTVITFKPDVEIFNGTTYNYDILATRLRELAFLNKGVVLSLTDLREETARQETFVSQLGLLEFVQYLDGTREKLTEKPIYLEG----------DKGGIPIEIAMQYNTGFSENIHSYVNNINTIEGGTHLSGFRRGLTTTLKAYADKNGLLSKLKFDIDATDFREGLTAIISVKVAEPQFEGQTKTKLGNSEVMAAVSQATTVALENYLEENPKDAKNIVDKVILAATARHAARKAREMVQRKTVMSGSGLPGKLADCSDRDPSKCEIFLVEGDSAGGTAKTGRDRAFQAILPLRGKILNVEKAMEHKVFENEEIRNIYTALGVTIGTELNISKLRYHKVILMTDADVDGSHIDTLILTFFFRYMQDLIKNGYVYIATPPLYLVKKGKQEQYCWSEDDRKEAIEQIGRGKLHVQRYKGLGEMNAIQLWDTTMDPGTRLLRQVTIDNAAEADRIFSMLMGDEVPPRREFIETHAKYA-NIDV 667
9 0.000e+00gi|516342191|ref|WP_017732224.1| DNA gyrase subunit B [Nafulsella turpanensis]  clstr ali  47  1MSEPKKANNYGANNIQVLEGLEAVRKRPAMYIGDVGIKGLHHLIWEVVDNSIDEAMAGHCDHIKVTINEDNSITVVDNGRGIPTDYHTKEKRSALEVVMTVLHAGGKFDKDTYKVSGGLHGVGVSCVNALSILLHAEVHRDGKVFEQEYSKGIPQ-YPVREIGTTD-LTGTTIRFKPDGEIFHDLVYRYETVATRLRELSFLNAGIRIDLTDLREGQPRHEQFFSQGGLKEFVEYLDSTRENLIPEPIFVEG----------EKGGIPVQVAMSYNTSYTENVVSYVNNINTIEGGTHVSGFRRALTRTLKAYADRSGLLDKAKVEIVGDDFREGLTAVVSVKVAEPQFEGQTKTKLGNSDAIGAVDASVSEILNNYLEEHPKEARQIVQKVILXXXXXXXXXXXXEMVQRKNVLSGTGLPGKLADCSDSDPAVSELYLVEGDSAGGSAKQGRDRKFQAILPLRGKILNVEKAQEHRIYDNEEIKNMITAMGVSFGRELNMEKLRYHKIVIMTDADIDGSHIRTLILTFFFRYMRELIEKGYLYIALPPLYLLKKGKDERYAWSEDDRARIVKEMAKEGVGVQRYKGLGEMNPEQLWTTTMNPDTRSMKRVTIDSAAEADHLFSMLMGDEVAPRRDFIERNAKYAK-LDV 652
10 0.000e+00gi|511345230|emb|CCX38627.1| dNA gyrase subunit B [Clostridium sp. CAG:1013]  clstr ali  48  6MTDTKSEKAYDGDQIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNAIDEALAGFCDKIDVRLLPGNIVYVSDNGRGIPVGVQHKTGLPAVTVVFTILHAGGKFGGGSYKVSGGLHGVGASVVNALSTWLEVEVVQDGILYFQRFERG-HAVTQLENRGPVNDGRGTVVRFQADPEIFETTVYEYDVLQKRLREQAFLNAGVNIHLTDERPQEDRPESYCYEGGVSSFVEYINANKDVIHPDVIHFSA--------VAEDENSTAEIAMQYTDSYQEQILSFANNIHTTDGGTHEDAFKRTLTRVMNDYARKYNILKDNDKNLSGEDVREGLTCVISVKLKEAQFEGQTKAKLGNTEMGPLVSSMVYNKLMTYLEENPATARTIFDKALSASRAREAARKARDLARRKTALENTTLPGKLADCQSRDVNETEIYIVEGDSAGGSAKGGRDRKFQAILPLWGKMLNVEKARLDKVYSNEKLMPVVMALGTGLGEDFDLSKLRYGKIIIMADADVDGSHIRTLLLTFFFRFMRPLVEEGHVYLAQPPLFRITKGKRHYYAFSDQQRDQIMAELG-TGYDIQRYKGLGEMDSEQLWETTMNPATRTMRRVEVDDAIEADEVFTVLMGDKVEPRRDFIMKRAKEA-NWDV 659
11 0.000e+00gi|503420407|ref|WP_013655068.1| DNA gyrase subunit B [Cellulosilyticum lentocellum]  clstr ali  52  4........TYDENQIQILEGLQAVRKRPGMYIGSTSSKGLHHLVYEIVDNAVDEALAGFCSFIKVTIHADNTISVIDNGRGIPVGIHPQKGISTVEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLTVEVYTDGKVHQEKFSRGD-VVQPLTVIGDTNKV-GTYVRFKPDTEIFEEVIFDYKVLEQRLKETAFLTKALKIQLVDEREGQEQNKTFHYEGGIKEFVQHLNKHKTPIYDEIFYCEG----------EKDGIAVEVAFQHNDSYVENLFSFVNNINTPEGGTHLSGFRTAITKNLNDYARKMGLLKDSDKNLTGDDIREGMTAVISIKIGDPQFEGQTKTKLGSSEAAGAVQSVFGDQLTYFLEQNPNVGKVIVQKGVMXXXXXXXXXXXXELTRRKSALEGNALPGKLADCSEKDASKCEIYIVEGDSAGGSAKSARSPKTQAILPLRGKILNVEKVRIDKMLENQEIRNMITAFGAGISDDFDISKLRYGKIILMTDADVDGAHIRTLLLTFLYRYYRELIEQDHVYIAQPPLYLVEKNKKKHYAFDDKELEKLLEEVGRTGITMQRYKGLGEMNAEQLWETTMDPESRVLVKVNIDDAAAADEIFTKLMGDDVEPRRQFINEHAHKVTYLDI 634
12 0.000e+00gi|524053338|emb|CCY37082.1| dNA gyrase subunit B [Alistipes sp. CAG:831]  clstr ali  48  3....EAEREYSADSIQVLEGLEAVRKRPSMYIGDIGPRGLHHLVYEVVDNSIDEALAGFCRNIEVTILPDNSIRVKDDGRGIPTGIHEKEGRSALEVVLTVLHAGGKFSKDSYKVSGGLHGVGVSCVNALSSYLKAEVHREGKIFVQEYSRGVPQ-YPVKVVGECDD-TGTTITFTPDGEIFRTTVYDASVLATRLRELAYLNKGIHLTLIDEREHEPVRQEFYSEHGLVEFVQYLDGTREKLTDKPISLE----------TDKTGIPIEIAMQYNTGFSENIHSYVNNINTIEGGTHLTGFRRGLTSTLKAYAEKNGYLSKLKFDLDASDFREGLTAVISVKVAEPQFEGQTKTKLGNSEVDAAVSQATKAALETYLEENPKDAKNIIDKVILAATARHAARKARELVQRKTVMSGAGLPGKLADCSNRDPEKCELFLVEGDSAGGTAKTGRDRTYQAILPLRGKILNVEKAMEHKVLESETIRNIYTALGVTIGTEEDLDKLRYHKVIIMTDADVDGAHIATLILTFFFRYMPDMIKNGYVYIAAPPLYKVKKGKEEKYCWTEEERIAAIAEIGKGNIYVQRYKGLGEMNAEQLKETTMDPATRLLRQVTIDNAAEADRIFSMLMGDEVPPRREFIEMNAKYAK.... 656
13 0.000e+00gi|522157862|ref|WP_020669070.1| DNA topoisomerase IV subunit B [Amycolatopsis nigrescens]  clstr ali  47  1MAAN--TNNYGASSITVLKGLEAVRKRPGMYIGSTGERGLHHLIQEVVDNSVDEAMAGYASKIEVTLLADGGVRVVDDGRGIPVAMHPVENKPTLEVVLTQLHAGGKFDGESYAVSGGLHGVGVSVVNALSTRLDVEIHLEGKIWTQRYEMSEPV-APVQEQGPTSK-TGTTITFWADPEIFETTTYNAETISRRLQEMAFLNKGLTIVLRDERTARVKERVYHYPGGLEDFVRHINGSKDPIHQTVVSFDAKG----------DGLEVEVAMQWNNGFTPSVYTFANTINTHEGGTHEEGFRAALTRVVNAYAREKKLLKEKDTNLTGDDVREGLAAIVSIKLAEPQFEGQTKTKLGNSEAKSFVQTKTNEWLADWFERNPTEAKIVINKAVSSAQARMAARKARDLVRRKGALDIGGLPGKLKDCRSTKPEECELYIVEGDSAGGSAKEGRDSMYQAILPIRGKIINVEKARIDRVLKNTEVQSLITALGTGIHDEFDVTKIRYHKIVLMADADVDGQHINTLLLTLLFRFMRPLIEHGHVYLSQPPLYKIKWPREPEYAYSDKERDGLIKAGAEAGDSIQRYKGLGEMNAAELWDTTMDPAHRILRQVNLDDAATADELFSVLMGEDVEARRSFIVRNAKDVRFLDV 656
14 0.000e+00gi|490977849|ref|WP_004839613.1| DNA gyrase subunit B [Anaerococcus vaginalis]  clstr ali  51  2.....ENSEYNASNIRVLKGLEPVRLRPGMYIGSTSERGLHHLVYEVVDNSVDEALAGRCDYIKISIDENNIVTVEDDGSGIPIEKHPQTGKSTLETVLTVLHAGGKFDDKAYKVSGGLHGVGVSVVNALSEYLIAEVKREGHIHRMTFERGKP-TSDLEIVGDT-KESGTKITFKADPEIFDVTVYDKKTLENRFREMAFLNKGVRLIFEDKRDESEIE--FKYDGGIKEFVEYLNRNKTPIFKEVPYFEGR----------QESTEIEISFQYTDGYSENILTFANNIYTLEGGTHLSGFRSALTRSVNDYARKYNLLKENEDNLQGDDAREGITAIISVKISNPQFEGQTKGKLGNSEVRGAVDAFFSEHMGNFLEENPKIAKTIIQKALASRRAREAARKARDLTRKRSILDSTTLPGKLADCQSQDIGENEIFIVEGNSAGGSAKGGRDNRIQAILPLRGKIMNVEKANLDRILNYEEIKSMITAFGTGIGSEFDISKLRYGKIIIMTDADVDGAHIRTLLLTFFYRYMKPLVDGGHIYIAQPPLYKISSGKKERYCYTDKELDEIVKEWKVDNYKISRYKGLGEMNAEQLWETTMDPENRVLLQVEKEDSMSTDATFSMLMGEKVEPRREFIEENAQYVENLDV 634
15 0.000e+00gi|517351519|ref|WP_018527011.1| DNA gyrase subunit B [Spirochaeta alkalica]  clstr ali  50  2......PGNYSAENIQILTGLDPVRKRPGMYIGSTGSEGLHHLVYEVVDNSIDEALAGHCETIAVVIEKNNVITVVDDGRGIPVDHHAGENVSALEIVMTRLHAGGKFDKDTYKVSGGLHGVGVSVVNALSEWLEVEVYRDNRIWHQRYERGI-ATKQVESIGET-RLTGTKVTFKPDDQIFETVTFSFDVLSHRLRELAFLNKGIRITIEDRRLPQIKSHDFKFDGGLKEFVQYLNKNKTMIQSEPIWFEAS----------RDEVEVEISMEYNDGFNEILFAFVNNINTREGGTHVTGFRGALTRTFNDYLKRSKFAKKMDESFSGDDVREGLTAVISVKVMNPQFEGQTKAKLGNSEVRGIVESLVNENLTAYFDENPKIIEAILEKSVLXXXXXXXXXXXXDLTRRKSFLESSGLPGKLADCSERNPELAEVYIVEGDSAGGSAKQGRDREFQAILPLWGKMLNVEKTRIDKVLANEKLQPIIASLGAGVGNEFDITKVRYHKVFIMADADVDGSHIRTLLLTFFFRYMPQLIEAGYVYIAMPPLYKISYGKMVAYAYNEAERARIIEEITREKIGIQRYKGLGEMNPDQLWDTTMNPETRSIMQVRLEDAVEADSVFTTLMGEHVAPRREFIEENALSVSNLDI 639
16 0.000e+00 [EC:5.99.1.3][KEGG:K02470] DNA gyrase subunit B;|[COG0187] Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit  ali  51  9...KKMSNNYDAEQIQVLEGLEAVRKRPGMYIGSTSTRGLHHLVYEIVDNSVDEALAGYCNHIEVFINPDNSITVVDNGRGIPVGIQEKTGKSALEVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVEVTRDGHVYKQTYKRGN-VDSTLQIIADAEDKSGTKVTFLPDKTIFDDWIYDYDTLRTRLRETAFLTKGLKITLTDLRVDPPKERHFHYEGGIKEFVEYMNRHREALYDKVIYCEGL----------KDGVYVEVAMQHNDSYNEMIHSYVNNINTPEGGTHLTGFKSAITKIFNDYARKNNLLKEKEDNLSGEDLREGMSAIVSVKIGEPQFEGQTKQKLGNSEVRPVVENIVSEQLTYFLEQNPNIAKIIINKSVMXXKANLA--------------DNMALPGKLADCSDKDPKNCEIYIVEGDSAGGSAKKARSRATQAILPLRGKILNVEKARIDRILENAEIKAMITAFGTGIHENFDIDKLRYNKIIIMTDADVDGAHIATLLLTFFYRFMPDLIRKGHVYLAQPPLYKLEKNKKIWYAYSDDELNSILNEVGRDQSNIQRYKGLGEMDAEQLWETTMDPEKRILLKVDDDDESEIDMTFNVLMGDKVEPRRQFIETNAKFVKNLDI 648
17 0.000e+00gi|502640343|ref|WP_012876792.1| DNA gyrase subunit B [Xylanimonas cellulosilytica]  clstr ali  49  1MA-NRNDGGYDAGNITVLEGLEAVRKRPGMYIGSTGERGLHHLVTEVVDNSVDEALAGYADTIDVTLLADGGVRVVDNGRGIPVAIHPTEGKPTVEVVMTILHAGGKFGGGGYAVSGGLHGVGISVVNALSRRVVSEIARDGYHWRMEFADGGHPVGELQRL-EPTEETGTTQTFWADPEIFETTEFDFETLRARFQQMAFLNKGLTITLTDERAGHARTVTYRYDGGLTDYVKHLNSSKDLIHPEVIDFESEDTERK--------ISLEIAMQWTSAYSESVHTYANTISTTEGGTHEEGFRAAMTNLVNSYAREKGILKEKEDNLTGDDIREGLTAVISIKLGEPQFEGQTKTKLGNTEAKTFVQRVVREQLTDWFDSHPNEAKDVIRKAISASQARIAARKAREATRRKGLLSSGGMPGKLKDCQSNRPEECEIYIVEGDSAGGSAVRGRNPHNQAILPIRGKILNVERARLDKALSNLEVQSLITAFGTGIGEDFDASKLRYHKVILMADADVDGQHIATLLLTLLFRYMRPLIEQGHVYLAMPPLYRLKWSNAPHYVYSDKERDAFIREMPKDK-GIQRYKGLGEMDYQELWETTMDPDHRTLRQVTMDDAAAADEIFSMLMGEDVESRRSFIQRNAKDVRFLDI 681
18 0.000e+00gi|545656248|ref|WP_021763539.1| DNA topoisomerase IV subunit B [Leifsonia aquatica]  clstr ali  49  9....ETDHEYGANEIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNSVDEALAGHADNIEVTILPDGAVRVIDNGRGIPVDEHPVQKKSTVEVVLTILHAGGKFGGGGYAVSGGLHGVGSSVVNALSSRLDIEVYRQGSVWRQSYRDGVPQ-APLEQ-GEASDRTGTTITFWPSAETFETTVFDYDTLRTRFQQMAFLNKGLRIAITDERTDTPRSEVFLYEQGLTDYVHYLNSAKEVVHDEIISFESEDTERK--------IALEVAMQWTTSYNESVFTYANTINTHEGGTHEEGFRAALTTLVNKYAREKNILKEKDDNLSGDDVREGLTAVVSVKLSEPQFEGQTKTKLGNTEAKAFVQKVVGDQLGDWFDRNPNQAKDIIRKALQAATARLAARKARETARRKGLLESGGMPGKLKDCQSKDPTVSEIFIVEGDSAGGSAVQGRNPETQAILPLRGKILNVEKARLDRALANNEVQAMITAFGAGIGEDFNPEKARYHKIVLMADADVDGQHITTLLLTLLFRYMRPLVDLGYVYLAQPPLYRLKWSNEHEYVYSDRERDAYLAEIPKDN-GVQRYKGLGEMDYKELWETTMNPESRTLLQVTLDDAAAADEIFATLMGEDVESRRSFIQKNAKDVRFLDI 673
19 0.000e+00gi|948679789|gb|KRL08648.1| DNA gyrase B subunit [Lactobacillus perolens DSM 12744]  clstr ali  53  53...EKLAKSYDASQIQVLEGLEAVRKRPGMYIGATSSQGLHHLVWEIIDNGIDEALAGFATKIEVTVEADGSVTVQDDGRGIPVDIQKKTGKPALETVFSILHAGGKFGGGGYKVSGGLHGVGASVVNALSTSLDVTVAREGKKYYMDFHRG-KVNTPMKVIGTAEHEHGTLVHFVPDPEIFETTTFDDKILTTRIRELAFLNKGLKLTFTDKRQETHEKLVFHYEGGIKSYVEYLDHGKDVLFQEPIYVEG----------KQNGITVEVALQYISGYHSILMTFANNIHTYEGGTHEAGFKAALTRVINDYAHKQNIIKDPDEKLSGDDVREGLTAVVSIKHPDPQFEGQTKTKLGNSDARTVTDRTFSEMFTKFLMENPNEARAIVDKGMVASKARVAAKRAREMTRKKSGLEISNLPGKLADNTSKDPSISELFIVEGDSAGGSAKSGRSRLTQAILPIRGKILNVEKASMDRILANDEIRSLFTAMGTGFGGDFDISKARYHKVIIMTDADVDGAHIRALLLTLFFRYMRPLVDAGYIYIAEPPLYQVRQGKFIRYIDSDEELQEVLQTLPSPKPAIQRYKGLGEMDASQLWDTTMNPENRRLQRVNVADAIEADAVFDMLMGDKVEPRREFIEKNANYA---DI 688
20 0.000e+00gi|501770976|ref|WP_012636109.1| DNA gyrase subunit B [Halothermothrix orenii]  clstr ali  50  9.........YGAEQIEILKGLEAVRKRPGMYIGSTGIRGLHHLVWEVVDNSIDEYLAGYGDKIEVTINEDNSITVEDWGRGIPAEEHPETGLPAAQVVMTTLHAGGKFNNNSYKVSGGLHGVGISVVNALSEWLELTTYWNGNEYYQRYERGYPKT-KFQKLG-TSNRNGTIISFKPDPEIFDVTEFKYETLAHRLQESAFLNKELSLILIDKRSDKTKKEVFQYDGGIKAFVEYLNKNRQVINEDIIYTEK----------ENGDYYIEVALQYNEGYNERIFSYANNINTVDGGYHLTGFKTALTKAINNFAKQNNLLKQSDPTLTGNDVREGLTAVVNVKLPNPQFEGQTKSKLGNSEIRSIVESNIYDYLSLYLDSNPEVGKKIVDKAIQAIRARQASKKARELTRRKNALNSHSLPGKLADCASRKPEKSELFLVEGDSAGGSAKQGRNRHFQAILPLKGKIMNVERARLDKILSNNEIATIISALGTGIGQEFNIDKLRYHKIIIMTDADVDGAHIATLLLTLFYRYMPELIKEGYIYIAQPPLYKVSWKKNIRYLYTDKELESLKRELENKSYSIQRYKGLGEMNPRQLWETTMNPETRKLLRIEIDDEIEADEIFTRLMGSNASLRREFIISNADMVDELDI 637
21 0.000e+00gi|518932959|ref|WP_020088834.1| DNA gyrase subunit B [Lactobacillus parabrevis]  clstr ali  51  8.TKAEQAREYDASQIQVLEGLEAVRKRPGMYIGSTSAQGLHHLVWEIVDNGIDEALAGFADSIHVTVEKDNSITVSDNGRGIPVDIQQKTGKPALETVYTILHAGGKFGGGGYKVSGGLHGVGASVVNALSTHLEVQVIRGGKRYGITFKRG-HVNKPMYVMEEDPDRHGTIVHFLPDPDIFETTTFDIKTLTTRVRELAFLNKGLRITIRDERPETPTEDDFHYEGGIRHYVDYLNENKTTLFEPPIYVEG----------EENGITVEVALQYTDDYHNNLLTFTNNIHTYEGGTHEEGFKRALTRVVNDYARQNKLMKDNEPNLTGDDVREGMTAVVSVKHPDPQFEGQTKTKLGNSDARTAVDHTFADHFMRYLMEHPDIARKVVDKGTLASKARVAAKRAREVTRKKSGLEISNLPGKLADNTSKDPAISELFIVEGDSAGGSAKQGRSRLTQAILPIRGKILNVEKASMDRILANEEIRSMFTAMGTGFGSDFDVSKANYHKLIIMTDADVDGAHIRTLLLTLIYRYMRPLLDAGYVYIACPPLYRVRQGKMQRYLDSDDELKELLGQLPAPKPQIQRYKGLGEMDAEQLWDTTMKPENRRLLRVDAQDAINADQVFSMLMGDKVAPRREFIEDNATFAE-LDV 648
22 0.000e+00gi|949536799|ref|WP_056974181.1| DNA topoisomerase IV subunit B [Lactobacillus floricola]  clstr ali  52  18...EARAKSYDASQIQVLGGLEAVRKRPGMYIGSTSSQGLHHLVWEIIDNGIDEALAGFADEINIEIEADNSVTITDNGRGIPTDIQQKTGRPALETVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSTELDVTVVRDGKKYYIDFTSG-KVKTPMKEMGEAEHQHGTKVHFVPDPDIFETTTFDSKVLTTRIRELAFLNKGLRLTYLDKRIENPELIAYHYEGGIKSYVDYLNHNKEVLFDTPIYVEA----------DQDDIQVEVALQYTDGYHTNLMSFANNIHTYEGGTHESGFKSALTRVINDYARKTGLLKENDAKLSGEDVREGMTAVISIKHPNPQFEGQTKTKLGNSDARTITERLFSEIFSKFLMENPTVGRRVVEKGQLASKARVAAKRAREVTRKKSGLEISNLPGKLADNSSKDPEMSELFIVEGDSAGGSAKQGRSRLTQAILPIRGKILNVEKASMDKILANEEIRTLFTALGTGFGADFDVSKARYHKLIIMTDADVDGAHIRILLLTLFYRYMRPMVEAGYVYIAKPPLYQVRQGKMVKYVDSDEELKELLSTLPSPKPVVQRYKGLGEMDAEQLWETTMNPENRRLDRVDPQDAVEADGIFTMLMGDKVDSRRQFIEDNAKYVENIDV 656
23 0.000e+00 GL0055526 [Complete] locus=scaffold98055_1:84:1997:-  ali  50  1MA--TAEKNYSSKNIQVLEGLEPVRTRPGMYIGSTGSAGLHHLVYEVVDNSIDEAMAGYCKNITVTIKKDNIIEVQDDGRGIPVDLHPKLKVSALEVVMTKLHAGGKFDNETYKVSGGLHGVGVSVVNALSKELIAEVSKDGKLYKQIYHKGVP-EAPVKEVGKSSK-NGTKVTFKADDEIFETTEYDYKILANRLRELAFLNRGIRITLIDKRESKTVSNEFYYEGGIEMFIAHLNENKKLLHDKPIYLHKT----------EDKTDIEVSMQYVDAYNENIFTYCNNINTTEGGTHLVGFRTALTRIYTDFAKKLELDKKNKVTFMGEDTREGLVAVVSVKIPNPQFEGQTKTKLGNTEVRAITEKLVFEGLNDYFSQNPKVIKVILEKIISAAQAREAARKARDLARRKNALESDSLPGKLADCSEQEVDKCEVYLVEGDSAGGTAKGGRDRHFQAILPLRGKVLNVEKARLDKIIDNESLKPIIAALGCGVGSSFDISRIRYGRVIIMADADIDGSHIRTLLLTFFFRYMRPLIDLGHIFIAVPPLYKISFDKKNFYAYSDEQRDKILEENKGKNSDIQRYKGLGEMNADQLWDTTMNPETRLMYQVLTEDAEKADQLFTMLMGDEVKPRRDFIEANARYVKNLDV 637
24 0.000e+00gi|503174155|ref|WP_013408816.1| DNA gyrase subunit B [Leadbetterella byssophila]  clstr ali  49  1MSENNK-QDYSASNIQVLEGLEAVRKRPAMYIGDIGIKGLHHLIWEVVDNSIDEAMAGYCNRIETTINTDNSITVKDNGRGIPTGWHEKEQKSALEVVLTVLHAGGKFDKDTYKVSGGLHGVGVSCVNALSTHLRAEVHRDGKITEQEFSIGKP-LYPAREIGTTDY-RGTIIHFKPDDSIFQVTEYKYETVANRLRELSFLNKGITLTLTDLREGKPKYEEFHSEGGLIEFVEYLDKSRERLITTPMYMEG----------QRDGVPVEVSMTYNTSYSENVSSFVNNINTPEGGTHVSGFRMALTRTLKSYAEKSGLLAKEKIEISGDDFREGLTAVISVKVAEPQFEGQTKSKLGNSEVTAAVSGCVQEMLENYLEENPKDAKIIVDKVILXXXXXXXXXXXXEMVQRKNVLVGSGLPGKLADCSEHDPALCEVYLVEGDSAGGSAKQGRDRNFQAILPLRGKILNVEKAQEYKIYENEEIKNIFTALGVQIGKELNLEKLRYHKIIIMTDADIDGSHIRTLILTFFYRFMREIIENGYLYIAQPPLYLVKKGKDEIYAWTEEQRYAAVKKLAGENVGVQRYKGLGEMNPEQLWETTMNPQHRTLKQVTIESAAEADMLFSMLMGDDVPPRRDFIEKNARYA-NVD. 648
25 0.000e+00gi|948862036|gb|KRM78918.1| DNA gyrase subunit B [Lactobacillus dextrinicus DSM 20335]  clstr ali  53  34.........YDASQIQVLEGLEAVRKRPGMYIGSTSSQGLHHLVWEIIDNGIDEALAGFASQIDITVEPDNSITVVDDGRGIPVGIQKKTGRPALETVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSTNLDVTVTHEGKRYYMDFVRG-KVNTEMTVIGDAEHEHGTKVHFVPDPDIFETTIYDDKVLNTRIRELAFLNKGLKLTFTDKRAESAERIEYHYVGGIRSYVEYLNEGKEVIFPTPIYVEG----------EQNDITVEVAIQYTDDFHSNLLTFANNIHTYEGGTHEAGFKAALTRVINDYGKKTGLIKENDDNLSGDDVREGMTAVVSIKHPDPQFEGQTKTKLGNSDARTVTDKMFSETFNKFLLENPTVAKQIVEKGQLASKARLAAKHAREVTRKKSGLEISNLPGKLADNTSKDPEISELFIVEGDSAGGSAKQGRSRLTQAILPIRGKILNVEKASMEKILANEEIRTLFTAMGTGFGSDFDLSKARYHKLIIMTDADVDGAHIRTLLLTLFYRYMRPVVDAGYVYIAKPPLYQVRQGKFMRYIDSDEELNEVVGQLPSPKPAIQRYKGLGEMDAEQLWETTMNPENRRMDRVEVTDAQEADDVFQMLMGDNVGPRREFIESHAKYTKNLDV 666
26 0.000e+00gi|931394521|gb|KPJ83800.1| DNA gyrase subunit B [Gemmatimonas sp. SG8_23]  clstr ali  51  1MAKNQKGSDYTAGQIQVLKGLEAVRKRPGMYIGSTSGRGLHHLVYEVVDNSIDEAMAGHCSQVTVTIHDDDSITVEDDGRGIPVDIHPTEKVPGVELAMTTLHAGGKFDKDTYKVSGGLHGVGVSVVNALSVYLEVEIRRGGKLYHQRYERGIK-TKELEEKG-TAKGSGTTVRFKPDHEIFTELVYSFETLSNRLRELAFLNKGLKIVLTDERDE-GQTEEYQYDGGIAEYVTFLRGSRGALHDKICYFEASKPEAEIG----------LALQYDQGFSENTHSFVNNINTHEGGMHVTGLKAALTRTINDYARRNNIFKKGE-SLSGDDVREGLTCVLSVRVMEPQFEGQTKTKLGNSEVRGAVEAAVNEHLAIFLDENPKAGKAIIEKSLQXXXXXXXXXXXXXLARKKSALEGGVLPGKLADCSISDPSMCELYLVEGDSAGGSAKQGRDRAYQAILPLKGKILNVERARIDKILANDEIGAMITAIGAGIREEFELNKTRYHKIVIMTDADVDGAHIRTLLLTFFFRQMRELIEAGYVYIAQPPLYRVRKGRQEFYAYSDGERDDYVKRLGGKGIHIQRYKGLGEMNPDQLWKTTMDPESRTILQVQIEDAAIASNLFDRLMGDDVEPRREFIEKNAKYVKNLDV 643
27 0.000e+00gi|495018982|ref|WP_007744927.1| DNA gyrase subunit B [Oenococcus kitaharae]  clstr ali  52  1MIDEKNNNQYGGSSIQILEGLEAVRKRPGMYIGSTASSGLHHLVWEIIDNGIDEALAGFAHHVTLTIEKDNSITVTDDGRGVPVEIQPKTGRPAMEAVFTILHAGGKFDSKNYKVSGGLHGVGASVVNALSKEMDVRVYRDGKIYYMDFQRG-HIQTEMKLLDEPMRERGTIVHFAPDPDIFETTTFDYNTLASRIRELAFLNKGLRLSITDRRVEPEKKESFMYEGGIAEYVKFLNKNKQPLFPEPVYVEG----------EENGIQVEVALQYTDAVAETLMSFTNNIHTHEGGTHETGFKMALTRIINDYAKKKGILKDSDDPLTGEDVREGITAIVSIKHPDPQFEGQTKTKLGNTDAQQAVNHQFSTIFNRFMMENPETARAIANKGIIASKARVAAKKARDLTRRKSGLEISALAGKLADNTSKDPDISELFIVEGDSAGGSAKQGRSRLTQAILPIRGKILNVEKATLDKVLANEEIRSLFTAMGTGFGDEFDISKAHYHKVIIMTDADVDGAHIRTLLLTLFFRHMRPLIDAGYIYIAQPPLYGVAIGNSDQYLDSDEELDRYIATLPSPKPRIQRYKGLGEMDAEQLWDTTMDPKHRRLLRVSPDYQPEVDTTFDMLMGDRVEPRREFIEDNAQFVEDLDV 652
28 0.000e+00gi|557311060|ref|WP_023386791.1| DNA gyrase subunit B [Youngiibacter fragilis]  clstr ali  52  1MTDIEKIENYDESKIQVLEGLEAVRKRPGMYIGTTSSRGLHHLVYEIVDNSIDEALAGFCDHIEVYIHKDNSITVEDNGRGMPVGINKKLNKSSVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEVCIVYVKRDGKLYKQEFRRGIPFDT-LSVVGEST-GTGTRTYFKPDDEIFEELEFDFEILSDRLRELAFLNKGIRITLYDERDE--KTESYFYEGGIKSFVEYLNRNKEVLHKDPIYME----------EEKDGYSVEVSLQYNDSYNENIFTYANNIDTTEGGTHLEGFKRAMTRVINDYGKKFGHIKENDKNLSGEDIREGLTAVISVKLENPQFEGQTKTKLGNSEVRSIVDNVVGRCVQTILEENPQIGKTVIDKALMXXXXXXXXXXXXXLT-RKSVLERGSLPGKLADCASKDPLECEIYIVEGDSAGGSAKQGRNRQFQAILPIRGKIMNVEKQRLDKILGSETIRSMVTAFGGGIGKDFDKEKLRYSRIIIMTDADVDGAHIRTLLLTFFYRYMKDLIDHGHVYIAQPPLYQVTKGKFVEYTYSDKELETVLEKIGGKSVNIQRYKGLGEMNAEQLWDTTMDPEHRILLRATVEDAKAADEIFTILMGDKVEPRREFIERNSKKVVNLDI 640
29 0.000e+00JGI.Meta 7023454748 SRS022602_Baylor_scaffold_122708__gene_167976 hypothetical protein [Human Supragingival plaque microbiome from visit num  ali  50  1MSAIMSQSNYSASNITVLKGLEAVRKRPGMYIGSTGPNGLHHLVYEVVDNCIDEAMAGFCNKIIVVLEAGNVVRVEDNGRGIPVDVHAEEGVSALELVMTRLHAGGKFDKGSYKVSGGLHGVGVSVVNALSNWLEARVYRDGGEYYAKFEKGE-IVTPVKKIGSSSR-RGTVVRWAADPSIFETVTYNFDVLSSRLRELAFLNSSISIVLRDERLTTPKEVTFAFEGGISHFVSYLNESKQILPKEPIYVEG----------EKSDVVSEIALQYNDGYNENILSFVNDINTHEGGTHLDGFKHALTRVMNDFLKKNPKLLEKEEKLAGEDVRAGLTAIISVKVPEPQFEGQTKTKLGNSEVRSIVDSIFSEKITLYFEQNPQTIEKILEKCVAEATARIAARKAKEATRRKSGIDSFGLPGKLADCSMKDPAMCEVYIVEGDSAGGSAKKGRDSKTQAILPLWGKMLNVEKTRLDKVISNEKLQPIIATLGTGIGDDFNIEKIRYHKIIIMADADVDGSHIRTLLLTFFFRYMPKLIEEGYVYLAMPPLYKVSHNKKEWYVYDDNEREALLKKIGSGNVAVQRYKGLGEMDGTQLWDTTMDPAKRKMMRVTLPDALEADRTFSTLMGEEVEPRRKFIEENAVYA-NLDV 642
30 0.000e+00gi|489652274|ref|WP_003556660.1| DNA gyrase subunit B [Lactobacillus buchneri]  clstr ali  51  1MADQKETNEYDASQIQVLEGLEAVRKRPGMYIGTTSSQGLHHLVWEIVDNGIDEALAGFATKITVTVEKDNSITVTDDGRGIPVDIQKKTGKPALETVYTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEELDVAVTRNGKVYYMDFSRG-HVTTPMKVIDHSDDLHGTKVHFLPDPDIFETTTFDIKVLTARLRELAFLNKELRIIVRDMRPEKPTEQDFLYEGGIRHYVEYLDKDKETLLKEPIYVEGMD----------NGITVEVAIDYSEDYHSTLMTFTNNIHTYEGGTHEEGFKRALTRVINDYARKNNLLKDNEANLSGEDVREGTTAVVSIKHPDPQFEGQTKTKLGNSDARTVTDRIFSDHFSKFLMENPKLARKIIDRGLLASKARSAAKRAREVTRRKSGLEISSLPGKLADNTSKDPKISELFIVEGDSAGGSAKQGRARLTQAILPIRGKILNVEKASMDRILANEEIRSLFTAMGTGFGDDFDLSKINYHKLIIMTDADVDGAHIQTLLLTLIYRYMRPLIDAGYVYVAQPPLYQVRQGKMQRYIDSDDDLNQFLGTLPSPKPVIQRYKGLGEMDAEQLWDTTMNPENRHLLRVESSDAAEANHVFSMLMGDKVEPRREFIEDNATFVENLDI 647
31 0.000e+00gi|527499750|gb|EPT32960.1| DNA gyrase, B subunit [Bacteroidetes bacterium oral taxon 272 str. F0290]  clstr ali  46  12MTEEEKEANYSASNIQVLEGLEAVRKRPAMYIGDISEGGLHQLVYEVVDNAIDEALAGYCDHIDVFINQDNSITVEDNGRGIPVDYHPKEKKSALEVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTHMITNVYRNGEIYQQEYARG-KALYPVKVIGECGNKTGTKQSFWADASIFTVTTYRFDILQARLRELSYLNKGITITLTDMREGRPRFEKFYSNDGLKEFVRYLDRNNTPLINDVIYL----------NTEKNGTPVECAIMYNTGFRENLHSYVNDIHTRDGGTHEAGFRSALTRVLSKYAEDSKTLEKAKVKIEGEDFREGLIAVISVKVAEPQFEGQTKMKLGNSEVRGAVDQAVGEALTNYLEEHPKEAKLIVDKVVLAATARIAARKARETVQRKNPMGGGGLPGKLADCSSKNPEECELFLVEGDSAGGSAKQGRSRATQAILPLRGKILNVEKAMWHKAFESDEVNNIITALGVRFGVEEDIDKLRYDKIIIMTDADVDGSHIDTLIMTLFYRYMPELIERGHLYIANPPLYKCTKGKVSEYCYTDDAREEFIRKYGNGGIHTQRYKGLGEMNPEQLWETTMDPEKRILKQVTINEAQDVDETFSILMGDDVDPRREFIERNATYA-NID. 665
32 0.000e+00gi|512056564|gb|EPD56069.1| DNA gyrase subunit B [Streptomyces sp. HGB0020]  clstr ali  47  51.SNGEVTASYDASAITVLEGLDAVRKRPGMYIGSTGERGLHHLVYEVVDNSVDEALAGHADTIDVTILADGGVRVVDNGRGIPVGIVASEGKPALEVVLTVLHAGGKFGGGGYAVSGGLHGVGVSVVNALSAKVAVEVKTDGHRWTQDYKMGVP-TAPLAQH-EATDVTGTAVTFWADPDIFETTEYSFETLSRRFQEMAFLNKGLTIKLTDEREDEVKTVTYHYEGGIVDFVKYLNSRKDVVHNTVIDLEAEDKDKSL--------SLEVAMQWNSGYSEGVYSFANIIHTHEGGTHEEGFRAALTSLINKYARDKKLLREKDDNLTGDDIREGLTAIISVKLSEPQFEGQTKTKLGNTEAKTFVQKAVYEHLNDWLDRNPVEAADIVRKGIQAATARVAARKARDLTRRKGLLETASLPGKLSDCQSNDPTKCEIFIVEGDSAGGSAKSGRNPQYQAILPIRGKILNVEKARIDKILQNQEIQALISAFGTGVHEDFDIEKLRYHKIILMADADVDGQHINTLLLTFLFRFMRPLVEAGHVFLSRPPLYKIKWGREVEYAYSDRERDALL-EMGRQRDSIQRFKGLGEMNAEELRVTTMDQEHRVLGQVTLDDAAQADDLFSVLMGEDVEARRQFIQRNAKDVRFLDI 712
33 0.000e+00gi|654392324|ref|WP_027869676.1| DNA gyrase subunit B [Eubacterium sp. AB3007]  clstr ali  50  1MSDQKQGSEYTADQIQVLEGFEAVRKRPGMYIGSTGPRGLHHLVYEIVDNSVDEALAGFCKKIKVIINQDNSVTVIDDGRGMPVDEHPKMKIPAVEVIHTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTRMEVEINRNGKIYEIEFARG-KTTKKLNVIGES-RRTGSKTTFWPDPEIFEDTIYDYDTLQHRLREMAFLTKGLNISLEDKRPGQKRKEVFHYEGGLREFVKHLNTNKDPIHEDIVYFEYADAA--------EGHEVEVAMQYTDRFNELMLSYANNINTNEGGTHLAGFKSALTRAMNDYAKKAGLLKEGD-SLTGDDVREGITAVISVKLEQPQFEGQTKAKLGNTEMRGFVETTCNSNIMAFLEEHPKQAAAIVNKCVSASRAREAARKARALVRRQSALQGLSLPGKLADCSEKDPQLSEIFLVEGDSAGGSAKQGRDRKRQAVLPLRGKILNVEKARQDKMLNSEEIKNMITAFGCGIGSEFDISKLRYHKIIIMTDADVDGAHIRTLLLTFFYRYMTPLIEGGYVYAAQPPLFRVQKGKQTWYTYSDKEQEKLLAEIEDKKVEIQRYKGLGEMDFDQLWETTMDYKTRTMVQITVEDATAADEIFTTLMGDKVPPRRKFIEDNARYAT-LDV 641
34 0.000e+00gi|973095469|gb|KUK54883.1| DNA gyrase subunit B [Marinimicrobia bacterium 46_47]  clstr ali  48  1MT-TSAANDYKSDKITVLKGLEAVRKRPAMYIGDVGKRGLHHLVYEVVDNSIDESLAGFCDKIVVTIHPDESVSITDNGRGMPVDLHPTEKKPGVEVIMTILHAGGKFDKGSYKVSGGLHGVGISVVNALSEQCRVQIHRNGNVYEQTFEKGVPTKA-LEIIGKS-RKTGTTVTFYPDKSIFTKVQFDKDILEERMRELAFLNRDVSITLIDERSGE--ESTFHYKGGIQEFVVYLNEARTPLHPKPVFISG----------EREDVLVEFAFQYNDSYNENFFAYVNCIHTIEGGTHLTGARTALTRSLNTYAIKNNLIKKNNFSLSGEDTREGITAVISVRVAEPQFEGQTKTKLGNSEVKGIVDSIISDGLSEYFEQNPSVARKVIEKSVLXXXXXXXXXXXXELTRRKNALDSSNLPGKLSDCSIKDPALCELFLVEGDSAGGSAKQGRDRRFQAILPLRGKILNVEKARLDKILSNNEIRTMITAIGAGIGEEFDINKIRYHKIIIMTDADVDGAHIRTLLMTFFYRQMFDLIKDGYVYIAQPPLYRIKNGKSMQYAYDDDELMKLLKRFDRSRLNISRYKGLGEMNPDQLWTTTMDPETRTLRQVSIEDAAAADRMFSVLMGESVESRRRFIEANAKYVKNLDI 642
35 0.000e+00gi|496355709|ref|WP_009064885.1| DNA gyrase subunit B [Clostridium sp. MSTE9]  clstr ali  52  7...TQTDQNYDENQIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNAIDEALAGFCDRIIVKILPGNIISVEDNGRGIPVGIEHKTGISAVTVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSQWLEVEVFTEDGVYSQRFERGVAVT-ELTRTGDSDH-TGTVVRFQPDSEIFESIEFEYDILQNRLREQAFLNAGIHIELDDDRPEHLVHNVYQYEGGIRSFVEYLNKKREVIHENVIYFDAVAAD--------DNATAEVAMQYNNSYNELMLSFANNIHTTDGGTHEDGFKRALTRIMNDYARKYNILKENDKNLSGEDVREGLTVIISVKLKEAQFEGQTKARLGNTEIAGLVSQMMSDKLTTYLEENPSVARAIFEKALSXXXXXXXXXXXXXLVRRKSALESAALPGKLADCQSRNPEETEIYIVEGDSAGGSAKGGRDRKFQAILPLWGKMLNVEKARLDKVYGNEKLMPVVTALGCGLGEEFDLSKLRYGKIIIMADADVDGSHIRTLLLTFFFRFMRPLVEQGHIYLAQPPLYRITRGKNHRYAYSDKQRDAIMAELGGTNYDIQRYKGLGEMDAQQLWETTMDPETRTMLKVEMEDAAAADETFTILMGDKVEPRRLFIEQNARFVSNLDI 647
36 0.000e+00gi|493397372|ref|WP_006353487.1| DNA gyrase subunit B [[Clostridium] methylpentosum]  clstr ali  50  2...EKLNQNYDENQIQVLEGLEAVRKRPGMYIGSTGPKGLHHLVYEIVDNAIDEALAGFCTQIDVEILPGNIIHVVDNGRGIPTGIHQKEGISAATVVYTILHAGGKFGGGGYKVAGGLHGVGASVVNALSEWLELKVYDGENIHYQRFERG-HYDKQMEVIGKTDR-TGTEVAFKADPEIFSETEYDYDTLLTRLREQAFLNAGVKIVMADRRQPEPVVENLHYEGGIISFVEFIHKRKETLHPDVIYLKA----------QEGDSVAEVALQYNDSYNELILSFANNIHTAEGGTHEIGFKNALTRVFNDYGRKNNLLKEADKNLSGDDVREGLTAIISVKLTECEFEGQTKSKLGNIEVRALVDRMVSEKLTNFFEENPSVARSIFDKALNAQRAREAARKARELTRRKSALETASLPGKLADCSERDPALTELYIVEGDSAGGSAKSGRERKYQAILPLWGKMLNVEKARLDRVYGNDKLMPVVTALGTSIGDDFDITKLRYNKIVIMADADVDGSHIRTLLLTFFFRFMRPLIDQGHVYIAQPPLYKLSRGKQHRYAYSDKERNQYLSELPDAKVDIQRYKGLGEMDPEQLWETTMNPENRVMIKVEMEDAVAADEVFTILMGDKVGPRREFIEKNAQYVQNLDV 642
37 0.000e+00gi|501258150|ref|WP_012301168.1| DNA gyrase subunit B [Candidatus Desulforudis audaxviator]  clstr ali  52  2...DKNGSGYRAEDIQVLEGLEAVRKRPGMYIGSTGPKGLHHLIFEVVDNSIDEALAGFCDYIEVVIHADNSVTVSDNGRGIPVDIHPQVGRPALEVVLTRLHAGGKFGGTQYKISGGLHGVGVSVVNALSRRMEVEVKREGYRYRQEFERGL-ATGELELLDEAD-ETGTRVTFIPDPDIFEEVEFQYDVVAKRLRELSFLNAGVTLVLRDERTG--RDKVYQYAGGIRDFVRHLNLHKEVLPADPIYVE----------DHKNGVWVEVAVQYVNSDRELIFSYANTIHTVDGGTHEAGFKSALTRTINDYARKYNLVKN--DSLSGEDIREGLTAVINVKVPEPQFEGQTKTKLGNSEVRGLVDWVVSQRLAAYLEEHPTEARQIVQRAVVXXXXXXXXXXXXXLTKRKSLLESATLPGKLADCSRRDPQHSELYLVEGDSAGGSAKQGRDREFQAILPLRGKILNAEKARRDKLLGNEEIRALITAIGTGFGEDFDLAKARYHRIVIMTDADVDGSHIRTLLLTFFYRYMKPLIDAGYVYIAQPPLYRVSKGKNGVYLYSDQQLEQFFRENGRQNWSIQRYKGLGEMNPEQLWDTTLDPENRTMLQVTLEDALAAEQLLSTLMGEQVEPRREFIQQHAREVRNLDI 635
38 0.000e+00 GL0055790 [Complete] locus=scaffold20280_2:8215:10152:-  ali  51  1MSENQENQNYDENQIQVLEGLEAVRKRPGMYIGSTGPKGLHHLVYEIVDNSIDEALAGFCSEIRVDILEGNVIRVSDNGRGIPTGIHPKEGISAATVVYTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLELTVKDGSSVHFQRFERGE-YSEPLKIIGETE-ETGTSVMFKADGEIFEDTTYDYEVLLKRLREQAFLNAGIKIVFSDKRDEENKSEVLHYEGGIRQFVEHIHKTKESLSDKVIYVSGM----------QGDSFAEVAMQYNDSYNEVILSFANNIHTVDGGSHETGFKNALTKVINEYGKKFNLLKDGE-KLLGDDVREGLTAIISVKLTDCEFEGQTKGRLGNPEVKGFVEKMVMEKLMCYLEENPVEAKAIFEKSVAAQRAREAAKKARETARRKTAMESASLPGKLADCSEHDTEMTEIYIVEGDSAGGSAKEGRDRRYQAILPLWGKMLNVEKARIDKVYGNEKLMPVVTALGTSIGEDFDISKLRYGKIIIMADADVDGSHIRTLLLTFFFRFMKPLITNGNIYIAQPPLFKVFRGKKVRYAFSDEERDEYIAELNGTKPEVQRYKGLGEMDPEQLWETTMNPETRTMLKIDMEDAVKADETFTILMGDKVAPRREFIEANAKYVENLDI 645
39 0.000e+00JGI.Meta 7062725197 SRS017227_Baylor_scaffold_163894__gene_233393 DNA gyrase, B subunit [Human Supragingival plaque microbiome from visit nu  ali  46  1MENQNKSSNYSASNIQVLEGLEAVRKRPAMYIGDISDKGLHHLVYETVDNSIDEALAGYCTHIEVTICTDNSIIVQDNGRGIPVDMHPKEHRSALEVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSKHMTSQVFRDGKIYQQEYEQGKP-LYPVKVVGET-QLRGTKQQFWPDDTVFTATIYNYDTLATRMRELAFLNAGLKITLTDLRPDEEKQEEFYSEQGLREFVRYVDSSRTHLFNDVIYIS----------TNKADIPIEVAIMYNTSYSENVHSYVNNINTIEGGTHLIGFRQAITRVLKKYAEQTKQIEKAKIEISGEDFREGLTAVISVKVAEPQFEGQTKTRLGNTEVTGAVNQAVGEALTNYLEEHPKEAKLIVDKVILAATARIAARKARESVQRKNPMSGGGLPGKLADCSSKDAAVCELFLVEGDSAGGSAKQARSRTTQAILPLRGKILNVEKAMWHKAFESDEVNNIIQALGVRFGKEANIEKLRYHKIIIMADADVDGQHIATLIMTLFYRYMPQIIEDGYLYIAMPPLYRCKKGHAEEYCYNETARLRFIEQYGDDNITTQRYKGLGEMNPEQLWETTMNPETRLLKQVTLESATNADYTFSMLMGEDVGPRREFIEKNATYA-NID. 652
40 0.000e+00JGI.Meta 7067050650 SRS062544_LANL_scaffold_69498__gene_88044 DNA gyrase, B subunit [Human Tongue dorsum microbiome from visit number 3 of s  ali  53  2......SAEYGADQIQILEGLEAVRKRPGMYIGSTSLKGLHHLVYEIVDNSVDEALAGECSHIEVFINEDNSITVVDDGRGIPVGINKKSGLPAVQVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSKWLEVLVETDGKAYKQRYERG-KVVTPLEEIGPTDR-HGTTVTFLPDEEIFEDTVFDYATIKQRLREMAFLTKGLRISLTDKREDGKKTDSFHYEGGIMEYVSYLNKNQTVLYDKIIYCEG----------KKGTVQVEVALQHNDGYNEGCYSFVNNINTPEGGTHLTGFRNALTKTFNEYAKLMKLVKENDPALTGEDIREGMTAIVSIKIPEPQFEGQTKQKLGNSEARGAVESIAGEQIMIFLEQNPAIGKMIVEKALLAQRARDAARKARDLTRRKTALEYMNLPGKLADCSDKNPDNCEIYLVEGDSAGGSAKDARDRATQAILPLRGKILNVEKSRLDKILENKEIQSMITAFGTGIHEDFDINKLRYKKIIIMTDADIDGAHIDTLMLTFIYRFMPELIRKGHVYLAQPPLYKVEKGNKIWYAYNDKELENIMSEIGRDNNKIQRYKGLGEMDAEQLWETTMDPERRVLLKVMMENASEIDLTFNTLMGDKVEPRREFIEQNAKYVRNLDI 636
41 0.000e+00gi|503791037|ref|WP_014025031.1| DNA gyrase subunit B [Lactococcus garvieae]  clstr ali  54  1MNEENKEQEYDASQIQVLEGLEAVRMRPGMYIGSTSNEGLHHLVWEIVDNSIDEALAGFASHIEVFIEPDNSITVVDDGRGIPVDIQEKTGRPAVETVFTILHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVTVHKDGQKYYQEYHRGV-VVEDLAIIGETDK-RGTVVHFTPDPTIFTETVFDYDKLVTRVRELAFLNRGLRISITDKREGQENNHAFHYEGGIQSYVSFINENKEVIFDTPIYTEG----------ELEGITVEVAMQYTGTYHSTIMSFANNINTHEGGTHEQGFRTALTRAINNYAKAQKLLKDNEENLTGDDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVTGIVNKLFSEALQTFMLENPQVAKKIVEKGILASKARIAAKRAREVTRKKSGLEISNLPGKLADCSSNDPKQTELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKATMDKILANEEIRSLFTAMGTGFGADYDLSKARYHKLVIMTDADVDGAHIRTLLLTLFYRYMRPVVEAGYVYIAQPPIYGIKVGSETEYIQQERELKLALEKWGRAKPTVQRYKGLGEMDDHQLWETTMDPDARLMARVSVEDAAEADKIFDMLMGDRVEPRREFIEANAQYST-IDV 652
42 0.000e+00gi|492761199|ref|WP_005955350.1| DNA gyrase subunit B [Peptoniphilus harei]  clstr ali  50  1MAKDKR--HYDASDIQVLEGLDPVRKRPGMYIGSTGPRGLHHLVYEIVDNSIDEALAGICDHIIIKINKNGSVEITDNGSGIPVDIHPQTGKSTVETVLTILHAGGKFDNSAYKVSGGLHGVGVSVVNALSNKLVATVKRNGKIYRQEFARGIRK-SDLEVIGETTDETGTTIYFEPDDTIFETVEFSDEVLAKRFREMAFLNKGIKIEFIDERKD--LNEVFHYEGGIKSFVEFINAKKKPVHDEIIYIDEI----------REETAVEIAIQYTDSYSEVVLSFANNINTEEGGTHLSGFRSALTRTLNDYGRKNNIIKEKEENLSGEDVREGISAVISVKLPDPQFEGQTKGKLGNSETRGIVDSVLSEDLAVFLEENPRVGKQILDKALSXXXXXXXXXXXXDLTRKKNNLESMTLPGKLADCQNDDPKRNEIFLVEGNSAGGSAKDGRDSAYQAILPLRGKIMNVEKARLDRMLNSSEIRAMITAFGTGIGEEFDLEKLRYDKIIIMTDADVDGAHIMTLLLTFFFRYMKPLIEEGHVYVAQAPLYGIEKGKILRYCHNEKELRLALKEYKDSKVNIKRYKGLGEMDPEQLWETTMNPDNRLLLKVNIDDLAEADDTFSILMGTEVEPRRDFITENAVYADYID. 636
43 0.000e+00gi|503396597|ref|WP_013631258.1| DNA gyrase subunit B [Pseudopedobacter saltans]  clstr ali  50  1MSEAEKNSNYSADNIQVLEGLEAVRKRPAMYIGDTGVKGLHHLVYEVVDNSIDEALAGYCTDILVTIHKNNSITVEDNGRGIPTGINKKENKSALEIVMTVLHAGGKFDKDTYKVSGGLHGVGVSCVNALSTHVITVVHREGKIFTQEYERGKP-LFDVKVIGESDR-TGTIQTFQPDPEIFTTTEYRFDTLAGRLRELAFLNKGIRLVLTDEREGSFLSEEFYSEGGLREFVTFLDSTRTPLIPDAIYIEG----------EKNGIPVELAFTYNNSYNENIHSYVNNINTIEGGSHVAGFRRGLTRTLKSYAEKSGLLKNLKVEITGDDFREGLTAVISVKVQEPQFEGQTKTKLGNTEVTGAVDIAVGEALGNFLEENPKEAKLIVNKVILXXXXXXXXXXXXEMVQRKNVMGGSGLPGKLADCANKDPHVCELFLVEGDSAGGTAKQGRNRDFQAILPLKGKILNVEKAMEHKIYENDEIKNIFTALGVSIGKELNLEKLRYHKVIIMTDADVDGSHITTLILTFFFRYMKQLIEAGNIYIAAPPLYQVKKGKEFEYCWNDVQRDAAVQRLKGGGVHIQRYKGLGEMNAEQLWETTLNPETRTLKRATIESAAEADRIFSMLMGDEVAPRREFIEKNARYAK.... 649
44 0.000e+00gi|984754574|gb|KWW31614.1| DNA gyrase subunit B [bacterium P3]  clstr ali  48  1MSDEKTQTNYGANSITVLEGLEAVRMRPAMYIGDVNFRGLHHLVYEVVDNSIDEALAGYCTSIQVYINEDNSITVEDNGRGIPVDMHEKEHRSALEVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSDRMTAEVYRDGKVYRQEYSRGLP-LYPVKETGTTDK-RGTRIDFHPDPQIFTVTEYDYATLENRLRELAYLNKGIELTLEDRRPKEETKHRFYSEAGLKDFIAYLDENRETLMPEAICIEGN----------RNGIPIEVAMQYNSSYSENIHSYVNNINTHEGGTHLAGFRSGLTRTLKAYADKSGLLVKAKVEIAGEDFREGLTAVISVKVAEPQFEGQTKTKLGNTEVRAAVDSAVSEMLENYLEEHPNEARTIVEKVILXXXXXXXXXXXXEMVQRGNVFSSGGLPGKLADCQDGDPGMCEIYFVEGDSAGGSAKQGRDRRYQAILPLRGKILNVEKAMRHRAFESEEIKNIYTALGVTIGEDLNMEKLRYHKVIIMTDADVDGSHIDTLMLTFFFRYMPELIENGYVYLATPPLYLVQKGKRRIYCWSEEERIAALAEVGDKGIHVQRYKGLGEMNPEQLWETTMDPENRQLRQITIENAASADRIFSMLMGDDVPPRREFIERNATYA-NID. 646
45 0.000e+00gi|496077594|ref|WP_008802101.1| MULTISPECIES: DNA gyrase subunit B [Fusobacterium]  clstr ali  51  2.......NNYGAQNITVLEGLEAVRKRPGMYIGTTSARGLHHLVWEVVDNSVDEALAGYCNTITVSILPDNIIQVEDNGRGIPVDIHPKYGKSALEIVLTVLHAGGKFENDNYKVSGGLHGVGISVVNALSEWTEIKVKRDGNVYYQKYLRGKPI-EDVKIISEAGDTTGTTVTFKPDAEIFETVIFEYEVLQHRLKELAYLNRGLEINLLDCRNEIGKKEKFQFEGGISDFLKEVTHENQVLLSKQIHVEGQA----------EQVGVDIAFTYTTSQSETIYSFVNNINTTEGGTHVTGFRTCLTKVINDIGKSQGFLKEKDGKLQGGDIREGIVAIISVKVPQPQFEGQTKTKLGNSEVSGIVNSVLSVDLKIFLEDNPNDTKLIIEKILNSKKAREAAQRAREAVLRKSVLEVGSLPGKLADCSSKKSEECEIFLVEGDSAGGSAKQGRDRYFQAILPLKGKILNVEKAGLHKALESEEIRAMVTAFGTNIGEEFDLNKLRYGKIILMTDADVDGAHIRTLILTFLYRYMVDLIHNGNVYIAQPPLYKISFGKSIRYAYTDAQLKEILQEGENKKYTLQRYKGLGEMNPEQLWETTMDPEARLLLKVSIDNAREADMLFDKLMGDKVEPRREFIQEHAEYAKNIDI 638
46 0.000e+00gi|503376429|ref|WP_013611090.1| DNA topoisomerase IV subunit B [Odoribacter splanchnicus]  clstr ali  48  1MSEEKNEREYSADSIQVLEGLEAVRMRPSMYIGDVNVKGLHHLVYEVVDNSIDEALAGFCDHIQVTINEDNSISVRDNGRGIPTARHSKENKSALEVVMTVLHAGGKFDKDSYKVSGGLHGVGVSCVNALSTTLIAEIHREGKIWRQEYHKGIPA-GDVQVVGDTDR-TGTTITFLPDDTIFYVTEYKYDILSARLRELAYLNKGIRLSLTDKRENAPRHEVFFSQHGLSEFVEYLDNTREKLIEDTIDI----------ATEKNGIPVEVALHYNTGFSENVFSYVNNINTIEGGTHLTGFKRGLTTTLKAYAESHGMLSKLKFDINSDDFREGLTAVISVKVAEPQFEGQTKTKLGNTEVGTAVSQAVSTVLENYLEENPREAKAIVDKVILAATARHAARKARDLVQRKTVLSGSGLPGKLADCSDNDPAKCEIFLVEGDSAGGTAKQGRDRRYQAILPLRGKILNVEKAMMHRVYESDEIKIIFQALGITIGEDVNLEKLRYHKIVIMADADVDGAHIATLIMTLFFRFMRPVIENGYLYIATPPLYSVKKGKEQRYCWTDKELEQLVNEMGDAGLHIQRYKGLGEMSKEQLWETTMSPENRILRQVSIENAADADRIFSMLMGDDVPPRRQFIEQNATYAT.... 651
47 0.000e+00gi|505138671|ref|WP_015325773.1| DNA gyrase subunit B [Halobacteroides halobius]  clstr ali  52  2....REEVNYDADQIQVLEGLEAVRKRPGMYIGSTEKKGLHHLVYEVIDNSIDEALAGYCDEVEIKIEPGEIITVRDNGRGIPVASHAKLDRPAVEVVMTVLHAGGKFEGEGYKVSGGLHGVGVSVVNALSEWLEVRVHRNGKIYYQKYHRGVP-DNDLEVIGNTE-ETGTEIRFKADEEIFESVRYNYDTLSQRFKELAYLNKEVKIKILDERED-LIEDEFKYDGGIISFVEEINEHNTPIHEDVIFFE----------EQIDNTEVEVAIQYNTDYADKIFTFANNINTHEGGTHLSGFKSALTRTINDYARQNDFLKDDDNNLSGDDIREGIVAIINVRLTDPQFEGQTKTKLGNSEIRGMVDSIVSKGLSTILSENPKLGKQIVKKSIXXXXXXXXXXXXXELTKRKNALVSTALPGKLADCSSRNAEESEIYIVEGDSAGGSAKQGRDREFQAILPLKGKILNVEKARLDRVLSNKEIKSLITALGTGIADEFDMNNLRYRKIIIMTDADVDGAHIRTLLLTFFYRYMRPLLEEGLVYIAQPPLYKVKKGRREEYVYKDRQLQDLLEEIGKKRTSIQRYKGLGEMNPIQLWKTTMDPENRTLLQVQISDEVIADDVFTKLMGDKVKPRREFIQRHAKEVQNLDV 634
48 0.000e+00gi|918570553|ref|WP_052515924.1| DNA gyrase subunit B [Phaeodactylibacter xiamenensis]  clstr ali  48  6MSEQKKPQNYGASNITALEGLEAVRKRPGMYIGSTDTKGLHHLVWEVIDNSIDEHLAGYCNRIETIIHKDNSITVKDDGRGIPVDMHTKLKKSALEVVMTVLHAGGKFDKDTYKVSGGLHGVGVSCVNALSMDLRAEVHRDGKVYEQHYKKGKPQ-GDVAEIGTTDR-NGTFITFKPDPEIFSMLEYSYDILANRMRELSYLNSGLTLTLMDERVTNEKVETFYSEGGLKEFVKSLDKSRTALIDAPIHVIG----------KEENVEVEVALHYNTSFTETIYSYVNNINTREGGTHVNGFRRAVNRLFKQYGEDNGMFKKLKFAISGEDFREGLTAVVSVKVPEPQFKGQTKGELGNSEVTGIVSRCVGEVLGHYLEEHPQAARKIVDKVILAATARHAARKAREMVQRKNVLTGSGLPGKLADCSSRNPDESELFLVEGDSAGGTAKQGRDRRFQAILPLRGKILNVEKAMEHKIYENEEIKNMFTALGVSIEEKLNMEKLRYHKIIIMCDADVDGSHIVTLILTFFFRYMRPLVENGNIYIATPPLYLVKKGKQFRYCWTEDERKEAVAAYGKGGVKVQRYKGLGEMNAEQLWETTMDPDTRILQQVSIDDAQVANDIFSMLMGDEVPPRRAFIEANAKYA-NVDV 658
49 0.000e+00gi|652829666|ref|WP_027114673.1| DNA gyrase subunit B [Lachnospiraceae bacterium NK4A144]  clstr ali  52  2......SQEYGADQIQILEGLEAVRKRPGMYIGSTSARGLHHLVYEIVDNSVDEALAGFCTNIHVWIKPDNSIVVEDDGRGIPVGINHKSGLPGVEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSTWLTVNVYSEGKIYEEKFARGQK-LSDLTVVGECDPEHGTRVSFLPDPEIFETQVYDFSVLRQRLREMAFLTKNLRIELHDERPGQEKDEKYHYEGGIKEFVKYLNKSTTSLYDDIIYCEGA----------RGNVYVEVAMQHNDSYNESSYSFVNNINTPEGGTHLTGFRNAITKTFNEYARKNKILKDSEDNLSGEDIREGLTSIVSIKIEDPQFEGQTKQKLGNTEARNAVESLFTEQLTYYLEQNPNVAKIICEKSIQSQRAREAARKARDLTRRKSALDGLSLPGKLADCSDKNPKNCEIFIVEGDSAGGSAKTARSRATQAILPLRGKILNVEKARLDRVYGNEEIKAMITAFGTGIHDDFDISKLRYDKIIIMTDADVDGAHIATLMLTFIYRFMPELIKQGHVYLAQPPLYKLEKNKKVWYAYSDEELAKIIDEVGRDQNNIQRYKGLGEMDAEQLWETTMDPAKRVLLRVAMDEESVSDLTFMTLMGDKVEPRREFILENAKYVKNLDI 639
50 0.000e+00gi|757130463|ref|WP_042684737.1| DNA gyrase subunit B [Methermicoccus shengliensis]  clstr ali  51  4......SEEYSSEHITVLEGLEAVRKRPSMYIGGTDSHGLHHLVYEIVDNSVDEALAGHCHNIEVVLYPDGSVRVVDDGRGIPVDVHPRYGKSALELVMTTLHAGGKFSHELYKVSGGLHGVGASVVNALSEWLEAKVRRNGKLYYQRYERGRPTTS-VEVVGEAE-GTGTDIWFKPDPLIFGSCGLKYSILADRLRELAFLNRGVRFTIRDESTGT--QEEFEYEGGLVSFVEHLNRNRTVLHKPPMYF----------VRERDSIIVEIAMQYTDGFLESVHAFANNINTIEGGTHLTGFRAALTRTANEYLRKRG----EKVELTGEDVREGLTAVISVKLPNPQFEGQTKTKLANSEVKGVVESLVSEELGYFLDENPTVAETILNKALQXXXXXXXXXXXXXLIRRKSALNGSSLPGKLADCTESDPERCEIYIVEGDSAGGSAKQGRDRRFQAILPLRGKILNVEKSRLDKVLSNTEVSALLTALGCGVGDELDIGKLRYGKIIIMTDADVDGAHIRTLLLTLFYRYMRPLIERGHVYIAQPPLYRVFKGKRELYVYSESELQRAIEELGGDGVGVQRYKGLGEMNPSQLWETTMNPERRTILKVTLEDAIYADEIFSVLMGERVEPRREFIRAHAKEVVNLD. 628
51 0.000e+00gi|493974396|ref|WP_006917483.1| DNA gyrase subunit B [Lactobacillus coleohominis]  clstr ali  51  13.AEKKAESKYDASQIQVLKGLEAVRKRPGMYIGSTTAQGLHHLVWEIVDNGIDEALAGFTDEINVVVEPDNSITVTDNGRGIPVDIQKETGKPALETVFTVLHAGGKFGNGGYKVSGGLHGVGASVVNALSTELDVRVARQGKEYYMDFQ-GGHVKTPMKVIGLPETQHGTIVHFKPDPDIFETTVYNIKTLTDRIRELAFLNKGLKITIEDKRNDEDNRQEFHYEGGIRHYVEFLNRGHELIFDPPIYVEG----------EYNGITVEVSLQYTSGYRCNLLTFTNNIHTYEGGSHETGFKTALTRVINDYGRKSGQLKGNNSTLSGDDVREGLTAVVSIKHPNPQFEGQTKTKLSNSDARTATDHIFSETMNRFMMEHPDTAKKIVEKGMLASKARVAAKRAREVTRKKSGLEISNLPGKLADNTSKDPSISELFIVEGDSAGGSAKQGRSRLTQAILPIRGKILNVEKASLNRVLANDEIRSLFTALGTGFGEDFDVSKANYHKLIIMTDADVDGAHIRTLLLTLFYRFMRPMIEKGYVYIAQPPLYQVRQGKFVKYIETDEELEQVVNSLPSPKPVIQRYKGLGEMDAEQLWETTMDPENRHLLRVDLDDAAAADEIFPMLMGTKVGPRRDFIEKNATFVKNLD. 655
52 0.000e+00gi|973059704|gb|KUK32295.1| DNA gyrase subunit B [Thermoanaerobacterales bacterium 50_218]  clstr ali  49  4.....NSNRYDASQIEVLEGIEAVRRRPGMYIGNTGSKGLHQLVFELIDNSVDEALAGYCDHIEVILHKDGSVTVSDNGRGIPVDIHPQTGRPAVEAALTLLHAGGKFGGNGYEISGGLHGVGLSVVNALSRWLEVEIKRDGKKYFQRYERG-KISSPVKEIGVSE-ETGTKIRFLPDAKIFSERKFNREIIVNRLRDLSFLNRGVKFFFRDENTGE--EVSFLHEGGIIDFVKILNKNKEVLHEQPVYFNAT----------RDGIWIEVAMQYHDGYVENIYSFVNNIHTQEGGTHETGFKTALTRVVNDYARRLGILKNGGPGLSGEDVREGLTAVLNIRMKEPQFEGQTKTKLGNSEVRGIVDSLTTEYLSAFFEENPGPARLITEXXXXXXXXXXXXXXXXXLTRRKSALDHVALPGKLADCVSRDPAECELYLVEGDSAGGSAKQGRDRRYQAILPLRGKIINAEKARLDKLLANEEIKSIITAIGTGILDDFDLSKARYHRIVIMSDADVDGSHIRTLLLTFFYRYMRPLIEAGYVYIAQPPLYRVRKGKEQYYVYSDQELQQLLERLQTTNVEIQRYKGLGEMNAEQLWETTMNPEKRIMLQVTLNDAVKADEIFTILMGEKVEPRREFIQAHAREVRNLDI 634
53 0.000e+00 GL0107692 [Complete] locus=scaffold15858_6:6253:8178:-  ali  51  2...TMENDNYGAEQIQVLEGLEAVRKRPGMYIGSTSSTGLHHLVYEIVDNSVDEALAGYCTHIQVYINEDNSITVVDDGRGIPVGIHKKQGIPAVEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSTWLEVEITRDGKVYKQRYEKG-KVMYKLQVIGEAPEGSGTKVTFLPDHTIFEDNIYDYDILRNRLREMAFLTKGLKISLTDKRLIPEKVRSFHYEGGIKEFVTYLNRHRDPLYNEVIYCEGV----------RDGISVEVALQHNDSYNESTYSFVNNINTPEGGTHLTGFKSAITKVFNDYARKNNIIKDKDDNLSGDDLREGLAAIVSIKISDPQFEGQTKQKLGNSEARPAVESVVTEQLTYYLEQNPQIAKIIVNKAAVAQRARIAARKARDVARKANLSDNMALPGKLADCSDKDPKNCEIYIVEGDSAGGSAKTARSRATQAILPLRGKILNVEKARIDRILGNEEIKAMITAFGTGIHENFNIEKLRYNKIIIMTDADVDGAHIATLLLTFFYRFMPDLIRKGHVYLAQPPLYKLEKNKKVWYAYSDDELNSILDEVGRDQNNIQRYKGLGEMDAEQLWETTMDPEKRILLRVDDDDESEIDMTFNVLMGDKVEPRREFIETNAKYVKNLDI 641
54 0.000e+00 [EC:5.99.1.3][KEGG:K02470] DNA gyrase subunit B;|[COG0187] Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit  ali  50  19MSDEKIETTYDESQIQVLEGLDAVRKRPGMYIGSTSSAGLHHLVYEIVDNSIDEALAGYCTEIKVDINPDNSVTVTDNGRGIPVGIHPQQGIPTVEVVLTILHAGGKFGGGGYKVSGGLHGVGSSVVNALSEHLEVEVSDGEHVHYQSYERGKPTC-KLKVIGDTDK-TGTKITFKPDPEIFEVLEFDYDVLLKRLREQAFLNKGVKILFTDYRVENPETVTLHAEGGIKEFVQYLNRNKDPLHDDIIYFEA----------QREDMMVEVAMQYTTSYTESLLSFANNIHTGEGGTHETGFKSGLTRVINDYAKKNNLLKEKDPNLSGEDTREGLTAVISVKVVEAQFEGQTKTKLGNSEARALVENALNDKLSAFLEENPKIAKIIIEKTLTASRAREAAKKAREAS-RKNSSSNSSLLGKLARCTDEGADYAELFIVEGDSAGGSAKQGRNRRFQAILPLWGKMLNVEKSRIDKVYSNEKLLPIIQALGTGIGDDFNIDNLKYGKIVIMADADVDGAHIRTLLLTFFFRHMRPLIENGNVYIAQPPLFKVFKGKNEKFAFTDDERDRLIAEMG-PGAKVQRYKGLGEMDPAELKETTMDPAKRTMLKVDIEDAMIADETFTILMGDKVEPRREFIEKHAKYVSNLDI 659
55 0.000e+00gi|551064027|ref|WP_022796106.1| DNA gyrase subunit B [Bavariicoccus seileri]  clstr ali  52  1MSEVDKNHEYNASQIQVLEGLEAVRKRPGMYIGSTSSTGLHHLVWEIVDNSIDEALAGFATKIMITINKDNSITVLDDGRGIPVDIQQHTGRPAVETVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSSKLTVQVFKDGIIYQQEYERGV-VKYDLKKVGETT-EHGTKVHFIPDKEIFETTEFDYNTLMTRVRELAFLNKGLNLTLTDLRGEEPVSEKFHYEGGIKSYVSYLDRNVDVLFDEPIYLEG----------EQDSILVEVSLQYTNTYKTTLMSFTNNIHTYEGGTHEAGVKTALTRVINDYARKNNLMRDNEANLSGEDVREGMTMVLSIKHPDPQFEGQTKTKLGNSEARTITDRLFSVHFDRFMMENPTIARQIVDKGLLASKARLAAKRAREVTRKKSGLEISNLPGKLADCSSNDPSINEIFIVEGDSAGGSAKTGRSRHFQAILPIRGKILNVEKASIEKILANQEIRSLFTAMGTGFGGDFDVSKARYHKVIIMTDADVDGAHIKTLLITLFYRYFRPIVEKGYLYIAQPPLYKVKQGKNEEYLNSDEELTELLKTLPKPKPLINRYKGLGEMNAEQLWETTMDPENRYLSQVDIGDAEEANQVLDMLMGDRVEPRREFIEDNAVYVDNLDI 645
56 0.000e+00gi|504842617|ref|WP_015029719.1| DNA gyrase subunit B [Emticicia oligotrophica]  clstr ali  48  1MAENKSKADYGAENIQVLEGLEAVRKRPAMYIGDIGAKGLHHLIWEVVDNSIDEALAGHCDTINVTINPDNSVTVKDNGRGIPTGMHSKEKKSALEVVMTVLHAGGKFDKDTYKVSGGLHGVGVSCVNALSTHLRVEVHREGKVFEQEYSIGKP-LYPVREIGTAED-TGTQVTFKPDNSIFTVTEYKYETVANRLRELSFLNKGITIVLTDLREGNALTDTFYSVGGLAEFVSYIDAGRERLIPEPMFMEGN----------KDGVPVDVAMLYNTSYSENVYSFVNNINTHEGGTHVSGFRMALTRTLKSYAEKSGILAKEKIDISGDDFREGLTAVISVKVAEPQFEGQTKTKLGNSEVTSAVSACVAEMLENYLEEHPKEARIIVDKVILXXXXXXXXXXXXEMVQRKNVLVGTGLPGKLADCSESDPSICEVYLVEGDSAGGSAKQGRNRAFQAILPLRGKILNVEKAQEFRIYENEEIKNIFTALGVQIGRDLNTDKLRYHKIIIMTDADIDGSHIRTLILTFFYRYMKELIERGYIYIAQPPLYLVKKGKEEEYCWTEEQRELAVKRLAGAGVGIQRYKGLGEMNPEQLWETTMRPDKRTLKQVTVESAAEADHLFAMLMGDEVGPRRDFIERNAKYAK-VDI 657
57 0.000e+00gi|576320107|gb|ETZ19821.1| DNA-cytosine methyltransferase [Pedobacter sp. V48]  clstr ali  48  33MSEEKDNSNYSADNIQVLEGLEAVRKRPSMYIGDTGVKGLHHLVYEVVDNSIDEALAGHADTIYVNILEDNSIRVEDNGRGIPTGINTKEQKSALEIVMTVLHAGGKFDKDTYKVSGGLHGVGVSCVNALSTHLRAEVHREGKIWVQEYNIGKP-LYEVKSIGDTDK-RGTIVTFTPDATIFTTTEYRYDTLASRLRELSFLNKGISLTLTDEREGTFRTELFHSEGGLKEFVQFLDGNRPSLIAEPIYVEGI----------KNGIPVELALQYNDSYAENVHSYVNNINTHEGGTHIAGFRRGLTRTLKAYADKSGLLKGVKFEITGDDFREGLTAVISVKVQEPQFEGQTKTKLGNSEVMGAVDIAVGEALGIYLEEYPREAKSIVNKVILXXXXXXXXXXXXEMVQRKSVMGGSGLPGKLADCSDSDPEKCELYLVEGDSAGGTAKQGRDRNFQAILPLKGKILNVEKAMEHKIYENDEIKNMFTALGVSIGEDLNLTKLRYHKIVIMTDADIDGSHITTLILTFFFRYMKALIEAGYVYIAAPPLYQVKKGKEFEYCWNDQQRDAAVQRLKGAGVHIQRYKGLGEMNAEQLWDTTLDPAKRTLMQATIENAAECDHTFSMLMGDDVAPRREFIERNAKYAK.... 681
58 0.000e+00gi|1016781740|emb|CZR00367.1| dna topoisomerase ii signature [Trichococcus palustris]  clstr ali  54  1MAEIEKNKEYDASQIQVLEGLEAVRKRPGMYIGSTSGAGLHHLVWEIVDNSIDEALAGFATKIEIIIEKDNSITVIDNGRGIPVDIQVNTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSSELTVNVYKDNKIYTQTFVRGD-ITSDLTITGDTDK-HGTEVRFLPDPEIFETTVFEFEKLAVRVRELAFLNKGLNISIRDNRPEEPVEQDYYYEGGIKSYVEFLNRNKKVLFEEPIYIEG----------EQDDIQVEVAMQYTDGYHTNLLSFANNIHTYEGGTHESGAKTALTRVINDYAKRNKIIKENEENLTGEDVREGLTLVLSIKHPDPQFEGQTKTKLGNSEARTITDRLFSTFFDKFLMENPQVARQIVEKGMXXXXXXXXXXXXXEVTRKKSGLEISNLPGKLADCSSKNPVESEIFIVEGDSAGGSAKQGRSRFFQAILPIRGKILNVEKASIDKILANEEIRSLFTAMGTGFGGDFDVSKARYHKLVIMTDADVDGAHIRTLLLTLFYRHMRPLVEAGYVYIAQPPLYQVKQGKKEKYLDTDQELEEYLATIPSPKPSIQRYKGLGEMDAEQLWDTTMNPENRHFLQVTVADAIEADATLNMLMGDHVEPRRNFIEENAVYVKNLDI 645
59 0.000e+00gi|493352046|ref|WP_006308711.1| DNA gyrase subunit B [Facklamia languida]  clstr ali  52  1MADTNQNQQYNADQIQVLEGLEAVRKRPGMYIGSTSKEGLHHLVWEIVDNAIDEALAGYCTHIEVTIEADGSITVADNGRGIPVDIQAKTGRPAVETVYTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSSQLSVEVARNGQIHRIEFERG-KILSELQVVGQ-QSETGTKVNFFADPTIFETTDYHYQTLKERIRELAFLNKGLKISLEDKRLDREVADSYQFEGGIKSYVTYLNEDKTVIFDEPIYLEG----------EMDGIALEISLQYTDSYYTTIASFANNIHTHEGGTHESGFKTALTRVINDYARKTNLIKENEENLTGEDTREGMTAIISVKHPDPQFEGQTKTKLGNSEVRTVTDRLFSQHFETYLLENPKVARTIVDKGILXXXXXXXXXXXXEMTRKKSGLEIANLPGKLADCSSKEAEKCELFIVEGDSAGGSAKQGRSRMYQAILPIRGKILNVEKASMDRILNNMEIRSLFTAMGTGFGEEFDVKKARYHKLILMTDADVDGAHIRTLLLTLIFRYMRPLLEAGYVYIALPPLYKIKQGKKEWYLDTDEELRTWQAENPDARYSLQRYKGLGEMNHDQLWETTMNPANRRMQRVKIEDAEQADRIMEMLMGEEVEPRRDFIEKNAVYVRNLDV 639
60 0.000e+00gi|655902586|ref|WP_028973373.1| DNA gyrase subunit B [Spirochaeta cellobiosiphila]  clstr ali  50  2......QDNYSAQNIQVLKGLEAVRKRPGMYIGSTGPDGLHHLVYEIVDNSIDEALAGHCSHIKVVIEHEDIIRVEDDGRGIPVDLHPIENVSAMEVVLTKLHAGGKFEKDAYKVSGGLHGVGVSVVNALSTWCEVTVHQMNHVYFQSYKIGVP-DEPVKVIGDTDR-TGTMVRFKADPNIFDMTVYSFDVLAQRLRELAFLNKGIRITLEDKRSAHEKKHDFFFEGGVKSFVEFLNKNKTKVHGEPIYLEG----------EKDDVFLEIALEWNDGFAENIFSFVNNINTRDGGTHLSGFRSALTRTLNDRLKESKHVKKMDESFSGEDAREGLTAVVSVKVPNPQFEGQTKGKLGNSEVRGIVESFLNDQLSDFFEKNPKVLEQVLEKVVLXXXXXXXXXXXXDLTRRKSVLESAGLPGKLADCSEKDPSKCEIYIVEGDSAGGSAKMGRDRSFQAILPLWGKMLNVEKTRFDKVISNEKLLPVIGALGTSAGPNFDLEKLRYYKVIIMADADVDGSHIRTLLLTFFFRYMQPLVEAGHVYIAMPPLYKIAYGKEVHYVYNDDERKILLKEMPEEKINVQRYKGLGEMNPEQLWETTMNPDSRNMMQVKLEDLVEADEIFTTLMGDNVPPRRKFIEDNALAVSNLDV 639
61 0.000e+00gi|780798300|gb|KJS04408.1| DNA gyrase subunit B [Flavobacteriales bacterium BRH_c54]  clstr ali  47  1MSEEKQKN-YSADSIQALEGMEHVRMRPSMYIGDVGIRGLHHLVYEVVDNSIDEAMGGHCDEIQVWINEDNSIGVRDNGRGIPVDMHKKEGVSALEVVMTKIGAGGKFDKDSYKVSGGLHGVGVSVVNALSDDLKATVYRDGKVYEQEYKKG-KALYPVKEVGTTD-IRGTEVTFKPDGTIFENTEYSFETLKDRMRELSFLNKGVRITITDHREGNSVSNEFYSTEGLKEFVKYIDETREPLIGEVIHMEG----------EKSGIPVEVAMIYNTSYAENIHAYVNNINTHEGGTHLSGFRRGLTATLKKYAETSGMLDKLKFEISGDDFREGLTAIISVKVQEPQFEGQTKTKLGNREVTAPVSQAVTEMLTNYLEEHPADAKTIVQKVILAATARHAATKAREMVQRKNVMSGSGLPGKLSDCASKDPAVCELYLVEGDSAGGTAKQGRDRHFQAIMPLRGKILNVEKAMQHKILDNEEIKNIYTALGVRIGTELNIEKLRYHKVIIMCDADVDGSHIETLILTFFFRYMPELIEKGYIYIATPPLYLVKKGKEQRYCWNDKERDTAIQEIKGAGVHVQRYKGLGEMNAEQLWSTTMNPEFRTLRQINIENAASADHTFSMLMGDDVPPRREFIEANAKYAK-VDI 649
62 0.000e+00gi|737148367|ref|WP_035135502.1| DNA gyrase subunit B [Clostridium sulfidigenes]  clstr ali  52  3.....NNEKYDENQIQVLEGLEAVRKRPGMYIGSTSIRGLHHLVYEIVDNSIDEALAGFCESIQVIIHKDNSVTVIDDGRGMPVGIHPKMHIPTIEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEICEVTVKRDGHIWYQSFSRGKTVT-PFGKIGNTDD-HGTIIHFMPDEEIFESIEFEYDTLSQRLRELAFLNKGINIKITDERYE--KENQFHYEGGIKSFVEYLNRNKGKIHNEPVYIEGI----------KNTTSVELAFQYNDTYNENLFSFANNIDTVEGGTHLVGFKTALTRVLNDYAKKFGFLKENDKNLSGEDVREGLTAVISVKLTDPQFEGQTKTKLGNSEVRGIVESIVGDVVGSFLEENPTVGKSIIEKGLNXXXXXXXXXXXXXLTRRKSVLESTTLPGKLADCSSKDPSECEIYIVEGDSAGGSAKQGRDRRFQAILPLRGKIMNIEKQRLDKILASDTIRSMITAFGGGVGKDFDVSRIRYDRVIIMTDADVDGAHIRTLLLTFFYRFMRDLIDLGHVYIAQPPLYKVKKGKIEQYAYSDDELDKLLIEIGGKSTDIQRYKGLGEMNPEQLWSTTMDPSGRVLLKVSVEDAMAADEIFTILMGDKVDPRREFIRENAKRVSNLDI 635
63 0.000e+00JGI.Meta 7079584188 SRS064276_LANL_scaffold_71076__gene_166038 DNA gyrase, B subunit [Human Stool microbiome from visit number 2 of subject  ali  50  12....ENANHYNENDIQVLEGLEAVRKRPGMYIGSTSARGLHHLVYEIVDNSIDEALAGRCDTVKVIINSDNSITVEDNGAGIPVGIHKQMGIPTVEVVHTVLHAGGKFGGGGYHVSGGLHGVGASVVNALSEYLEVEVSRDGKIYYQRYEKGNTVT-ELKVIGEASH-TGTKTTFKPDGEIFEVLEFDYNILLSRFREMAFLNKGIKIILIDNRAEHPEEVTLHYEGGIISYVEYLNRKETVLHQPPIYIYG----------EKDGSSVEIAMQYNDSYVENIYCYANNIINHEGGTHLTGFRSALTKVFNDYARKYNFIKDNDKNLAGEDVREGLTAIISVKLENPQFEGQTKEKLGNSEIRTLVEGIVNDKLEAFLEENPSTSKLIFEKCLTXXXXXXXXXXXXXMTRRKSALEGTSLPGKLSDCSERDPALCEIYIVEGDSAGGSAKMGRQRETQAILPLWGKMLNVEKSRIDKVYGNEKLLPVITALGANVGPDFDVEKLRYHKIIIMADADVDGSHIRMLLLTFFYRYMRPLIEHGYLYIAQPPLYKVEKGKEFFYAFDDNELDQKVQEKGDKNLTIQRFKGLGEMKPEQLWDTTMNPATRIMLKVHLEDALIANEIFSDLMGEKVEPRKEFIQENAKFVQNLDI 649
64 0.000e+00JGI.Meta 7036511752 SRS015217_WUGC_scaffold_31562__gene_68617 DNA gyrase, B subunit [Human Stool microbiome from visit number 1 of subject 7  ali  51  1MQEEQIEDTYDENQIQVLEGLEAVRKRPGMYIGSTSSRGLHHLVYEIVDNSIDEALAGFCSRILVEIEEDNSITVTDNGRGIPTGIHPKMGISTVEVVFTQLHAGGKFGGGGYKVSGGLHGVGASVVNALSEYLEVEIKNGEHIFYQKYERGQGV-GSLKQIGETT-ETGTKVHFKPDGEIFEGLVYDYDVLRRRLREQAFLNAGINITLVDKRPEDKKMVELKYDGGIREFVEYLNRNKEVIHEDVIYV----------NSVREDSEAEVAMQYNDGYNEMIMSFANNINTTEGGTHETGFKSALTKVINDYARKTGMLKEADANLKGEDCREGLSCVISVKVTEAQFEGQTKTKLGNSEIRTIVEKMVNEKLGEFFEENPTIAKIVVDKAMTASRAREAAKRARESTRRKSALESSSLPGKLADCSDRDNTYTEIYIVEGDSAGGSAKQGRDRRFQAILPLWGKMLNVEKARIDKIYGNDKLTPVITALGAGIGDEFDLNKLRYGKVVIMADADVDGAHIRTLLLTFFFRYMRPLIEDGHVYIAQPPLYKISRGKIEKYAYTDQELQDILTEMGDGRPSVQRYKGLGEMNPSQLWDTTMNPDTRIMLRVDLEDAQQADETFTILMGDKVEPRRKFIEERGTSVINLDI 649
65 0.000e+00gi|655464464|ref|WP_028847417.1| DNA topoisomerase IV subunit B [Thermocrispum agreste]  clstr ali  50  1MAAKK--NEYSASSITVLEGLEAVRKRPGMYIGSTGERGLHHLIWEVVDNAVDEAMAGYATRVEVTLLADGGVRVEDDGRGFPVDEHPTMKKPGVEVALTVLHAGGKFDSKSYAVSGGLHGVGVSVVNALSKRLEVEIHRGGVIWTQKYVNSEP--GPLQKEGTTDR-TGTILSFWPDETIFETTYFNTETVARRLQEMAFLNKGLTMVLRDERKQXXTERTYYYPGGLVDFVKHINASRDTVHDKVISFEAKG----------DGMQVEVAMQWNTGYTPSVYTFANTINTHEGGTHEEGFRAALTRVVNAYARDKKLLKDKDANLTGDDVREGLAAIVSVKLAEPQFEGQTKTKLGNSEAKSFVQTTTNEWLADWFERNPSEAKLIISKAISSAQARLAARKARELVRRKGALDIGGLPGKLKDCRSTNPEECELYIVEGDSAGGSAKEGRDSRYQAILPIRGKIINVEKARIDKVLKNAEVQSLITALGTGIHEEFDISKLRYHKIVLMADADVDGKHITTLLLTLLFRFMTPLIEHGHVYLAQPPLYKIKWQRAEEYAYSDRERDGLLERGAGKKINIQRYKGLGEMNADELWETTMDPANRILLQVTLDDAATADELFSVLMGDDVESRRAFITRNAREAGLLDI 653
66 0.000e+00gi|492549454|ref|WP_005882568.1| DNA gyrase subunit B [Brevibacterium mcbrellneri]  clstr ali  49  1MTADDNRH-YDADDITVLEGLEAVRKRPGMYIGSTSERGLHHLVYEIVDNAVDEALAGFNDRIHVTILADGGVRVEDRGRGIPVAIHSTEKVPTLQVVLTILHAGGKFGGGGYAVSGGLHGVGSSVVNALSKRMDAEVHRDGFVWRQSYERGVP-TGEVTK-GEAADHTGTIITFWPDEEIFDTVQFNFETLRARFQQMAFLNKGLSITLRDERAEKPREVTFKYDNGLFDYVKYLNSTKEPVHEDIISFEAEDT--------EETIALEVAMQWTSSYAESVHTYANTINTHEGGTHEEGFRIALTNLINAYAREQKLLKEKDTNLTGDDVREGLTAVISIKLGEPQFEGQTKTKLGNSEARGFVQRVVRDHLGHWLESNPMQAKEVVRKAIQASQARMAARKAREATRRKSLLESSGLPGKLKDCQSKDPSISEVFIVEGDSAGGSAVQGRDPLTQAILPLRGKILNVEKARLDRALSNLEVQSMITAFGTGIGDEFDIEKLRYHKIVLMADADVDGQHITTLLLTLIFRYMKPLIERGHVYLATPPLYRIKWSNADEFAYTDRERDALLKRLPKE-LGIQRYKGLGEMNYHELWETTMNPDHRLLKQVTLDDAMVADEIFSVLMGDDVDSRKRFIQENAKDVRFLDI 664
67 0.000e+00 [EC:5.99.1.3][KEGG:K02470] DNA gyrase subunit B;|[COG0187] Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit  ali  50  21...TKTNQEYGASEIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNSIDEALAGYCDKIDVSILPGNVIRVKDNGRGIPVGIQPKMGIPAVTVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVKVCDGENIYRQRYERGN-IASDLEIIGKGTTK-GTEITFKADPLIFTETVYEYEVLETRLREQSFLNAGIHIELRDERDENILQNNFLYEGGVSNFVEYIHKKRDVIHPDVIHFEGKMDD--------DSASVEIAMQYNDSYNELILSFANNIHTTDGGTHEEGFKRALTKVMNDYARKFNILKENDKNLSGEDVREGLTAIISVKLKEAQFEGQTKAKLGSTFVRGLVDKLVTEKLSVYLEENPATAKAIFDKALMXXXXXXXXXXXXXLARRKTAMEGAGLPGKLADCQSRNAEETEIYIVEGDSAGGSAKGGRDRRFQAILPLWGKMLNVEKARLDRVYGNDKLMPVITALGCGIGDDFDITKLRYGKVIIMADADVDGSHIRTLLLTFFFRFMRPLIEEGHIYLAQPPLYRLTKNKEHHYAYSDPERDKIMAELG--KADIQRYKGLGEMDSEQLWETTMNPETRIMLRVDMEDAALADETFTILMGDKVEPRREFIEKNAKYVQNLDI 659
68 0.000e+00gi|371910567|dbj|BAL44382.1| DNA gyrase subunit B [uncultured bacterium]  clstr ali  52  1MTNEELK--YDASSIQVLEGLEAVRRRPGMYVGGTDSKALHHLVYEVVDNSIDEALAGACTRIEITIHPDQSVTVEDNGRGIPVDIHPQMKKSALEVVMTTLHAGGKFGGGGYKVSGGLHGVGVSAVNALSAWCEVEVKRHGQRYFQRYERGYPVT-PVQVIGKVENDTGTKTTFKFDAEIFKDVEYRFETLAQRFREMAFVTRGVTIHFVDERSN--RELTFYFEGGITSFVRYLNRNREVLHP-VVYVEK----------QVEGIGIEAAIQYTDAYTESVYSFANTINTVDGGTHLTGLRAAITRVINDYARKNGLLKENDPNFTGDDTREGLTAIISIKHPDPQFESQTKVKLMNAEVQTYVQQVVGEAFATFLDENPGAARAIVQKCLTSXXXXXXXXXXXXLVIRKSALESLTLPGKLADCSERDPSRTELFIVEGDSAGGSAKQGRDRHFQAILPLRGKILNTERSRLDKILSNNEVKAIISALGTGIGDNFDLSNLRYGRVIIMTDADVDGSHIRTLLLTFFFRYMQPLIEEGHLYIAQPPLYRLAWKNQVRYAYTDAEKDEILNSLNGEKVTIQRYKGLGEMNPQQLWETTMNPETRTLLLVTIEDAAEADRTFDMLMGDAVDPRRRFIQTHARAVRNLDI 635
69 0.000e+00gi|944550899|gb|KQM08845.1| DNA gyrase subunit B [Candidatus Bacteroides periocalifornicus]  clstr ali  49  1MTNEQREQDYSATSIQVLEGLEAVRKRPAMYIGDTGSKGLHHLLNEVVDNSIDEALAGYCDTIHVTINADGSLTVADNGRGIPVDYHEKEGKSALEVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSVRLVAEVHREGKIWRMEFSRGI-ATTPLQEVGPCSD-TGTIVTFLPDPEIFTTTTYSFEVLASRLRELAYLNKGITITLTDMRDMQPHSETFHCDEGLKGFVEFLDATRKPIVEKPIYIE----------TERNGVPVEIAMQYNDSYSVNEHSYVNNINTIEGGTHLQGFRLGLTRTLKAYAEGSGMLAKLKFEINSEDFREGLTAIISVKVAEPQFEGQTKTKLGNPEVTAAVSQAVSEALSAYLEENPKDAKAIVNKVIVAAEARNAARKAREMVQRKSALSGAGLPGKLADCTEKDPVRTELFLVEGDSAGGTAKQGRDSKFQAILPLRGKILNVEKALQSAAFTNEEIRSMFMALGVKIGNEIDLSGLRYSKVIIMTDADVDGSHIATLIMTFFYRYMHELIQQGHLYIATPPLYLVKYGKKQQYCWTEPQRMAAIAEYGQGGVQVQRYKGLGEMNDEQLWETTMNPETRLLRQVTITSAAEADRIFSMLMGEDVPPRRQFIEDHAKYA-NLDV 658
70 0.000e+00gi|1011159552|ref|WP_062081029.1| DNA topoisomerase IV subunit B [Bacteroidales bacterium 6E]  clstr ali  48  25.........YGADSIQVLEGLEAVRKRPAMYIGDVNEKGLHHLVYEVVDNSIDEALAGYCTDIEVIIHQDNSITVKDDGRGIPTEIHTKENRSALEVALTVLHAGGKFDKDSYKVSGGLHGVGVSCVNALSIHLKAEIHRNGQIYVQEYSCGKP-LYSVKTVGEAE-GTGTIISFKPDDSIFLVTTYKYEVLAARLRELAFLNAGIKLSLIDERDGSFKGEVFYSEEGLKEFVEYLDDSRVKLTQDVIHVS----------TEKFGIPVEIALQYNTSYSENVHSYVNNINTIEGGSHLTGFRRGLTRTMKNYADQSGMLSKLKIDINGDDFREGLTAVISVKVAEPQFEGQTKTKLGNSDVTLPVDQAVSEMLTNYMEENPKAARIIMDKVVLAAQARHAARKAREMVQRKNAMTGGGLPGKLSDCSERDPQKCEIFLVEGDSAGGTAKQGRDRRFQAILPLRGKILNVEKAMTHKIFESEEIKNIFTALGVTIGKELNITKLRYHKVVIMTDADVDGSHIATLIMTFFFRYMQELIRRGHLYIATPPLYLLKKGKKEAYAWSEQQRLQLIQEWADGNVHIQRYKGLGEMNAEQLWSTTMNPEQRTLQQVTIENAAEADHIFAMLMGDDVPPRRKFIEDHAIYA-NID. 663
71 0.000e+00gi|652818366|ref|WP_027108144.1| DNA gyrase subunit B [Lacticigenium naphtae]  clstr ali  55  14........EYDASQIQVLEGLEAVRKRPGMYIGSTSAEGLHHLVWEIVDNSIDEAMAGFADTIQIIIESDGSVTVIDDGRGIPVDIQQKTGRPAVETVFTILHAGGKFGGGGYKVSGGLHGVGSSVVNALSEYLEVSVHKEGKVYSQRYERGA-VVTELTVTGETER-HGTVVHFMPDTEIFETIEFDFNKLAIRIRELAFLNRGLNISIEDKREGQEKVKAYYYEGGIKSYVEHLNKTKTVLYEDPIHLEG----------EQEGITVEVALQHTDGYHTLLMSFANNIHTYEGGTHESGFKTALTRILNDYARRKKILKENDENLTGEDVREGLTVVLSIKHPDPQFEGQTKTKLGNSEVRTITDRLFSSHFDRFLVENPSIAKKIVEKGILXXXXXXXXXXXXEVTRKKSGLEISNLPGKLADCSSKDPEKSEIFIVEGDSAGGSAKQGRSRKFQAILPIRGKILNVEKASLDRILANEEIRALFTAMGTGFGEEFEAAKARYHKLIIMTDADVDGAHIRTLLLTLFYRFMRPAVEAGFVYIAQPPLYQVKQGKKEVYLDTEAELEEYLKSIPSPKPSIQRYKGLGEMDAEQLWDTTMNPENRRLLQVTIDDAIEANEVFEMLMGETVEPRRQFIEDNAKYVQNIDI 645
72 0.000e+00 GL0071369 [Lack 5`-end] locus=scaffold1672_6:2:1954:+  ali  50  16...ENGKSDYGAKDIRVLEGLEAVRLRPGMYIGSTSARGLHHLVYEVVDNSIDEALAGFCTHIEVTLNDDGSCTITDNGRGIPTGIHE-TGKPAMEVVLTVLHAGGKFGGDGYPISGGLHGVGISVVTALSEWTTVTVKREGHFHEMKLARGV-VTQHMKTFGETTETG-TQVTFKPDGEIFEGTDFDYDTLKVRMRELAFLNKGLTITLTDVRDGATHQDVFCYAGGIVEFIKFLNEGKDLVDPGVISFEG----------EKDRVIVDIAMQYQAGYSESMYTFVNNINTVEGGMHLTGFRNALTRTINDYARSNNLLKPNEENLSGDDVREGLTCVISVKVPNPQFEGQTKTKLGNQDVKGIVDTIVSDGLRTYLEEHPAEAKEIISKSITXXXXXXXXXXXXXLTRRKNALEVSSLPGKLADCSEKDPKFTEIYIVEGDSAGGSAKSGRDRRYQAILPLRGKILNVEKARLDKVLNSDAIRTMITAFGTGVAEDFDIKKLRYYKIIIMTDADVDGAHIRTLLLTFFYRYMKPLITEGHVYIAQPPLYQVRKGRQKYYTYDDVEQDKLLNEIGRDGCAIQRYKGLGEMNPEQLWDTTMNPEQRVMLKVELTDAVEADRLFTILMGDKVEPRRKFIEDNAKNVSNLD. 649
73 0.000e+00gi|472838437|gb|EMS32368.1| DNA gyrase subunit B [Mariniradius saccharolyticus AK6]  clstr ali  49  20MSEKKSQQEYSAGNIQILEGLEAVRKRPAMYIGDVGIKGLHHLIWEVVDNSIDEALAGHCDTIHVTVHENNSVTVEDNGRGIPTDMHPKEKKSALEVVMTVLHAGGKFDKDTYKVSGGLHGVGVSCVNALSTHLKATVHRDGKIFEQEYAIGIPQ-YPVREVG-TTNKRGTTIHFQPDDSIFTITEYKYETIANRLREMSFLNAGIRIFLKDYREGTPRNDEFFSEGGLVEFVQYLDETKEKIIDQPIYIE----------SEKGNVPVQVAMNYNSSYSENVVSYVNTINTYEGGTHVSGFRMALTRTLKSYADKSGMLDKLKIDIAGDDFREGLTAVISVKVAEPQFEGQTKTKLGNSDVAGAVNSAVSEVLQTWLEEHPKEAKTIVGKVILAAQARHAARKAREMVQRKNVLGGGGLPGKLADCANSDPTICELFLVEGDSAGGSAKQGRDREFQAILPLKGKILNVEKAHEHKIYDNDEIKNILTALGVRFGKELDLSGLRYHKIVIMTDADIDGSHIRTLILTLFFRYMRTLIERGYVYIAQPPLYLLKKGKDERYCWTEEERKRLIREMAGEGVNIQRYKGLGEMNPEQLWSTTMDPNTRTLKQVTIESAAEADHLFSMLMGDEVAPRRDFIERNAKYAK.... 668
74 0.000e+00JGI.Meta 7040985061 SRS011105_Baylor_scaffold_1357__gene_2552 hypothetical protein [Human Anterior nares microbiome from visit number 1 of s  ali  52  6.SDVNNTDNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQ-FDLKEVGTTDK-TGTVIRFKADGEIFETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENREDSYHYEGGIKSYVELLNENKEPIHDEPIYI----------HQSKDDIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRALTRVLNSYGLSSKIMKEEKDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGIMXXXXXXXXXXXXEVTRRKSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVYNDRELDKLKSELPTPKWSIARYKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYA-NLD. 643
75 0.000e+00gi|495904377|ref|WP_008628956.1| DNA topoisomerase IV subunit B [Paraprevotella xylaniphila]  clstr ali  47  1MSEEEKGTNYSASSIQVLEGLEAVRKRPAMYIGDISEKGLHHLVYETVDNSIDEALAGYCTHIEVTINEDNSITVQDNGRGIPVDMHEKEHKSALEVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTHMLSQVFREGKIYQQEYECGKP-LYPVKVVGETE-LRGTRQQFWPDSSIFITTTYKYEILANRMRELAFLNAGITIILTDMREGVPRSETFHSKDGLKEFVRYIDSSRIHLFNDVIYL----------NTEKQGVPIEVAIMYNNGYTENIHSYVNNINTIEGGTHLAGFRTALTRTLKKYAKELEKLEKNKVEISGEDFREGLTAVISIKVAEPQFEGQTKTKLGNSEVAGAVQQAVGEALSYYLEEHPKEAKLIVDKVILAATARVAARKARESVQRKSPMSGGGMPGKLADCSDKDAANCELFIVEGDSAGGSAKQGRSRQYQAILPIRGKIFNVERVMWHKAFEHEEVNNIIQALGVRFGKEANYEKLRYYKVIIMTDADVDGSHIDTLLMTLFYRYMPELIQKGHLYIATPPLYRCKKGKIEEYCYTEADRLRFMQQYNNGGMTTQRYKGLGEMNPEQLWETTMNPETRLLKQVTIEDAAGADYVFSMLMGEDVGPRREFIEQNATYA-NID. 654
76 0.000e+00gi|503644380|ref|WP_013878456.1| DNA gyrase subunit B [Halopiger xanaduensis]  clstr ali  49  1MSQE---SEYGAGQIQVLEGLEAVRKRPAMYIGSTDSRGLHHLVYEVVDNSIDEALAGYCDDITVSIHEDGSVSVADDGRGIPVDTHDEYDRPALEVILTVLHAGGKFDNKSYQVSGGLHGVGVSVVNALSERLEAEVKRDGGVFRHAFEQGEPV-GDMERVREPDEETGTEVRFWPDTGIFEAGEFSFSTLANRLRELAFLNSGVRITLRDEREEGPVEETYEYEGGIREFVEYLNETRSAMHDDVIYFE----------DEEQNIQVEVAMQATEELQGSIHAFANNINTREGGTHLTGFKTALTRTVNDYANENSMLSDLDNNLKGEDIREGLTAVISVKHPDPQFEGQTKTKLGNSEVRGIVESAMHEGLGTYFEENPDTAEAIINKAVEAAKARMAAQKAEELTRRKSALESTSLPGKLADCQTKDPDEAELFIAEGDSAGGSAKQARNPEFQAVLPIRGKVLNVEKHRLDRVLENDQIRNIITAIGAGVGDEFDLEDVRYKKVIMATDADVDGAHIRTLLLTFFYRHMRPLLEGGYVYATQPPLYRIRYRGETYDAMTDQERDEIIEEKCDGSPSVQRFKGLGEMNPQQLWDTTMDPSNRILKQITVEDAAAADKMFSVLMGDAVEPRKQFIKENAPEAEWIDI 646
77 0.000e+00gi|1011148949|ref|WP_062070513.1| DNA topoisomerase IV subunit B [Demequina sediminicola]  clstr ali  50  10....EAQPAYGAENITVLEGLEAVRKRPGMYIGSTGERGLHHLVYEVVDNSVDEALAGYCDSISVTLLEDGGVRVQDNGRGIPVDMHPTEGKPTVEVVMTILHAGGKFGGGGYAVSGGLHGVGISVVNALSIRVETEVRRQGFTWNQTFADGGKPQGTL-IKGEATEDTGTQQTFWADPEIFETTEYDFETLRARFQQMAFLNKGLSITLIDERPEHARSVTYKYEGGLVDYVTHLNDAKKAVHADVISLEAEDTDKK--------ISLEMAMQWTNGYAESVFTYANTIATTEGGTHEEGFRAALTSLVNRYARDKGLIKDKDDNLTGDDVREGLTAVISVKLGEPQFEGQTKTKLGNTEAKTFVQKVFGEQLADWFDSHPNEAKEIIRKALQASQARLAARKAREATRRKGLLESGGMPGKLRDCSSKDPSISEIYLVEGDSAGGSAVRGRNPATQAILPLRGKVLNVERARLDRALGNTEIQALFTAFGSGIGDEFELEKSRYHKIVLMADADVDGQHIRTLLLTVLFRYMRPLIEAGYVYLAQPPLYKLKWTNADHYVFTDRERDAVLKEIPKDN-GIQRYKGLGEMDYSELWDTTMNPETRTLLQITMEDAALADETFSILMGDDVESRRNFIQRNAKDVRFLDI 672
78 0.000e+00gi|1002495780|gb|KXT76884.1| DNA gyrase subunit B [Streptococcus sp. DD12]  clstr ali  54  1MSEENKEQAYDASQIQVLEGLEAVRVRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFATEVQVIIEADDSITVVDDGRGIPVDIQETTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVRVYKNGQVYFQEYRQGM-VVEDLRVIDQTDR-HGTTVHFTPDPEIFETTTYDYAKLAKRVQELAFLNRGLRISITDKREGKAQSESFHYEGGIEEYVTFLNESKEAIFPDPIFTEG----------ELEGISVEVAMQYTTAYQENIMSFANNIHTYEGGTHEQGFRTALTRVINDYARKNKLLKDNEDNLSGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSDAFSRFLLENPAVAKKIVEKGILASKARVAAKRAREVTRKKSGLEISNLPGKLADCSSNDASQNELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKASMDRILANEEIRSLFTAMGTGFGADFDVAKARYHKLVLMTDADVDGAHIRTLLLTLIYRFMRPVLEAGYVYIAQPPIYGVKVGSEVKYADQEQRLQEALAEYGRTKPTIQRYKGLGEMDDHQLWETTMNPEHRLMARVSVDDAAEADRIFDMLMGDNVQPRREFIEENAEYST-LDI 648
79 0.000e+00gi|503516976|ref|WP_013751417.1| DNA gyrase subunit B [Dokdonia sp. 4H-3-7-5]  clstr ali  47  1MSDDAKKKEYSADSIQALEGMEHVRMRPSMYIGDVGVRGLHHLVYEVVDNSIDEAMGGYCDAIDVTINENNSITTRDNGRGIPVGLHKKEGVSALQVVMTKIGAGGKFDKDSYKVSGGLHGVGVSCVNALSNHLRATVYKEGKIWEQEYERG-KAMYPVKVIGDTD-FTGTEVTFLPDDSIFQTTEYSYDTLASRLRELAYLNKGITITLTDKRKGEHETETFHSKEGLSEFVRFLDGNRTPIIGEVISMEG----------EKNGIPVEVAMIYNDSYAENLHSYVNNINTHEGGTHLAGFRRGLTGSLKKFADASGMLDKLKFDIAGDDFREGLTAIISVKVSEPQFEGQTKTKLGNREVTSAVSQAVAEMIEIYMEENPNDAKIIVQKVILAAQARHAAKKAREMVQRKTVMSIGGLPGKLSDCSETDPTLCEVFLVEGDSAGGTAKQGRDREFQAILPLRGKILNVEKAMSHKVFENEEIKNIFTALGVTIGTELNLSKLRYHKVVIMCDADVDGSHISTLILTFFFRYMKELVENGYVYIATPPLYLVKKGQKKQYAWNDKERDAIADSMGTQGVSIQRYKGLGEMNAEQLWDTTMNPEFRTLRQVAIDNGTEADRIFSMLMGDEVPPRREFIEKNAIYA-NIDV 647
80 0.000e+00JGI.Meta 7066446790 C2694023__gene_117540 hypothetical protein [Human Buccal mucosa microbiome from visit number 2 of subject 159814214]  ali  52  2......STEYDASQIQILEGLEAVRKRPGMYIGSISSRGLHHLVYEIVDNSVDEALAGFCKTIEVTINKDNSITVLDDGRGIPVDIQKKAGIPALEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSKNLEVRVYKNGKIHEMKFERGN-VLKKLEIVGKCEDKHGTEVRFLPDDTIFEETIYDYDILKVRLRETAFLTKDLKIKLIDKRVED-KQDIFHYEGGIKEFVEYLNKGKEAIYSNVLYCEG----------EKEKVYVEVALQHNDSFTENIYTFVNNINTPEGGTHLTGFKNALTKTFNDYARKNKLLKDNEDNLSGEDIREGLTAIISVKVSEPQFEGQTKQKLGNSEAAIAVNGIVSEQLTYFLEQNPSIAKIICEKAILXXXXXXXXXXXXDLTRRKSALDGLKLPGKLADCSSKNASECEIFIVEGDSAGGSAKSARKRDTQAILPLRGKILNVEKARIDKVFSNAEIRAMITAFGTGIHEEFDISKLRYNKIIIMTDADVDGSHIDTLMLTFIYRFMPELIKEGHVYLAQPPLYKLEKNKRVWYAYSDEELNNILNEVGRDGSNIQRYKGLGEMDAEQLWETTMDPERRILLKVVIENLTETDLTFTTLMGDEVEPRREFIENNAKYVQNLDI 637
81 0.000e+00JGI.Meta 7001416134 SRS053214_LANL_scaffold_27222__gene_77380 hypothetical protein [Human Stool microbiome from visit number 2 of subject 15  ali  51  4..NTNVENEYGADQIQVLEGLEAVRKRPGMYIGSTSSRGLHHLVYEIVDNAVDEALAGYCDIIDVQINKDNSITVRDDGRGIPTDINTKTGKPAVEVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSKWLEVKVCRNGDVHYQRYEYG-HVVEPLKVIDKCDENTGTEVTFLPDDSIFEDTIYDYKVLETRLRETAFLTKNLKIILRDVREEEPIEKTFHYEGGIKEFVTYLNKGKTALYDDVIYCEGT----------VNNVYVEVAMQHNDAYNENTLSFVNNINTPEGGMQVEGFKRALTKTLNNYARNNKILKEKEDNLSGEDFREGLTCIISVKIEDPQFEGQTKQKLGNSEARTAVDGVVSEQLTYYLEQNPVIAKTICEKAVLXXXXXXXXXXXXXTTRRKTALDVAALPGKLADCSDKDPKKCEIFIVEGDSAGGSAKKARVRATQAILPLRGKILNVEKARVDKIMQNAEIRAMITAFGTGIYDEFDISKLRYDKIIIMTDADVDGAHIDTLMLTFFYRFMPELIKEGHVYLAMPPLYQVTRNKKNYYAYSDEELNKILTEIGRDNQNIQRYKGLGEMDASQLWETTMDPKTRILKQVKVNDLTEIDATFNTLMGDEVEPRREFIEANAKFVQNLDI 644
82 0.000e+00JGI.Meta 7022063619 C3686262__gene_141532 DNA gyrase, B subunit [Human Stool microbiome from visit number 1 of subject 159247771]  ali  49  1MSEEEK--GYSANSIQVLEGLEAVRKRPSMYIGDTGMKGLHHLVYEVVDNSIDEALAGFATHIEVTINEDNSITVVDNGRGIPVDLHEKENKSALEVVLTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSDYLRAEVHRDGKIYMQEYSCGVPK-APVKIVGET-KHNGTFITFHPDSKIFTETVYDYKVLATRLRDLAFLNAGISLSLTDCREGNPKKEVFYSKDGLKEFVEYIDSSKEHLIEDIIHI----------NTERQGVPVEVAMTYNTSYNENIYSYVNNINTIEGGTHLTGFRRGLTGTLKKYAEDSKMLEKVKIDISSDDFREGLTAVISVKVMEPQFEGQTKTKLGNNEVIGAVQTAVSEALRYYLEEHPRQAKAIVEKVIIAAQARHAAYNARVKVQRKSPLTGGGLPGKLADCSSRVAEDCEIFLVEGDSAGGSAKQGRDRVFQAILPLRGKILNVEKAMDHKVYDSQEITNMFRALGVTIGTEEDIAKLRYHKIIIMTDADVDGSHIATLLMTFFFRRMRPIIENGYLYLATPPLYKCSKGNNELYCWNDMQVKQFIDNYANKQIKLQRYKGLGEMNPEQLWETTMDPENRMLKQITIESAAEADRIFSMLMGEDVAPRKEFIETNATYA-NID. 646
83 0.000e+00gi|931508269|gb|KPK86745.1| DNA gyrase subunit B [Bacteroides sp. SM23_62_1]  clstr ali  48  4.SENVPNQAYSAESIQVLEGLEAVRKRPAMYIGDVSTKGLHHLVYEVIDNAIDEALAGYCKNIEVIINEDGSVTVIDDGRGIPIDFHEKEKKSALEVVMTMLHAGGKFNKESYKVSGGLHGVGVSCVNALSSKLRAEVHRDRKIHVQEYERGKP-LKDVTVVGETNK-NGTIVTFMPDDTIFTTTDFNFEILASRLKELAYLNKGIQLSITDKREGQFRCEKFFSETGLKEFIHYLDETREKLTENIIYID----------TEKGDMPVEIALQYNTSFSENVHSYVNNINTIEGGTHLAGFRRGLTRTLKNYAEKSGMLAKLKFDINGDDFREGLTAIISIKVQEPQFEGQTKTKLGNSDALGAVDQAVSTMLTNYLEENPRDAKVIVQKVILAATARHAARKARELVQRKNVLSGAGLPGKLADCAEKDPSISELYLVEGDSAGGTAKQGRDRHFQAVMPLRGKILNVEKAMQHKIFENEEIKNIFTALGVSIGTELNLEGLRYHKVIIMTDADVDGSHITTLIMTFFFRYMQELIKEGYLYVATPPLYLIRKGKFEKYCWTEEDRIQTLKELGNDSIHVQRYKGLGEMNSEQLWETTMNPDKRTLRQVTIESAAEADRIFSMLMGDEVPPRREFIETHAKYA-NID. 661
84 0.000e+00gi|499958741|ref|WP_011639475.1| DNA gyrase subunit B [Syntrophomonas wolfei]  clstr ali  50  3......EREYNASDIQVLEGLEAVRKRPGMYIGSTGPKGLHHLVFEIVDNSIDEAVAGFCKKIEVTINQDNSITVCDDGRGIPVDIHPAMGIPALQVILTTLHSGGKFGGSGYNISGGLHGVGLSVVNALSRRMEVRVKRDGHIYQQDYERGNPV-NEIRIIGES-KETGTSICFFADDEIFEEINFEREILLQRLRELSFLNRNLKISLRDEREEEVFYQEFHYSHGLKDFVAYINKNKEVINDNPIYFE----------NKKDDVIVQVAIQYNNSYSENLYSFANNIRTQEGGTHEIGFKNALTRVINDYAKKNNILKENDNNLSGEDIREGIAAIISVLVKDPQFEGQTKTKLGNTYIRGIVESIVFEHVEDYLNENPAAARKLLDKAISXXXXXXXXXXXXXLTRRKNALESTALPGKLADCSNKNPAESELFIVEGDSAGGSAKQGRDRTYQAILPLRGKILNVEKARLDRVLSSEEIRNLITAMGTGIGEDFDIKKARYHKLFIMTDADVDGSHIRVLLLTFFYRYMKELIEEGYLYIAQPPLYGLKRGKEIKYFYNDADLNAFLSQT-EQKWSIQRYKGLGEMDPEQLWTTTMDAESRTVLKVTIEDAIKANDIFSALMGDNVQPRREFIESNARYVANLDI 633
85 0.000e+00gi|493301677|ref|WP_006259279.1| MULTISPECIES: DNA gyrase subunit B [Myroides]  clstr ali  48  1MSQETNKNNYSADSIQALEGMEHVRMRPSMYIGDVGVRGLHHLVYEVVDNSIDEALAGYCDTISVTINEDNSITVEDNGRGIPVDIHKKEGVSALEVVMTKIGAGGKFDKDSYKVSGGLHGVGVSCVNALSDLLRATVYREGKIYEQEYSRG-KALFPVKVIGETDK-RGTSVTFKPDHTIFTTLEFSYDTLAGRLRELSFLNKGLKITLTDKRNGEPKHEVFFSKEGLKEFIKFLDGSRVPIIEDVISME----------LDKGEIPVEVALVYNDTYAENIYSYVNNINTHEGGTHLQGFRMGLTRTLKKYADASGMLDKLKFEITGDDFREGLTAIVSVKVMEPQFEGQTKTKLGNREVVSPVSQAVAEMLENYLEEHPNDAKIIVQKVILAAQARHAAKKAREMVQRKTVMVGGGLPGKLSDCSEQDASKCEVFLVEGDSAGGTAKQGRDRNFQAILPLRGKILNVEKAMGHKVFENEEIKNIFTALGVTMGTELNLEKLRYHKVVIMCDADVDGSHIATLILTFFFRYMRGLIENGYVYIATPPLYMVKKGQRKEYAWTDEERLELMEKMG-SGSSVQRYKGLGEMNAEQLWDTTMNPEHRILRQVTIDSLQEADRVFSMLMGDEVPPRRDFIEKNATYAK.... 643
86 0.000e+00gi|639448062|ref|WP_024626193.1| DNA gyrase subunit B [Lactobacillus fabifermentans]  clstr ali  51  1MTENEKETEYDASQIQVLEGLEAVRKRPGMYIGTTSSQGLHHLVWEIVDNGIDEALAGFADKIHVTVEKDNSITVTDNGRGIPVDIQKKTGKPALETVYTILHAGGKFGGGGYKVSGGLHGVGASVVNALSTELDVKVTRDGKVYYMDFTRG-KVKTPMKVIATPMDAHGTAVHFLPDPDIFETTTYDINVLTTRIRELAFLNKGLQISIRDNRPDEPTEQDFLYEGGIRHYVEFLDKNKSVLFPEPIYVEG----------EQKGITVEVALQYTDDYHSNLMTFTNNIHTYEGGTHEEGFKRALTRVINDYARKNNLLKDSDANLSGEDVREGMTAVVSVKHPDPQFEGQTKTKLGNSDARAAVDRLFSEHFNKYLMENPSIGRKVVDKGMLASKARVAAKRAREVTRKKSGLEISNLPGKLADNSSKDPEISELFIVEGDSAGGSAKQGRSRLTQAILPIRGKILNVEKASIDKILANEEIRSLFTAMGTGFGGDFDLSKANYHKLIIMTDADVDGAHIRTLLLTLFYRYMRPLVDAGFVYIAQPPLYQVRQGKFVRYIDSDEELSEVMGQLPSPKPVVQRYKGLGEMDAEQLWETTMDPERRRLLRVRDEDAADADDVFSMLMGDQVKPRRQFIEDNAKFVQDLDV 649
87 0.000e+00gi|502568534|ref|WP_012818162.1| DNA gyrase subunit B [Ammonifex degensii]  clstr ali  53  4..EEKEREEYRASSIQILEGLEAVRRRPGMYIGSTGPRGLHHLVYEVVDNSIDEALAGFCTEIEVVIKQDNSVLVKDNGRGIPVDIHPQAGRPAVEVVLTTLHAGGKFGGGGYKVSGGLHGVGVSVVNALSEWLEVEVHREGRIWRQRFERGRPVT-DLEAIGETDR-TGTTVHFKPDHQIFEEVVFSQDYLTQRLRELSFLVPEVRIVLRDERTGE--EFVFHHKGGLRDFVRHLNRAREVLHPDPIYLAG----------EREGMVVEAALQYHDGYAESIFSYANTIRTVDGGTHEAGFKAALTRVVNDYGRRHGIIPEN-FQLAGEDVREGLTAVVAVKVPDPQFEGQTKTKLGNTQVRRVVESIVGEGLASFFEENPSIARLIVEKXXXXXXXXXXXXXXXXXXXXKGLLESTSLPGKLADCSERDPAKTELYIVEGDSAGGSAKQGRDRRFQAILPLRGKILNVEKARLDKILANEEIKALITAIGAGIGEDLDLKKVRYHKLIIMTDADVDGAHIRTLLLTFFFRYMRPLIEAGYVYIAQPPLYRVRKGKESFYAYNDAELEKLLSTLGRNGVTIQRYKGLGEMNAEQLWETTMNPEKRVILQVTLEDAVAADELFSTLMGDKVEPRREFISRYARYVRNLDI 636
88 0.000e+00gi|524005035|emb|CCX87003.1| dNA gyrase subunit B [Clostridium sp. CAG:590]  clstr ali  50  3...KSQEQEYGADQIQILEGLEAVRKRPGMYIGTTSEKGLHHLVYEIVDNAVDEALAGYCNEITVTINKDGSVTVVDNGRGIPTGIQEKAGIPAVDVVFTMLHAGGKFGGGGYKVAGGLHGVGASVVNALSDWLEVEIYRDGKVHKQRYEKG-KIIHPLEVTGNT-RKRGTKVTFMPDETIFETLNFDFDTLRTRLREMAFLTKGLKITLADKRAGKEKEREFHYEGGIKEFVQYINRHKDPLYDKIIYCEG----------EKDGVIVEVAMQHNNSYSESVYTFVNNIGTIEGGTHLTGFRSAITKVFNDYARNNKMLKDNEDNLSGDDLREGLAAIVSIKIGDPQFESQTKIKLGNSEARTAVDSVVTEQLTIFLELNPKVAKIIVNKAIQAQRARIAARKARDVARKSTLSDSMALPGKLADCSDKNPENCEIYIVEGDSAGGSAKTARSRSTQAILPLRGKILNVEKARIDRILGNEEIKAMITAFGTGIHENFDISKLRYHKIIIMTDADVDGAHIATLMLTFFYRFMPDLIREGHVYLAQPPLYKLEKNKKVWYAYSDEELDNILKEVGRDQNNIQRYKGLGEMDATQLWDTTMDPEHRILLRVGIEDESEVDLTFNTLMGDKVEPRREFIEANAKFVKNLDI 640
89 0.000e+00gi|268309241|gb|ACY95615.1| DNA gyrase, B subunit [Thermomonospora curvata DSM 43183]  clstr ali  50  3.........YDASSITVLEGLEAVRKRPGMYIGSTGERGLHHLVYEIVDNSVDEALAGYADTIEVTLLADGGVRVADNGRGIPVDEHPVEKRPAIEVVLTTLHAGGKFDGKSYAVSGGLHGVGSSVVNALSTRLDAEVRQKGYVWRQSYTRG--PIAPLAK-GEPTDETGTTITFWPDPEIFETVEWNFETLSRRLQEMAFLNRGLSITLTDERPGEPRRVVYCYEGGISDFVRYLNAKKDAVHPDVISFEEHT----------EGMSVEVAMQWSGSYTESVHTFANTINTAEGGTHEEGFRSALTSVVNRYARDKGLLREKDDNLTGEDVREGLTAIISIKLTNPQFEGQTKTKLGNTEARSFVQKTVHEHLKDWFDREPGQAKEIINKASXXXXXXXXXXXXXDLTRRKSLLESTSLPGKLADCQSTDPAKCELYIVEGDSAGGSAKGGRNPHFQAILPIRGKILNVEKARIDKILKNAEVQAIITALGTGVHDEFDISKLRYHKIILMSDADIDGHHINTLLLTLLFRFMRPLIEAGHVYLSQPPLYKIKWGQDAEYAYSDAERDAIIEAGPRPRDGVQRFKGLGEMNAQELWDTTMDPSRRVLLQVTLDDAAQADELFSVLMGEDVEPRREFIQRNAKDVRFLDI 649
90 0.000e+00gi|972512278|ref|WP_059071127.1| DNA topoisomerase IV subunit B [Cytophagales bacterium MC1A]  clstr ali  49  1MSEKKAPAAYSADSIQVLEGLEAVRKRPAMYIGDIGIKGLHHLVWEVVDNSIDEALAGYCDTIDVTINEDNSIVVRDNGRGIPVDFHQKEGRSALEVVMTVLHAGGKFDKDTYKVSGGLHGVGVSCVNALSNLLRVTVYKNGHVYQQEYERGAP-LYAVKQIGDTER-SGTQVEFWPDDTIFTETVYRYETIATRLRELAYLNKGIRINLTDLREGTARGETFFSEGGLAEFVQYIDGERNVLMPRPIHV----------VSERGGTPVEVALQYNDSYQEHIFSYVNNINTHEGGTHVAGFRSALTRTLKAYADKSGMLEKAKVEIQGDDFREGLTAVISVKVAEPQFEGQTKTKLGNNEVSGAVNQVVGEILNQYLEENPKEARVIVEKVILXXXXXXXXXXXXEMVQRKTVLGSNSLPGKLADCSESNPEACELYLVEGDSAGGTAKQGRDRRFQAILPLRGKIMNVEKAQEHRIYENEEIRNMITALGVTFGEKLNLEKLRYHKVIIMTDADIDGSHIRTLILTFFFRYMRELVDKGYIYIALPPLYLVKRGKEERYCWTEQERAQAQEELGKGRPNVQRYKGLGEMNAEQLWTTTMQPETRSLKQVTVESAAEADHLFSMLMGDEVAPRREFIERNAKYAK-LDV 658
91 0.000e+00gi|738872205|ref|WP_036760656.1| DNA gyrase subunit B [Peptococcaceae bacterium SCADC1_2_3]  clstr ali  51  3...KENNVKYGVEEIQVLEGLEAVRRRPGMYIGSTGARGLHHLVYEVVDNSIDEAMAGFCSLIEVTLHQNNKVTVVDNGRGIPVEIHPKTGLPAVETVLTMLHAGGKFGGAGYKVSGGLHGVGLSVVNALSLCLTCEVKRNGFLYQQRYSRG-KVKTSLEVIGES-KTCGTKITFQPDPEIFEELVFKQEEINQRLRELSFLNQSVKIILKDERTGQEIVH--QHDGGIQDFVHYLNKNKTVVHEKPIYINK----------KKDDVQVEIALQYTDSYLESLFSYVNNIHTIDGGTHEIGFKTALTRVVNDYGRKQNLIKNGTVNLTGEDIREGLTGVISVKVPEPQFEGQTKTRLGNSEVRGIVDSVLSEELNTFLIENQPVARRIIEKAVTXXXXXXXXXXXXXLTRRKNFLENSTLPGKLTDCSERNPAETEIYLVEGDSAGGSAKQGRDRRFQAILPLRGKILNVEKSRLDKILANEEIKTLITALGTGISEDFDLSRLRYHRVVLMSDADIDGAHIRTLLLTFFYRYMRPLVEAGYVYIAQPPLFQVIKGKDNHYVYNDIDLENLLKKVGRDKIVIKRYKGLGEMNPEQLWDTTMDPEKRTMLKVSLTDAIEADAIFSMLMGERVKPRREFIQENARAVRNLDV 635
92 0.000e+00gi|504862081|ref|WP_015049183.1| DNA gyrase subunit B [Thermacetogenium phaeum]  clstr ali  51  13......DRDYDAAQIEVLEGMEAVRRRPGMYIGNTGARGLHQLVFELIDNSVDEHLAGYCDLIEITLHRDGSVTVRDNGRGIPVDIHPRTGRPAVEAALTMLHAGGKFGGNGYEISGGLHGVGLSVVNALSRWLLVEVRRDGRRYQQRYERGQ-VKSPLKDAGAAE-GTGTTVRFLPDGQIFSERKFNREYITARVRDLSYLNKGLRFVLVDEVTGDRQE--FYHEGGIADFVRSLNKNKEVLHQDPLYFS----------DKKDGVVIEVALQYHTGYTEGIYSYVNNIHTQEGGTHEAGFKAALTRIINDYAKKSGYLKENMEKLSGEDTREGLTAVLSVKLKEPQFEGQTKTKLGNSEVRGIVESVVSEHLEEFFEENPGPSKLIVEKAVQXXXXXXXXXXXXXLTRRKTALDHISLPGKLADCTSKDPRECELYIVEGDSAGGSAKQGRDRRFQAILPLRGKIINAEKARLDKMLSNEEIKSIITAVGTGILDDFDLKKARYHRIIIMSDADVDGSHIRTLLLTFFYRYMRPLIEAGYVYIAQPPLYKVQKGKRIEYAYSDRELEKLLRNWKTDNVTIQRYKGLGEMNPEQLWETTMDPERRTMLQVTLTDAMLADEIFTILMGEKVEPRREFIQAHARDVRNLDI 642
93 0.000e+00gi|524102784|emb|CCY78840.1| dNA gyrase subunit B [Mycoplasma sp. CAG:877]  clstr ali  52  1MNEDKVQGSYDSSSIQVLEGLEAVRKRPGMYIGTTSSRGLHHLVWEIVDNAIDEALAGYCTHIEVTIGKDNSITVKDDGRGIPVDIHPKTGKSTVETVYTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSDWLEVKVYKNGNVYYQRFSHGGHPDDSLKIIDKCDDRTGTTVHFLPDDEIFETTVFDYDILMKRLRELAFLNKGLRISLYDDR-EPDKKDSFCYEGGISEYVKMINSNKNPIHETIVDVSGKDK----------DISVEVALQYNETYNSCIYSFVNNITTPEGGTHEDGARRALTRVLNKYGVSANILKQNDDPLTGDDVREGLTMIISVKHPDPQFEGQTKTKLGNSEVRGVVDKIFSEAFERFLMENPDQAKIILDKAMTASRARVAAKKARELTRRKGDLDITNFYGKLSDCKSKDAAVSEIFLVEGDSAGGSAIKGRDSMTQAILPLRGKILNVEKARLDRALSNEEIRTIITAFGTGIGDEFDLNKLRYHKIIIMTDADVDGSHIRVLLLTLFYRFFRPIVEAGHVYAAQPPLFVIKHGKTIKYVLNEQERDEYLATLPNTKYDIARMKGLGEMDAEELNETTMDIHKRVLRQITVEDTIAADDVFSKLMGEDVGPRREFIETNATYVENLDV 642
94 0.000e+00gi|490705470|ref|WP_004568819.1| DNA gyrase subunit B [Polaribacter irgensii]  clstr ali  49  1MSEEKKTYSYDASSIQALEGMEHVRMRPSMYIGDVGPRGLHHLVYEVVDNSIDEAMGGYCDTIDVTINEDNSVTTRDNGRGIPVGIHEKEGVSALQVVMTKIGAGGKFDKDSYKVSGGLHGVGVSCVNALSDLLTATIHKEGKVWQQEYSKG-KALYPVKTIGESD-FTGTIVTFLPDKSIFQTTEFNYDTLATRMRELSYLNKGITITLTDKREGNFISEVFYSDEGLPEFIKYLDSTREQLTSKIISMEG----------EKNGIPVEVAMVYNTSYAENLHSYVNNINTHEGGTHLSGFRRGLTGTLKKYADESGLLKNVKFEIAGDDFREGLTAIISVKVAEPQFEGQTKTKLGNREVSAAVSQSVSEMLTNYLEENPNDAKIIVQKVILAATARHAARKAREMVQRKTVMSIGGLPGKLSDCSETDPAQCEIFLVEGDSAGGTAKQGRDRNFQAILPLRGKILNVEKAMQHKVFENEEIKNMFTALGVSIGTELNLSKVRYHKVVIMCDADVDGSHIATLILTFFFRYMREMVEQGYIYIATPPLYLVKKGQKREYAWDDDQRDFIAQQMGGT-VNIQRYKGLGEMNADQLWDTTMNPEFRTLRQVVIDSPTEADRVFSMLMGDEVPPRREFIEKNAKYAK-IDV 646
95 0.000e+00gi|503531062|ref|WP_013765153.1| DNA gyrase subunit B [Haliscomenobacter hydrossis]  clstr ali  48  13.DESNGADDYGASNIQALEGLEAVRKRPGMYIGSTDSKGLHHLVWEVVDNSIDEHLAGFCTQIDVIVHEDNSVTVKDDGRGIPTGMHPKLKKSALEVVMTVLHAGGKFDKNTYKVSGGLHGVGVSCVNALSDYLRAEVHREGKIFVQEFAKGKP-MGDVQIIGDSP-LHGTTITFRPDGTILEALVFEYEILVRRVKELSFLNKGLKLNLTDERTG--KTESFLSEGGLREFVKYLDGAKKPLLDEPIYV----------MTRKDDVEVEVAMIYNESYQENIYSYVNNIHTREGGTHVRGFRMALARVFKQYGEDSGAFKKLKEEISGEDFREGLTAVISVKVQEPQFKGQTKGELGNSEVTTIVSQCVGDVLKNFVEENPREAKRIVEKVILAATARHAARKAREMVQRKNILTGGGLPGKLADCSSKDPYESEVFLVEGDSAGGTAKQGRDRHIQAILPLRGKILNVEKAMEHKIYENEEIKNIFTALGVSIEENLNIAKLRYHKVVIMTDADVDGSHITTLILTFFFRYMRPLIENGNIYIAAPPLYLIKRGKQERYCWNEEERKATIEEFGGSNVKVQRYKGLGEMNAEQLWETTMDPERRMLRSVNIDDAMEADRVFSMLMGDEVPPRRQFIEENAKYA-NVD. 654
96 0.000e+00gi|489102557|ref|WP_003012418.1| DNA gyrase subunit B [Sphingobacterium spiritivorum]  clstr ali  48  1MSEEKKNSTYSADNIQVLEGLEAVRKRPSMYIGDTGVKGLHHLVYEVVDNSIDEAVAGYCDDILVTIHEGNSISVQDNGRGIPTGINKKENKSALELVMTVLHAGGKFDKDTYKVSGGLHGVGVSCVNALSTLLIAEVHRDGQIFKQEYEKGKPK-YDVKAIGESER-TGTTVTFFPDPEIFTTTVYNYDTLSNRLRELAFLNKGIRLTIVDEREGSFRKDVFFSEGGLQEFVKFLDGNRQSLIPDPIYVEGI----------KQGVPVELALQYNDTYSENVHSYVNNINTIEGGSHVAGFRRGLTRTLKKYAEDSGLLKNLKVEIAGDDFREGLTAVISVKVAEPQFEGQTKTKLGNNEVMGAVDVAVGEILSTYLEENPREAKIIVQKVVIXXXXXXXXXXXXEMVQRKTVMGGSGLPGKLADCSDNDPHKCEIFFVEGDSAGGTAKQGRDRKFQAIMPLRGKILNVEKAMEHKIYENEEIKNMFTALGVSVGDDLNLEKLRYHKIVIMTDADVDGSHIATLILTFYFRYMKELIENGYVYIATPPLYLVKKGKESQYAWTEDQRLQAIQRLKGAGVHVQRYKGLGEMNAEQLWDTTMNPEHRTLRQVTIDNAAECDRIFSMLMGDEVAPRREFIEKNARYAK.... 649
97 0.000e+00gi|692229690|ref|WP_032110072.1| DNA gyrase subunit B [bacterium OL-1]  clstr ali  50  1MAK-KNDNSYDASEIKVLEGLEAVRKRPGMYIGTTSSAGLHHLVWEIVDNSVDEAMAGFCTKIKVTVHPDNSVTVEDNGRGIPVAKHPQKKISTLEVVLTILHAGGKFDNQAYKVSGGLHGVGVSVVNALSKKMVVQVKRDGGIYEMQFARG-KTTEKLKELGKT-KATGTTITFWPDDTIFETTVYDYDTLHDRLQETGFLNKNLKIILTDERELTPRVDEFCYSGGIIDFVKYLNGEKEVLPSKPIYIEGKSDPDAPFSQMGE---VEVALQWNTTYSEHTLSFANDIYTEEGGMHLEGFRTALTKAVNDYGKRQNIIKEKDPNLTGDDIREGLTAVVSVKLPDPQFEGQTKAKLGSSYMRTLTNRIVSQGMAEYLEEHPNQAKEILKKASQAAKGRLAAQKARQATRRKGLLESASLPGKLADCSVRDPEMTELFIVEGDSAGGSAKMARDRSIQAVLPLRGKILNVERVQEHRALSSDTITSLITAIGTGVDQEFDINKARYHKIVIMTDADVDGAHIRILLLTFFYRYMKPMIEAGYVYVAQPPLYQLKKGKKHKYIYTDEELAVEAKEFEDTKYTVQRYKGLGEMDPEQLWSTTMEPKNRILLQVTIDDAMAAERAVSDLMGTQVEKRKDFIQTHAKDVRFLDI 655
98 0.000e+00gi|1010955268|ref|WP_061914495.1| DNA topoisomerase IV subunit B [Bellilinea caldifistulae]  clstr ali  50  17.AQSKDLSSYGAKDIQVLEGLEAVRRRPGMYVGGTDLKALHHLVYEVVDNSIDEALAGFCNRIIVTIHPDSSVTVEDNGRGIPVDIHPEKKKSALEVVMTTLHAGGKFSHSSYKVSGGLHGVGVSAVNALSEWCEVVVCRDGQKYFQRYERGIPQEA-VKVIGKCENRTGTITTFKFDREIFDDVDYKFETLSQRFREMAFVTRKVLIRLVDERSN--RETTFFFEGGIISFVRYLNRNRTTLHP-VFFVEK----------EVDNIGIEVAVQYTDAYAESVYSFANTINTIDGGTHMTGLRTAITRVINDYARRNSLLKDADPNFTGDDTREGMTAIVSIKHPDPQFESQTKVKLMNPEVQTYVQQVVGEAFYAFLEENPSAARAIVQKCLTSXXXXXXXXXXXXLVIRKSALESLTLPGKLADCSERDPNKTELYIVEGESAGGSAKQGRDRHFQAILPLRGKILNTERARLDKILSNNEVKALISALGTGIGENFDLSGLRYGRVIIMTDADVDGSHIRTLLLTFFFRYMQPLIEAGHLYIAQPPLYRIAYKNQVRYVYTEAEKDKVLKELGADKVSIQRYKGLGEMNPQQLWETTMNPANRTLLSVSIEDAAAADRTFDMLMGEAVPPRTRFITTHARNVRNLDV 655
99 0.000e+00gi|524705776|emb|CDE12692.1| dNA gyrase subunit B [Ruminococcus sp. CAG:330]  clstr ali  49  1MTEEMKQQSYDESQIQVLEGLEAVRKRPGMYIGSTGPKGLHHLVYEIVDNAIDEALAGYCTEITVDILPENVVRVTDNGRGIPVGIHPKEGISAATVVYTILHAGGKFGGSGYKVSGGLHGVGASVVNALSEWLKLTVKDGSHVYFQEFHRGN-YDKPIAVIGDTT-ETGTAVEFKADPEIFETTEYDFEVLLKRLREQAFLNAGIRIVFSDKRNEEPHTEILHYEGGIRQFVEYLQKKRESLSEDVIYVSGMDG----------DSFAEIALQYNDSYNDLILSFANNIHTADGGTHEIGFKNALTKVINEYGKKFGLLKDG-TRLLGDDVREGLTAIVSVKLTECEFEGQTKGRLGNPSVKPFVEKMVFDKLMTYFEENPTVARAIFDKSISAQVAREAARKAKETARRKSAMESASLPGKLADCSEKTTEGTELYIVEGDSAGGSAKEGRDRRYQAILPLWGKMLNVEKARIDRVYGNEKLMPVVTALGTSIGEDFDISKLRYGKVIIMADADVDGSHIRTLLLTFFFRFMRPLITNGNVFLAQPPLFKVSKGKKYKYAFDEAERDRYIAEFADAKVGVQRYKGLGEMSSEQLWETTMNPETRSMIRVDMEDAERADEIFTILMGDKVAPRKEFIEKNARYVQNLDV 648
100 0.000e+00gi|1011367842|ref|WP_062280699.1| DNA topoisomerase IV subunit B [Flexilinea flocculi]  clstr ali  48  1MTENTNSSHYDASNIQVLDGLEAVRKRPGMYVGGTDSKALHHLVYEVVDNAVDEALAGFCTQIDITLHEDHSVTVLDNGRGIPVDIHPTMKISALEVVLTTLHAGGKFGGSSYKVSGGLHGVGSSAVNALSEWLEARVYRDGKVYFQRYRCGKP-EARVQIIGDCEDKTGTEITFRFDQSIFEETGYRYETLVNRFREMAFVTKKTKIHLLDERTN--KEMTFYFQGGITSFVHYLNKDKEPLHA-IVHADK----------EIENIGIEFALQYTDVYNETVYSFANTINTIDGGSHMTGLRTAITRVINDYARSANLLKESDPNFSGDDTREGLTAVVSVKHPDPQFESQTKVKLMNTEVATYVQQVVGESFKDFLENNPAAGKAIVSKCLTSSRARDAAKKARDLVIRKSALESMTLPGKLADCSGRNPEKTEMYIVEGDSAGGSAKQGRDRSFQAILPLRGKILNTERARLDKMLANNEIKAMVSAIGCGIGENFNIKGLRYGRIIIMTDADVDGAHIRTLLLTFFFRYMPALIEEGHVFIAQPPLYRIAYRSNVQYAYSDDERDALLKKLGAEKAAIQRYKGLGEMNAEQLWDTTMNPEFRTLLQVTVEDSATASKTFDMLMGQEVPPRTRFIQTHAHEVRNLDI 643
101 0.000e+00gi|523979044|emb|CCX64475.1| dNA gyrase subunit B [Firmicutes bacterium CAG:791]  clstr ali  50  43..DTKDVGSYTADDIQVLEGLQAVRKRPGMYIGTTSSRGLHHLVYEIVDNSVDEALAGYCTHIEVFINPGNSITVSDNGRGIPVGINHKTGMTAVEVVYTILHAGGKFGGGGYKVSGGLHGVGASVVNALSSWLEVTVRQDGKIHVIRFENGGHVKEKLHVVGTCAEDTGTSVTFQPDPSVFETTVYDYDIIKARLREMAFLTKGLKITLTDLREEEPRKDVFHYEGGIREYVAYLNRSKTPLYSEILYFDGT----------KNNVYVEVSMQHNDAYNVSEYSFVNNINTPEGGMHLTGFHNAMTKTFNDYARKNGILKDSEQNLSGDDIREGLTAIVSVKVEDPQFEGQTKQKLGNIEARGAVDSVVSEKLTYYLEQHPDVAKTICEKALLAQRAREAARKARDLTRRKTALETMSLPGKLADCSDKDPKNCEIFLVEGDSAGGSAKSARNRFTQAILPLRGKILNVEKAREDRIYGNEEIKAMITAFGTGIHEEFDIAKLRYDKIIIMTDADVDGAHIDTLMLTFLYRFMPELIRQGHVYLAMPPLFKLERNKKVWYAYSDEELAGILNEVGRDNNNIQRYKGLGEMDPEQLWETTMDPERRILRRVNIESESEVDLTFTTLMGDQVEPRREFIEQNAKFVQNLDV 691
102 0.000e+00gi|662568114|gb|KER09263.1| DNA gyrase subunit B [Chlorobium sp. GBChlB]  clstr ali  48  1MAKDNSKQNYGADNIQVLSGIEHVRKRPAMYIGDVGVRGLHHLVYEIVDNSVDEALAGHNDFIYVSINQDGSVTVTDRGRGIPTGIKKDTGKSALELVMTVIGAGGKFDKNSYKVSGGLHGVGASVVNALSEWCEVEVRREGKIFYQKYKRGVP-EAPVKEVGKTESDHGTKTTFMPDSQIFKNREFRYDTLADRLRELAYLNRELKIIIEDKRSD--KRDEFHFKGGIQEFVVDLDKNRMALFKKPIYMEG----------EKDGTFVDIALQYNNSYQENVFSYVNNINTHEGGTHLTGFRKAFTRTMNTYATKNDLLKSKNIQLTGDDYREGLTAIVSVKVPEPQFEGQTKTKLGNGETQTIVETIVNEKLAEFIEQNPSTAKIIIEKAIGAATAREAARKAKELTRRKSALDSYSLPGKLADCSISDPEHCELYIVEGDSAGGSAKQGRDRRFQAILPLKGKILNVEKARLNKMLENEEIRTIITALGTGIGDDFDPTKIRYGKLILMTDADIDGAHIRTLLLTFLFRYMRALIEAGRVYIAQPPLYLVKRGKEQVYAWDDEERDDAIKRFGKDNIMVQRYKGLGEMNPEQLWTTTMDPENRTLLKVSIDSALEADKIFSTLMGDEVEPRRKFIESNAKYVRRLDV 650
103 0.000e+00gi|916933664|ref|WP_051540376.1| DNA gyrase subunit B [Ruminococcus sp. FC2018]  clstr ali  51  5.SQVDKSNNYDENQIQVLEGLEAVRKRPGMYIGSTGARGLHHLVYEIVDNAIDEALAGYCTQIDVEILEGNIIRVTDNGRGIPTGIHPKEGISAATVVYTILHAGGKFGGGGYKVAGGLHGVGASVVNALSEYLELTVYDGKNIHFQHFDRG-HYTEPLKIIGETDK-TGTSVTFKADPEIFETTVYDYEVLEKRLREQAFLNGGIKIVFTDKRDENIKGETLHYEGGIRQFVEHIHKTREALSEEVIYVSG----------KEDDMFAEVALQYNDTYNDLILSFANNIHTPDGGSHETGFRVALTRVINEYGKKFGYLKDGD-KLLAEDVREGLTAIVSVKLTNCEFEGQTKGRLGNPEVRPFVDKLVTEKLMNYFEENPPVAKAIFDKSVQAQKAREAAKKARELTRRKSALESSSLPGKLADCSERDASITEIYIVEGDSAGGSAKEGRDRKFQAILPLWGKMLNVEKARIDRVYGNDKLSPVVTALGTSIGEDFDLSKLRYGKVIIMADADVDGSHIRTLLLTFFFRFMRPLIEHGHVYLAQPPLFKVQKGKQFRYAYTDAQRDRYIEEYNGGKINVQRYKGLGEMDPMQLWETTMDPETRTMIRVTMEDAVKADEIFTILMGDKVQPRKEFIEKNAEYAKELDV 646
104 0.000e+00gi|738449294|ref|WP_036400481.1| DNA gyrase subunit B [Microcystis aeruginosa]  clstr ali  49  2......TSNYGAEQIQVLEGLEPVRKRPGMYIGTTGPRGLHHLVYEVVDNSIDEALAGYCTHIEVDIKADGSVSVTDDGRGIPTDVHPTTGKSALETVLTILHAGGKFGSGGYKVSGGLHGVGISVVNALSAWVDVTVWRDHKVHTQRYERGIPVT-ELVSSPSQEEKTGTRVNFLPDTEIFQGIEFDYSTLSGRLRELAYLNAGVKITFSDYRAEEPHIETYCYEGGIKEYVAYMCREKETLHKDIIYVSG----------EKNGINIEVAFQWCDAYSDNILGFANNIRTIDGGTHLEGLKAVLTRTLNNVARKRNKIKENEPNLAGENVREGLTAVISVKVPEPEFEGQTKTKLGNTEVRGIVDSLVGETLNEYLEQNPQVADTIIEKAVQAYKAAEAARRARDLVRRKSVLESSPLPGKLADCSERDPEKSEIYIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIEKTDDAKIYKNTEIQSLITALGLGIGEDFDPSQLRYHRIVLMTDADVDGAHIRTLLLTFFYRYQKNLIDQGYVYIACPPLYKLERGKNHSYCYSDRELQQKIAEFPNANYTIQRFKGLGEMMPQQLWDTTMNPETRTLKRVEIEDAAKAEELFTILMGDRVAPRREFIETHGPNLTDLDI 640
105 0.000e+00gi|489229963|ref|WP_003138309.1| DNA gyrase subunit B [Lactococcus raffinolactis]  clstr ali  55  11.DKKEKAAEYDASQIQVLEGLEAVRMRPGMYIGSTSSEGLHHLVWEIVDNSIDEALAGFASHIEVFIEPDNSITVVDDGRGIPVDIQEKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVTVFKQGKKYYQEYHRGV-VGGDLEMIGETDR-HGTTVHFTPDPTIFETTEFDFQKLAKRVRELAFLNSGLRISITDKRPEEAESLHYHYEGGIQSYVEYLNEEKTVLFEPAIFTEG----------EMEGIAVEVAMQYTGSYHSMVLSFANNISTHEGGTHEQGFRTALTRVINNYAKSNKLLKENEENLTGDDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVSGIVNKLFSEEFGTFLLENPQVARRIVEKGILASKARIAAKRAREVTRKKSGLEISNLPGKLADCSSNDPTQTEIFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKASMEKILANEEIRSLFTAMGTGFGADFDVSKARYQKLVIMTDADVDGAHIRTLLLTLFYRYMRPVVEAGYVYIAQPPIYGVKLGDKITYVNQETELQTAVLEMGNRKPIVQRYKGLGEMDDHQLWETTMDPEHRTMAQVSVEDAAEADQIFDMLMGDRVEPRRDFIEANAQYST-IDI 653
106 0.000e+00gi|496141208|ref|WP_008865715.1| DNA gyrase subunit B [Flavobacteria bacterium MS024-2A]  clstr ali  48  1MSEENQNKQYSEDSIQALEGMEHVRMRPSMYIGDIGIRGLHHLVYEVVDNSIDEALGGYCDEISVVINEDNSITTKDNGRGIPVGIHKKEGVSALEVVMTKIGAGGKFDKDSYKVSGGLHGVGVSCVNALSERLTATVYRDGKVWEQTYERG-KALAPVKSIGDS-KETGTLVTFRPDAQIFTTREYNYDTLSLRMRELAYLNKGIKISITDRREGEFKSETFLSEKGLIEFIHFLDESREAIIGDVISMEG----------EKNGVPVEVAMIYNTSYSENLHSYVNNINTHEGGTHLAGFRRGLTSTLKKYADSSGLLDKLKFEIAGDDFREGLTAIISVKVGEPQFEGQTKTKLGNREVTSAVSQAVSEMLENYLEENPNDAKIIVQKVILAAQARHAAKKAREMVQRKTVMSGGGLPGKLSDCSEQDPALCEVFLVEGDSAGGTAKQGRDRNFQAILPLRGKILNVEKAMQHKVFENEEIRNIYTALGVTIGTELNLEKLRYHKVVIMCDADVDGSHISTLILTFFFRYMRELIESGYIYIATPPLYLVKKGQKKDYAWSDDQRDLLMQEFG-SGSSVQRYKGLGEMNAEQLWDTTMNPQERTLRKVTIDNGGEADRVFSMLMGDEVPPRREFIEKNAIYA-NIDV 646
107 0.000e+00JGI.Meta 7036961222 SRS021954_Baylor_scaffold_55432__gene_62719 DNA gyrase, B subunit [Human Tongue dorsum microbiome from visit number 2 of  ali  51  1MEENM---SYEAQNITVLEGLEAVRKRPGMYIGTTSERGLHHLVWEIVDNSVDEALAGYCNKIEVKILPDNIIEVVDNGRGIPTDIHPKYGKSALEIVLTVLHAGGKFENDNYKVSGGLHGVGVSVVNALSEWLEVEVRKEGNVYYQKYHRGKP-EEDVKIIGSCESEHGTTVRFKADGDIFETLVYNYFTLSNRLKELAYLNRGLTITLSDLRKDEKKEETYKFDGGILDFLNEIVKEETTIIDKPFYVSA----------EQDNVGVDVTFTYTTSQNEVIYSFVNNINTHEGGTHVQGFRTALTKVINDVGKAQGLLKDKDGKLMGNDIREGVVAIVSTKIPQPQFEGQTKGKLGNSEVSGIVNTIVSNSLKIFLEDNPAITKIVVEKILNSKKAREAAQKARELVLRKSVLEVGSLPGKLADCTSKKAEECEIFIVEGDSAGGSAKQGRDRYNQAILPLRGKIINVEKAGLHKSLESSEIRAMVTAFGTSIGETFDISKLRYGKIILMTDADVDGAHIRTLILTFLYRYMRDLITEGNIYIACPPLYKVASGKQIIYAYNDLELKNILAQMENKKYTIQRYKGLGEMNPEQLWETTMNPDGRLLLKVSIDNAREADMLFDKLMGDKVEPRREFIEEHAEYVKNIDI 639
108 0.000e+00gi|921242040|ref|WP_053186476.1| DNA topoisomerase IV subunit B [Sunxiuqinia dokdonensis]  clstr ali  48  1MSEIENKQNYSADSIQVLEGLEAVRKRPAMYIGDVNEKGLHHLVYEVIDNSIDEALAGYCNNIEVIINEDNSITVTDDGRGIPTEKMTKENKSALEVVMTVLHAGGKFDKDSYKVSGGLHGVGVSCVNALSTVLTAEIHRDGKIWMQEYRKGVPQ-YEVKQVGETEK-SGTIVTFKPDDTIFLTTTYKYEILSARLRELAFLNAGIRLVLIDKREGNFKRDDYFSEEGLKEFVEFLDSAREKLIDETIHIS----------SEKAGIPVEIALHYNTSFSENIHSYVNNINTIEGGSHLTGFRRGLTRTLKGYAETSGMLSKLKFDISGDDFREGLTAVVSVKVQEPQFEGQTKTKLGNSEVSLPVDQAVSEMLSYYLEENPKAAKAIVNKVILAATARHAARKARELVQRKNVMSGGGLPGKLADCSDKDPAECEIYLVEGDSAGGTAKQGRNRRFQAILPLRGKILNVEKAMQHKVFDNEEIRNIFTALGVSIGTELNMSKIRYNKIIIMTDADVDGSHIATLIMTFFFRFMNDLIKAGYLYIATPPLYLIKKGKREAYAWNDQQRLQLINEWADGKVHTQRYKGLGEMNAEQLWSTTMDPERRTLRQVTIENAADADHIFSMLMGDEVPPRRQFIEDHAVYA-NID. 655
109 0.000e+00gi|931475613|gb|KPK56988.1| DNA gyrase subunit B [Gemmatimonas sp. SG8_38_2]  clstr ali  51  2...............QVLKGLEGVRRRPSMYIGSTSSRGLHHLVYEVVDNSIDEAMSAYCDQIEVTIPKDNSITVSDNGRGIPVDRHPTEKVPGVELAMLTLHAGGKFDKDSYKVSGGLHGVGVSVVNALSEWLNVEIHRDGKIWQQSYSRGQKKT-ELKAGGKTDK-TGTIVSFKADPEVFTELEYDFDALAIRLRELAFLNRGVKVTLKDEREGQERKSNYQYDGGIKEFVKYLRGNKKALHTEIVYLE----------SKRSECEMELALQYNDGYKEDTFTFVNNINTHEGGTHLTGFKAALTRTLNDYARRAGMLKKVGYTLTGEDVREGLTAILSVRVMDPQFEGQTKTKLGNSEVRGAVESVVNEGLSNFLAENPSAARRVIEKTMXXXXXXXXXXXXXDLTRRKSALEGSILPGKLADCSLTDPSMSELYLVEGDSAGGSAKQGRDRNFQAILPLRGKILNVEKARLDKVLTNEEIRTIITAVGTGIGEDFNLENARYHRVIIMTDADVDGAHIRTLLLTFFFRHMRQLIEAGYVYIAQPPLYRVKRGKEEHYAYSDDERNDIMKRMDGDKADIQRYKGLGEMNPDQLWKTTMDPERRTILRVTMDDALEADRLFTLLMGDEVEPRRAFIEQNAKYVKNLDV 628
110 0.000e+00gi|502934295|ref|WP_013169271.1| DNA topoisomerase IV subunit B [Arcanobacterium haemolyticum]  clstr ali  49  1MSDEQKTAEYNASNITVLEGLEAVRKRPGMYIGSTGERGLHHLVYEVVDNSVDEALAGYASEITVTLLDNGGVKVEDDGRGIPVDIHPTEGVAAVQVVMTVLHAGGKFGNGSYAVSGGLHGVGISVVNALSTRMDTEVRRDGYVWRISYENGVPV-APLEQ-GEPTDKTGTTQTFWPNADIFETVEFDFDTLRQRFHQMAFLNKSLKITLIDERETKHTQVTYQYDNGLHDYVTHLIKTKEPVHEHPIYFEAEDKERV--------ISVEVAMQWTNAYSESLHTFANTINTTEGGTHEEGFRTALTSIINKYARDKAILKEKDANLTGDDIREGLTAVISVKLGEPQFEGQTKTKLGNTEARTFVQQTTYAQLTDWLDMHPSEGKEIIRKAMQAQTARLAARKAREATRRKSVLESAAMPGKLKDCTSRKPEECEIFIVEGDSAGGSAVNGRDPNHQAIMPIRGKILNVEKARLDRALSSDSIQSLITAFGTGVGEEFDIDKLRYHKIVFMADADVDGQHIATLLLTLVYRYMRPLIEHGYIYLAMPPLYRLKWTNEHEYVFSDKERDIKLEEGKAEGQGIQRYKGLGEMNDHELWDTTMNPETRTLKRVSIGEAAATDESFSVLMGEDVASRRSFIQRNAHDVRFLDI 682
111 0.000e+00gi|501491649|ref|WP_012500095.1| DNA gyrase subunit B [Chloroherpeton thalassium]  clstr ali  49  1MSEEEKSLEYGASNIQVLDGIEHVRRRPAMYIGDVGVRGLHHLVYEIVDNSVDEALGGYNDYIFVQIKSNGSILVRDKGRGIPTDIHPQKNTSALQLVMTVIGAGGKFDKGAYKVSGGLHGVGASVVNALSEWCEVEVYREGKIFFQGYEKGIPK-APVSVIGTTS-ENGTKTTFLPDESIFKNREFRYDTLADRMRELAYLNKNLTIVIEDERDG--RRDEFHFKGGIQEFVTFMDSTRLKLIKEPIYFEG----------EKDGTVVEIAFQYNDSYQENAFSYVNNINTHEGGTHVTGFRKALTRTLNYYGQKNDLFKNLKISLTGEDFREGLTAILSVKVPEPQFEGQTKTKLGNSETQSIVESIVNEKLAEYIEQHPNEVKIILEKVVSAAIARDAARKAKDLTRRKSALESSSLPGKLADCSINDPEHCELYIVEGDSAGGSAKQGRDRRFQAILPLKGKILNVEKARLNKMLENEEIRTLIMALGTSIGEDFDASRLRYGKIILMTDADVDGAHIRTLLLTFFFRYMRGLVEGGRVFIAQPPLYLIKSGKQQWYAWDDDERDDILKQFGKENYGIQRYKGLGEMNADQLWSTTMDPEKRTLLMVTIENAMEADKIFSTLMGDQVEPRRAFIETNAKYVRRLDV 644
112 0.000e+00gi|504491748|ref|WP_014678850.1| DNA gyrase subunit B [Solitalea canadensis]  clstr ali  49  1MSEETKAANYSADNIQVLEGLEAVRKRPAMYIGDVGVKGLHHLVYEVVDNSIDEALAGFCNDIYVTIHKDNSISVKDNGRGIPTGMHTKEKKSALEVVMTVLHAGGKFDKDTYKVSGGLHGVGVSCVNALSTHLKAEVHREGKVWVQEYERGKPQ-YDVKTVGET-NITGTIVTFTPDTEIFTTTIYNYDTLAARLRELAYLNKGIRLTLTDEREGSYVVNSYFSEGGLKEFITYLDGNREPLIPEPIYIDGN----------KSGIPVELALQYNSTYSENVHSYVNNINTIEGGTHVAGFRRGLTRTLKSYAEKSGLLKNLKVEITGDDFREGLTAVVSVKVAEPQFEGQTKTKLGNNEVIGAVDQAVGEILGVYLEEHPKEARLIVQKVVLXXXXXXXXXXXXEMVQRKSVMSGSGLPGKLSDCSNNDPEACELYLVEGDSAGGTAKQGRDRNFQAILPLKGKILNVEKAMEHKIYENEEIKNIFTAMGVSIGEDLNLEKLRYHKIIIMTDADVDGSHITTLILTFFFRYMKALVEQGYIYIATPPLYLVKKGKDFEYAWTEEQRLAAIERVKGNGVNIQRYKGLGEMNAEQLWETTMNPDTRTLRQVTIENAAECDHTFSVLMGDEVAPRRDFIEKHAKYAK.... 650
113 0.000e+00gi|749531603|ref|WP_040167955.1| DNA topoisomerase IV subunit B [Microbacterium sp. G3]  clstr ali  49  22....TPESHYGADDIQILEGLEAVRKRPGMYIGSTGPRGLHHLVQEIVDNSVDEALAGYASRIDVTILADGGVRVVDDGRGIPVDPHPT--KSTVEVVLTILHAGGKFGGGAYAVSGGLHGVGSSVVNALSTRFEVNVSQKGRVWSQTFADGGEPQGSLTP-GESTDRTGTDITFWPDPTIFETVEFDYDTLRTRFQQMAFLNKGLRIALRDEREMVQRSDEFYYERGLVDYVEYLNRVREVVNDEIIDFESEDSVRK--------ISLEVAMQWTNSYTENVFTYANVINTHEGGTHEEGFRAALTTLVNRYARANNLLKEKDDNLTGEDIREGLTAVVSVKLSEPQFEGQTKTKLGNTEAKAFVQRIVGEELGDWFERNPVQAKNVIRKAIDAATARMAARKARETARRKSVFESAAMPDKLKDCTSKDPSISEIFLVEGDSAGGSAVQGRDPHTQAILSLRGKILNVERARLDKALANKEVQAMIQAFGTGIGEDFNIDKARYHKIVLMADADVDGQHITTLLLTMLFRFMRGLIEAGFVYLAMPPLYRLKWTQEHEYVFSDEERDARLAAGQAAGAGIQRYKGLGEMNPKELWETTMDHTTRTLRQVTIDDAAAADEIFSVLMGEDVESRRDFIQRNAKDVRFLDI 683
114 0.000e+00JGI.Meta 7004764909 SRS013705_Baylor_scaffold_101880__gene_133169 DNA gyrase, B subunit [Human Tongue dorsum microbiome from visit number 1  ali  50  1MSEEKVNTQYDAAQIQVLEGLEAVRKRPGMYIGSTGARGLHHLVYEVVDNSVDEALAGYCKHIKISINKDGSLTVEDDGRGMPVDNHPKLGIPAVEVIHTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTDMVVEIKRNGKIYRQEYKRGKTVT-PLEVIGES-KSTGSKTTFWPDAEIFETVEFDYDTLQHRFREMAFLNKGIKISITDERVTPKKKEVFHYEGGLKEYVHYINQNKEVLHKDVIYFD---------VENKNSMEVEVALQYTDRYNEFILSYANNINTTDGGTHMAGLKSALTRAINDYAKKSKILKDSDPALSGEDIREGITAIVSVKLAQPQFEGQTKAKLGNSDVRGFVETATNDNLTAYLEEHPQEAKIIIEKCIIASRAREAARKARDLTKRKNALDSTSLPGKLADCSEKDPALSEIFLVEGDSAGGSAKQGRDRSRQAVLPLRGKILNVEKARLDKILNSEEIKNMITAFGCGVGDNFDASKLRYHKIIIMTDADVDGAHIRTLLLTFFFRHMTPLIEGGYVYAAKPPLFMSKQGKDVYYTYSEPEQEKLLAELKKTKVDIQRYKGLGEMDFHQLWETTMDFNNRTLVQITMDDASQADEIFTILMGDKVPPRKKFIEDNAKYAE-IDI 641
115 0.000e+00JGI.Meta 7058568563 SRS011529_WUGC_scaffold_28729__gene_58738 DNA gyrase, B subunit [Human Stool microbiome from visit number 1 of subject 1  ali  47  1MEDTEKKSGYSASNITVLEGLEAVRKRPAMYIGDISEKGLHHLVYETVDNSIDEALAGYCTHIEVTICEDNSIIVQDNGRGIPVDMHPKEHRSALEVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTKMVSKVFRDGKIYRQEYAKGHPQ-APVEVVGTTE-LRGTRQHFWPDPTIFTTTTYKYEILANRMRELAYLNAGITITLTDLREGNTRKEVFHSDLGLREFVRFIDSSRQHLFNDVIYL----------NTEKNNIPIEVAIMYNTSYSENIHSYVNNINTIEGGTHLVGFRQAITRVLKKYAEETKQIEKAKVEISGEDFREGLTAVISVKVAEPQFEGQTKTKLGNSEVTGAVNQAVGEALNYYLEEHPKEAKLIVDKVILAATARIAARKARESVQRKSPLSGGGLPGKLADCSTKDPALCEIFLVEGDSAGGSAKQGRSRATQAILPLRGKILNVEKAMWHKAFESDEVNNIIQALGIRFGKEANLEKLRYHKVIIMADADVDGQHIATLIMTLFYRYMPQIIQDGYLYIAMPPLYKCTKGKVSEYCYNDRDRQIFMDKYGDGSIKTQRYKGLGEMNPEELWSTTMCPETRLLKQVSLENAADADYIFSMLMGDDVGPRREFIEKNAVYA-NID. 651
116 0.000e+00gi|501263944|ref|WP_012306962.1| DNA gyrase subunit B [Synechococcus sp. PCC 7002]  clstr ali  50  2......TSNYSAQQIQVLEGLEPVRKRPGMYIGTTGPRGLHHLVYEVVDNSVDEALAGYCTEINVEINADGSVTVTDNGRGIPVDVHPSTGKSALETVMTVLHAGGKFGAGGYKVSGGLHGVGVSVVNALSEWVEVTVWRDETTYKQRYERGVPQ-GELTEAPAPQHLSGTSVCFLPDAKIFETTVFDYNTLAGRLRELAYLNAGVRIVFTDHRSEKQASNTYFYEGGIKEYVAYMNREKSPLHEEIIYVTG----------EKNGVQLEVALQWTDAYSDNLLGFANNIRTVDGGTHLEGLKSVLTRTMNTVARKRNKLKDNDSNLAGENIREGLTAVISVKVPDPEFEGQTKTKLGNSEVRGIVDSFVGEVLTEYFEFNLNVVDAILEKAIQAFKAAEAARRARELVRRKSVLESSLLPGKLADCSERDPAKTEIYLVEGDSAGGSAKQGRDRAFQAILPLRGKILNIEKTDDAKIYKNNEIQSLITALGLGIGEEFNPEKLRYHRVVIMTDADVDGAHIRTLLLTFFYRYQRELVDQGYIYIACPPLYKLERGKNHAYCYSDRELQDQISQLPNAKYNIQRFKGLGEMMPQQLWDTTMNPESRTLKRVEIEDAAEADRIFTVLMGDRVAPRREFIEMNAPNMDDLDI 640
117 0.000e+00gi|972257335|ref|WP_058963428.1| DNA topoisomerase IV subunit B [Ruminococcaceae bacterium AM2]  clstr ali  48  1MAEELNKQQYDGSQIQVLEGLEAVRKRPGMYIGSTGPKGLHHLVYEIVDNAIDEALAGFCDHIEVTIKKGDVIEVTDNGRGIPVDIQPKLGIPAVTVVLTVLHAGGKFGGSGYKVAGGLHGVGSSVVNALSEWLEVIVRKDGYEYYQRFQRGVP-DAPLKKLGPAAS-TGTTVRFKADPVMFETTVYDYETLLIRLREEAFLNAGVRITFTDERGDEVVRESMHYEGGIASFVEYLQKKRTVLHPQVIHLKG----------QKDDIIAEVAMQYNDSFNELILSFANNVNTPDGGTHEEGFKNALTRVINDFGREKGYLKDKDDNLTGNDVREGLTCVISVKLTEAQFEGQTKAKLGNTEVRSLVSGMVYDKLKEFLEENPGVAKAIYEKATQXXXXXXXXXXXXDLVRRKSALETSRMPGKLADCREKDPSKTEIFIVEGDSAGGSAKMGRDSNIQAILPLWGKMLNVEKARLDKVYGNEKLMPVVTALGCGIGEEFDIEKLRYHKVFIMADADVDGSHICTLMLTFFFRFMRPLIEGGYVYIAQPPLFKLTKGKDVRYAYNEPEMTQMSAEMG-QGVKINRYKGLGEMNPEQLWETTMNPDNRVIVQISIEDAEKADEAFTILMGDKVEPRRQFIEKNAEYA-NLDV 647
118 0.000e+00gi|503210531|ref|WP_013445192.1| DNA gyrase subunit B [Paludibacter propionicigenes]  clstr ali  48  1MSEEEKSANYGASSIQVLEGLEAVRKRPAMYIGDIGIKGLHHLVYEVVDNSIDEAMAGHCNNIQVFINENNSITVIDNGRGIPVDMHEKEGKSALEVVMTVLHAGGKFDKDSYKVSGGLHGVGVSCVNALSTYVRVEVSRNGKLYMQEYSCGIPK-APVQEIGTSTTNG-TKTTFLPDDSIFIESIYKYDILAGRLRELAFLNAGITLTLTDKRDGSFKTEVFHSDEGLKEFVEYIDEAREPLIESVIHIS----------TEKNGIPVEIAMTYNTSYNENIHSYVNNINTIEGGTHLAGFRRGLTRTLKKYAEDSKMLEKLKIEISGDDFREGLTAVISIKVQEPQFEGQTKTKLGNNEVMGSVDMAVGEALGNYLEENPKAARIIVEKVILAATARYAARKAREMVQRKSPLSGGGLPGKLADCADKDPEKCELFLVEGDSAGGTAKQGRSRQFQAILPLRGKILNVEKAMQHKVLESEEIRNIYTALGVTIGTELNMKKLRYHKVIIMTDADVDGSHIATLIMTFFFRHMKELIEQGYLYIATPPLYLCKKGKVEEYCWTEAQRQTFIEKYGGGGIHTQRYKGLGEMNEIQLWDTTMNPEHRTLRQVNIENAAEADHVFSMLMGDDVAPRRQFIEQNATYAK.... 651
119 0.000e+00 [EC:5.99.1.3][KEGG:K02470] DNA gyrase subunit B;|[COG0187] Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit  ali  46  1MSEEEQLNSYSASSIQVLEGLEAVRKRPAMYIGDISEKGLHHLVYETVDNSIDEALAGYCTHIEVTINEDNSITVQDNGRGIPVDMHEKEHKSALEVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTKMLSQVYRDGKIYQQEYECGKP-LYPVKVVGET-NLRGTRQQFWPDGSIFITTTYKYDVLANRMRELAFLNAGITIVLTDMREGNPRQETFHSKDGLKEFVRYIDSSRIHLFNDVIYL----------NTEKQGVPIEVAIMYNTGYTENIHSYVNNINTIEGGTHLAGFRTALTRTLKKYAEEQEKLEKNKVEISGEDFREGLTAVISIKVAEPQFEGQTKTKLGNNEVAGAVQQALGEALTNYLEEHPKEAKLIVDKVILAATARVAARKARESVQRKSPMAGGGLPGKLADCSDKDAANCELFIVEGDSAGGSAKQGRSRQFQAILPIRGKIFNVERVMWHKAFEHEEVNNIIQALGVRFGKEANYDKLRYYKVIIMTDADVDGSHIDTLLMTLFYRYMPELIQKGHLYIATPPLYRCKKGKIEEYCYTEADRLRFMKTYNNGGVTTQRYKGLGEMNPEQLWETTMNPETRLLKQVTIEDAASADYVFSMLMGEDVGPRREFIEQNATYA-NID. 655
120 0.000e+00 [EC:5.99.1.3][KEGG:K02470] DNA gyrase subunit B;|[COG0187] Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit  ali  46  5..EKKGASAYSASNIQVLEGLEAVRKRPAMYIGDISEKGLHHLVYETVDNSIDEALAGYCTHIEVTICTDNSIIVQDNGRGIPVDMHPKEHRSALEVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTKMVSEVFRDGKIYRQEYAKGHPQ-APVAVVGETD-IRGTRQHFWPDPTIFTTTTYKYEILANRMRELAYLNAGITITLTDQRPDEERKDVFHSDLGLREFVRYIDSSRQHLFDDVIYL----------NTEKNNIPIEVAIMYNTSYSENIHSYVNNINTIEGGTHLVGFRQAVTRVLKKYAEETKQIEKAKVEISGEDFREGLTAVISVKVAEPQFEGQTKTKLGNSEVTGAVNQAVGEALTNYLEEHPKEAKLVVDKVILAATARIAARKARESVQRKSPLSGGGLPGKLADCSSKDPAICELFLVEGDSAGGSAKQGRSRATQAILPLRGKILNVEKAMWHKAFESDEVNNIIQALGIGMGEDANLDKLRYHKVIIMADADVDGQHIATLIMTLFYRYMPQIIQDGYLYIAMPPLYKCTKGKVSEYCYNDRDRQVFMDKYGDGSIKTQRYKGLGEMNPEELWSTTMCPESRLLKQVSLENAADADYVFSMLMGDDVGPRREFIEKNAIYA-NVD. 651
121 0.000e+00gi|332745566|gb|EGJ76007.1| putative DNA gyrase subunit B [Streptomyces sp. Tu6071]  clstr ali  50  106......EPSYDANAITVLEGLDAVRKRPGMYIGSTGERGLHHLVQEVVDNSVDEALAGHADTIDVTILSDGGVRVVDNGRGIPVGIVPSEGKPAVEVVLTVLHAGGKFGGGGYAVSGGLHGVGVSVVNALSTRVEVEVKTDGHVWTQQYERGVPI-APLHK-GEATQEHGTSVTFWADGDVFETTEYSFETLARRFQEMAFLNKGLTIKLTDERDSEARTVTYHYEGGIVDFVKYLNSRKEVIHPSVIDVEAEDKEKLL--------SVEVAMQWNAGYTEGVYSFANTIHTHEGGTHEEGFRGALTTIVNKYARDKKLLREKDGNLTGDDIREGLTAIISVKLGEPQFEGQTKTKLGNTEARTFVQKIVYERLADWFDRNPNEASDIIRKGISAATARVAARKARDLTRRKGLLETASLPGKLSDCQSNDPTKCEIFIVEGDSAGGSAKSGRDPMYQAILPIRGKILNVEKARVDKILHNQEIQALISAFGAGVHDDFDIEKLRYHKIILMADADVDGQHINTLLLTFLFRFMRPLVEAGHVYLSRPPLYKIKWGKDVDYAYSDRERDALI-TLGRENGKVQRFKGLGEMDAEELRVTTMDQDHRVLGQVTLDDAAQADDLFSVLMGEDVEARRQFIQRNAKDVRFLDI 765
122 0.000e+00gi|167043616|gb|ABZ08310.1| putative DNA gyrase B, partial [uncultured marine microorganism HF4000_APKG2M17]  clstr ali  48  10MAENEASNQYGASNIQVLEGLEAVRKRPAMYIGDIGPRGLHHLVNEVVDNSIDEALAGHCDAIDVIIHEDGSISIKDNGRGIPVDMHPIEKRSALEVVMTTLHAGGKFDKDTYKVSGGLHGVGVSCVNALSEKLEASIWRDGALWKQTFEYGDPVGAVAKVRDMKDGETGTLVRFWPDGGIFQTTEFRFDRLADRLREMAYLNRHVYISIEDLREAEGLRDEYHFEGGIIEFVEYLDEARTPIHDETIYI----------ADEDAEVPVEMAMRYNSGYTENVLSFVNNINTHEGGTHVSGFRRALTRTLKSYADKNNLLKNVKVDLSGDDFREGITVILSIKVAEPQFEGQTKTKLGNSEVQGAVESLVFLKLGEWLDDHPKESKRIVEKVIIXXXXXXXXXXXXXLVQRKNAFSSGGLPGKLADCSSKNAEECEIYLVEGDSAGGSAKQARDRHFQAILPLRGKILNVEKARLDRILANEEIRNIVTALGTGLGDDFDPEKLRYHKIIVMTDADVDGAHIRTLLLTFLYRHMHALVEAGYIYIAQPPLYKAKKGKQEEYCWTDKQLKEVIERIGGDKVTIQRYKGLGEMNPDQLWDTTMNPETRLLQRITIDDAAAADRIFSTLMGDAVEPRRKFIERNAKYAT-IDV 655
123 0.000e+00 [EC:5.99.1.3][KEGG:K02470] DNA gyrase subunit B;|[COG0187] Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit  ali  51  4..NTNVENEYGADQIQVLEGLEAVRKRPGMYIGSTSLRGLHHLVYEIVDNAVDEALAGYCDTIDVQINEDNSITVKDDGRGIPTGINTKTGKSGIELVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVKVCRDGKIHHQKYQRG-HALGGLEIIGDCDPETGTEVKFLPDKTIFEDTVYDYSVLETRLRETAFLTKNLKIILRDVRPEEPIEKTFHYEGGIKEFVTYLNKGKTPLYEDVIYCEGT----------VNNVYVEVAMQHNDAYNENSFSFVNNINTPEGGMQVEGFKRALTKTLNNYARQNKILKEKEDNLSGEDFREGLTSIISVKIEDPQFEGQTKQKLGNSEARTAVDSVVSEQLTYFLEQNPGVAKIICEKAVLXXXXXXXXXXXXXTTRRKTVLDVAALPGKLSDCSDKDPKKCEIFIVEGDSAGGSAKKARVRATQAILPLRGKILNVEKARLDRIMQNEEIRSMITAFGTGIYDEFDISKLRYDKIIIMTDADVDGAHIDTLMLTFFYRFMPELIKDGHVYLAMPPLYQVTRNKKNYYAYSDAELDKILTEIGRDNQNIQRYKGLGEMDASQLWDTTMNPETRILKQVKIEDTLEMDLTFTTLMGDDVEPRREFIQANAKFVQNLDI 644
124 0.000e+00gi|973113219|gb|KUK69403.1| DNA gyrase subunit B [Anaerolineae bacterium 49_20]  clstr ali  50  1MENKNQNNHYNANDIQILEGLEAVRRRPGMYVGGTDVKALHHLIYEVVDNSIDEALAGVCTRISVTIHEDDSVTVEDNGRGIPVDIHPDRGISALQVVMTVLHAGGKFGGGSYKVSGGLHGVGVSAVNALSEWCEVTVRREGKIYFQRYERGIPQAA-VKQIGTKGDETGTSTTFKFDREIFKDVNYRFDTLVTRFRELAFVARGVTIMLKDERED--REMTFHFEGGVASFVRYLNKNKEVLH-EPIYGEK----------EIENVGVEFVVQYTDSYAESVYTFANTINTIDGGTHLTGLRTAVTRSINDYARKAGFLKDSDPNFSGDDTREGMTAIVSIKHPDPQFESQTKVKLMNPEVQTYVQQVVGDTFSTFLEENPAAGKAIIQKCLTSARARDAAKKARDLVIRKSALESMTLPGKLADCSERDPSKTELYIVEGDSAGGSAKQGRDRHFQAILPLRGKILNTERARLDKILDNREVKSLISALGTSVGESFDISGLRYNRIIIMTDADVDGAHIRTLLLTFFFRYMQPLIDEGHLFIAQPPLYRISARNQIFYAYTDQEKDELVAKFGGGKVSISRYKGLGEMNPEQLWETTMNPENRTLLQVTIEDAAEADRTFDMLMGSQVPPRRRFIQTHAKEVRNLDI 640
125 0.000e+00gi|952993132|ref|WP_057951829.1| DNA topoisomerase IV subunit B [bacterium L21-Spi-D4]  clstr ali  47  1MTEQKGQEDYSAESIQVLEGLEAVRMRPAMYIGDVSEKGLHHLVYEVVDNSIDEALAGYCDFIEVTIHKDNAITVRDNGRGIPVTKHAKENKSALEVVMTVLHAGGKFNKDSYKVSGGLHGVGVSCVNALSTNLKAEIHREGQIWSQEYKIGVPQ-QEVKAVGETEK-SGTIITFKPDDSIFIITEYKYEILSARLRELAFLNAGIHLKLVDEREGEFKSSDFYSDSGLPEFVQFLDNTRDKLINDIIHI----------TTEKNGVPVEVAMQYNSSFNENIHSYVNNINTIEGGTHLTGFRRGLTRTLKNYAVDSGMLDKLKFEIAGDDFREGLTAVVSVKVAEPQFEGQTKTKLGNSEVSLAVDQAVSEMLANYLEENPKDAKTIVNKVVVAAQARHAARKAREMVQRKSAMTGAGLPGKLADCSARDPEKAEIFLVEGDSAGGTAKQGRSRHFQAILPLRGKILNVEKAMQHKVFENDEIKNIFTALGVTIGKELNLDKIRYHKVIIMCDADVDGSHIATLIMTFFFRYMKELIKRGYLYIATPPLYLLRKGKNVQYAWNEEERAEFAEKYGDGNIHIQRYKGLGEMNSEQLWETTMDPEFRKLRQVTIENAAEADHIFAMLMGDDVPPRREFIQSHAKYA-NID. 652
126 0.000e+00gi|496707964|ref|WP_009347625.1| DNA topoisomerase IV subunit B [Alloprevotella rava]  clstr ali  47  1MEEEQKGSNYSASNIQVLEGLEAVRKRPAMYIGDTGERGLHHLVYETVDNSIDEALAGYCTHIEVTICEDNSIVVQDNGRGIPVDMHPKEHRSALEVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSSHMKSQVFRDGKIYQQEYEKGKP-LYSVKVVGETE-LRGTRQQFWPDDTVFSTTTYNYETLSNRMRELAYLNAGLKITLTDLREGNIRQQEFFSEQGLPQFVRYLDSSRSHLFDDVIHIS----------TNKNGLPIDVAVMYNTGYAENIHSYVNNINTIEGGTHLTGFRQALTRVLKNYAEQTKQIEKAKIEISGEDFREGLTAVISVKVAEPQFEGQTKTRLGNSEVTGAVNQAVGEAFTNYLEEHPKEAKLIVDKVILAATARIAARKARESVQRKSPLTGGGLPGKLADCSSKDAAECELFLVEGDSAGGSAKQGRSRRTQAILPLRGKILNVEKAMWHKAFESDEVNNIIQAMGVRFGKEANIEKLRYHKIIIMADADVDGQHIATLIMTLFYRYMPQLIEDGYLYIAMPPLYRCKKGNHEDYCYNEQARLQFIKDYGDENIVTQRYKGLGEMNPSQLWETTMNPETRLLKQVTLENASNADFTFSMLMGEDVGPRREFIERNATYA-NID. 652
127 0.000e+00gi|489624816|ref|WP_003529256.1| DNA gyrase subunit B [[Clostridium] leptum]  clstr ali  52  1MENNQTNEEYGASDIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNAIDEALAGYCDKIDVRILPGDIIVVEDNGRGIPVGIQPKMGIPAVTVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTWLEVEVSDGAHIYRQRFERG-KTITDLEMIGDTTK-TGTKVTFQADPEIFESTVYEYETLETRLREQAFLNAGIHIELVDERDPENRQKNFLYEGGISSFVEFLHKRKEVIHPDIIHVKGALTDGSA--------EAEVAMQYNESYNELLISFANNIHTTDGGTHEEGFKRALTRIMNDYARKYNILKDGDKNLSGEDVREGLTAIISVKLKEAQFEGQTKAKLGNTEIRTLVDNLISEKLSAYLEENPATARAIFEKAMAASRAREAARKARELVRRKSALESAALPGKLADCQSRNPEETEIYIVEGDSAGGSAKGGRDRKFQAILPLWGKMLNVEKARLDKVYGNDKLMPVITALGCGIGDEFDLAKLRYGKVIIMADADVDGSHIRTLLLTFFFRFMKPLIEEGHIYIAQPPLYRLTKGKNHYYAYSDKERDQMLKEMTVTAP-IQRYKGLGEMDSEQLWETTMNPETRIMLKVELEDAAAADETFTILMGDKVEPRREFIEKNAKYVQNLDV 646
128 0.000e+00gi|916517894|ref|WP_051135731.1| DNA topoisomerase IV subunit B [Lachnospiraceae bacterium NK4A179]  clstr ali  50  1MESEKVEGPYDGDQIQILEGLEAVRKRPGMYIGTTSERGLHHLVYEIVDNSVDEALAGYCKNIFVDINPGNYITVTDDGRGIPVGINHKAGKPAVEVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTWLEVDIYHEGQIYNQRYERG-KVCYPLKVVGKCDDKTGTKVTFQPDPEIFTDTVYDFDTLKKRMREMAFLTKGLNITLTDKRDGGDRVESFYYEGGIKEYVKYLNEGSSALYDKIMYFEG----------KKEGVYVEVAMQHNNGFNEIINGFVNNINTPEGGMHVEGLKTSLTRIFNDYGRKNEILKKNEANLSGDDVREGLTAIISVKIEDPQFEGQTKQKLGNSIARTAVSGIVSEQLTYFLEQNPDIAKKIIDKAVTAQRAKEAARRAIEATRRKTPLDGAALPGKLADCSDKDPKNCEIFIVEGDSAGGSAKSARSRATQAILPLRGKILNVQKARPDKVFANAEIKAMIKAFGTGIDEEFDISKLRYNKIIIMTDADVDGAHIATLMLTFLYRYMPELIRQGHVFLAQPPLYKLEKNKKVWYAYSDEELASIINEVGRDQNNIQRYKGLGEMDAEQLWETTMDPEHRILLRVGMDDASELDLTFSTLMGDEVEPRREFIEANAKYVQNLDI 656
129 0.000e+00gi|502628390|ref|WP_012865054.1| DNA gyrase subunit B [Sanguibacter keddieii]  clstr ali  50  19....TVDGGYGASDITVLEGLEAVRKRPGMYIGSTGERGLHHLVYEVVDNSVDEALAGYCDHIEVTLLDDGGVRVVDNGRGIPVDIHPTEGRPTVEVVMTILHAGGKFGGGGYAVSGGLHGVGISVVNALSTRVETVVRRQGFTWHQSFADGGKPVGELRK-GDATDQTGTQQTFWADGSIFETTRYDFETLRARFQQMAFLNKGLQISLTDERSDQARTVVYKYDRGLLDYVAHLNSAKEIVHEDIIAFESEDTERR--------ISLEVAMQWTNAYSESVHTYANTISTTEGGTHEEGFRAAMTSLVNRYARAKGIIKEKDDNLTGDDIREGLTAVISIKLGEPQFEGQTKTKLGNTEAKTFVQSVVNEQLGDWLDSHPVEAKDIIRKAIQASQARLAARKAREATRRKGLLESGGMPGKLRDCQSNKPEECEVYIVEGDSAGGSAVRGRNPRTQAILPIRGKILNVERARLDKALGNQEVQALITAFGTGIGEDFDIAKLRYHKIVLMADADVDGQHICTLLLTLLFRYMRPLIEHGMVYLAQPPLYRIKWSNAEHYVYSDRERDEYIKRIPKDN-GIQRYKGLGEMDYSELWDTTMDPDHRTLLQVTLDDAAAADEIFSVLMGEDVESRRNFIQRNAKDVRFLDI 683
130 0.000e+00gi|518044781|ref|WP_019214989.1| DNA gyrase subunit B [Fenollaria massiliensis]  clstr ali  52  2.....EDKNYNAGSIQVLEGLEPVRKRPGMYIGSTGTKGLHHCVMEVMDNSIDEVLAGRADTVKVVIYKDGSISIEDNGSGIPVEVHPKTGKSTLETVLTVLHAGGKFNNDAYKVSGGLHGVGVSCVNALSEWLIATVKRSGHIYEQHFARGKAQ-GDIQVVGDT-KESGTTIQFMPDSEIFDTTEFSKEVLVTKFREVAFLNKGVRITLIDEREEEPQEEVFHYEGGIKSFVEYINRSKNAISDDIIYFDKSM----------EDCELEIAMQYTDGYSENVLTFANNIHTTEGGYHLTGFRNALTRALNDYGRKANIIKEKEDNLSGDDAREGLTAIVSVKLKEPQFEGQTKSKLGNSEVQGIVNTTCYQELIDYFELHPQEGKKIIEKAISAQRAREAARKARDLSRGKSVLDNTTLPGKLADCQSNDNHETEIFIVEGDSAGGSAKQGRDRKFQAILPLRGKILNVEKARLDRILAYEEIKAMITAFGTGIDTEFNIEKLRYGKIIIMTDADVDGAHIRTLLLTFFFRHMRELVDDGHIYIAQPPLYMVSKNRKEYYVYDDDELEALLKEIGRDNYTIQRYKGLGEMNPEQLWETTMDPEHRILLRVNVDDAVNADEIFSMLMGDKVEPRREFIEKNAKYASNLDI 635
131 0.000e+00gi|524774521|emb|CDE72275.1| dNA gyrase subunit B [Acidaminococcus sp. CAG:917]  clstr ali  51  1MS--SVQHSYNESDIQVLEGLEPVRKRPGMYIGSTDSRGLHHLVTEVVDNSIDEALAGFCTDIDVEITNEGAIKVKDNGRGIPTGIIPGEGKSAVEVVLTKLHAGGKFGSGGYKVSGGLHGVGVSCVNALSEWLEVEVRQNGKVYKQIFNRGVPQ-RDLAVVGESD-ETGTTITFYPDDTIFETLEFNYDTLKARLRELAYLNKGLKIRITDSRVDPVKSELFCYEGGIVSFVESLNKSKETVFPEVIYFDKNYTETVKGVT--DTYEAEVAFQYNDSYSETILSFANNINTEEGGTHLDGFKFAISKCINDYGKKQGLIKDSE-KLSGEDTREGITAVISVKLGNPQFEGQTKTKLGNSVVRSIVSKAIVDGFGTYLEEHPKEAKELIMKTLTAQRAREAARNARELARRKSPLETTTLPGKLADCTDKEAKYCEIYLVEGDSAGGTAKQGRDRRFQAILPLRGKILNVEKARLHRVLENEEIKAMITAFGCGIHQDYDESKLRYDRIICMTDADVDGSHIRILMLTFFFRYMRPLIENGHVYIAQPPLYKVKTGKKEEYFYDDESLNAYLDSLDRKGYEIQRYKGLGEMNAEQLWETTMDPARRTLLKVTMEDAIEADSIISTLMGEDAELRRQFIEENAKLVEELDV 643
132 0.000e+00gi|504365100|ref|WP_014552202.1| DNA gyrase subunit B [Halanaerobium praevalens]  clstr ali  53  2..DIKDRGNYEAEHIQVLEGLEAVRKRPGMYIGSTSLEGLHHLVYEVVDNSIDEAMAGYCSEVIVEIKPGNIIKVQDDGRGIPVEIHPKVDKPAVEVVMTTLHAGGKFGGEGYKVSGGLHGVGISVVNALTEWMEVEIWKDGKVYKQKYERGIPQ-HELQLIGNCDNCTGTTIEFKPDPLIFEEIDFDFKLLAKRLKELAFLNKGINIKIVDNRKEEVQQEDFHFDGGLISFVEYLSQSKKPLLSEPIYIE----------DEAEEGSIEVAIMYHQGYNTSLYTFANNINTKEGGTHLSGFKSATTRTFNDYARNKNLLKDGDDNLKGQDIREGMIAIISVKLSEPQFEGQTKTKLGNSEMRGFVDSAVSSFLKTYLEENPKVGKAIIEKAISXXXXXXXXXXXXDLTRRKSALTSTALPGKLADCSKRKADDTEVYIVEGDSAGGSAKQGRNREFQAILPLKGKILNVEKSRLNKILNNDEIRALITAIGTGVGEEFDLTNIRYDRIIIMTDADVDGAHIRTLLLTFFYRYMRPLLENGNIYIAQPPLYKVKKGRREEYVYNDKALKELIEEIGKDRVSMQRYKGLGEMNPSQLWDTTMDPENRILLQVDIEDAIRADETFSILMGDKVAPRREFIQKHAREVKNLDV 640
133 0.000e+00gi|928958232|ref|WP_053982797.1| DNA gyrase subunit B [Lachnospiraceae bacterium mt14]  clstr ali  52  4........TYNENQIQILEGLQAVRKRPGMYIGSTSSKGLHHLVYEIVDNAVDEALAGECDTIVVSIHPDNSISVLDNGRGIPVGIHAQKGIPAVEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLVVKVYTGGKVHEEKFERG-HVVSPLTVVDDTDK-TGTFVHFKPDYEIFEDTIYDFNVLKQRLQETAFLTKGLRIELVDLREEH-KHKVFHYEGGIKEFVSHLNKHKTPIYEEIFYGEG----------EKDGINVEVAFQHNDSYVENVYSFVNNINTSEGGTHLSGFRSAITKTLNDYGRKMNLLKQADTNLSGEDIREGLTAIISVKIGEPQFEGQTKTKLGNSEARGAVESVFTEQLTYFLEQNPNVAKMIIQKATMXXXXXXXXXXXXELTRRKSVLESTALPGKLADCSEKDASKCEIYLVEGDSAGGSAKSARSRQTQAILPLRGKILNVEKARIDRMLESEEIRNMITAFGAGISEDFDVNRLRYHKIIIMTDADVDGAHIRTLLLTFFYRYYKPLIDHGFIYIAQPPLYLVEKNKKKHYAYDDRELEKILEEIGRTGISMQRYKGLGEMNPDQLWETTMDPETRTLVRVDIEDAAAADEIFTALMGDKVEPRREFIHEYAPKVTNLDI 633
134 0.000e+00gi|1000243040|gb|KXK06399.1| DNA gyrase subunit B [Chlorobi bacterium OLB4]  clstr ali  47  1MTEKEKKSHYQESDIKVLKGLEHVRKRPAMYIGDVSSRGLHHLVYEVVDNAIDEALAGFCNKIILTINKDGSVTVEDNGRGIPTGLHPTEKKSTLEVVMTQLNAGGKFDRSSYKVSGGLHGVGVSVVNALSEWMEVEVYRDGKIHYQKYKRGEPV-GNVEETGKVKQKTGTRVTFLPDKEIFKGINFKYSTLEARLRELAYLNKGITIKIADEAEG--KQDEFHFKGGIIDFVKYLDEGQKSISGKPIYL----------TAERENVIIEVAFQYNESYNENINTFVNNINTHEGGTHLEGFKSALTRTLNNFGTKNNIIKTDKITLTGDDFREGITAVISVKVPEPQFEGQTKTKLGNSEVKGIVQSICNEQLSDYLEENPSVAKKILEKCILAAEARMAARNARELARRKNALEISGLPGKLADCSITDPQQCEIYLVEGDSAGGSAKQGRDRRFQAILPLKGKILNVEKARLNKIYENEEIKSIVTAIGAGLSDEYDDSKVRYGKIILMCDADVDGSHIRTLLLTFFYRYMREIIESGKLYLAQPPLYKIKKGKQEWYAYNESERDEILKSLKVKKVIISRFKGLGEMNPEQLWATTMNPETRTIIQVTNENAAAADKIFRILMGEEVEPRRKFIEENARYA-NID. 665
135 0.000e+00 GL0100006 [Complete] locus=scaffold10699_1:11060:12967:+  ali  50  1MAE-KVQGEYGEEQIQVLEGLEPVRKRPGMYIGSTDERGLHHLVQEIVDNSIDEALAGYCDTIRVKINKDGSCTVTDNGRGIPTGIHHKEGVSSVELVLTKLHAGGKFGGGGYKISGGLHGVGLSVVNALSEWLEVEVYQNGHVYKQVYNRGVPQRA-LAIVGDTDK-TGTQVTFYPDSEIFETTVFNYDNLKVRLRELAYLNKGLTISIEDDREEKPKFDEFHYEGGILHFVEDLNKNKEVLFDAPLYFEEMQA----------DSGIEVAIQYNDGYNELIMSYANNIHTEEGGTHLDGFKAALTKVINDAGHKLNILKEND-KLSGEDVREGITAIVSVKLTEPQFEGQTKTKLGNSFMRSFVQKATVEHLGTYLEENPAKARELVLRCVTAQKARDAARNARELTRRKGVLESTTLPGKLADCSEKRAELCEIYIVEGDSAGGTAKQGRDRRFQAILPLRGKILNVEKARLNRVLENEEIKSMITAFGCGISDDFDESKLRYDRIICMTDADVDGSHIRILLLTFFFRFMRPLIANGHVYIAQPPLYKATRGKEEKYMYSDAELEEYRNSNPG-KFELQRYKGLGEMNKEQLWDTTMNPATRTLLRVNMKDAVEADEMFSLLMGEKPELRRQFIEENAKLVAELDI 635
136 0.000e+00gi|943600807|ref|WP_055431174.1| DNA topoisomerase IV subunit B [Candidatus Symbiothrix dinenymphae]  clstr ali  49  1MSEETKNHDYSADSIQVLEGLEAVRKRPSMYIGDTSQKGLHHLVYEVVDNSIDEALAGHCKTIDVFINEDNSVTVKDDGRGIPVGYHEKEKKSALEVVLTVLHAGGKFDKDSYKVSGGLHGVGVSCVNALSTYLRAEVCHEGKIYMQEFSCG-KAISQLQTIGDTT-ERGTTITFKPDATIFTVTEYKYDILAGRLRELAYLNAGVHLALTDKRAGEYKTEMFYSTEGLSEFVRFIDAAKEPLLNDVIHI----------ITEKEGMPVEVAMTYNTSYNESISSYVNNINTIEHGTHVAGFRSALTRTLKKYAETSKLLEKVKIEISPDDFREGLTAIISVKVQEPQFEGQTKTKLGNNEVRGAVDQAVGEVLGNYLEEHPKEAKTIVDKVILAATARHAARNARELVQRKSPLSGSGLPGKLADCSDRNPELCEIFLVEGDSAGGTAKQGRERKYQAILPLRGKILNVEKAMPHKVFDSQEIRNIFTALGVTIGKELNIEKLRYHKVVIMTDADVDGSHIATLILTFFFRHMRPMIENGYIYIATPPLYLMKKGKVEEYCWTDQQRQMFIDRYADKQVHTQRYKGLGEMNATQLWDTTMNPEQRTLRRVSIDNAAEADRVFAMLMGEEVAPRREFIEENATYA-NID. 652
137 0.000e+00gi|501799368|ref|WP_012642217.1| DNA gyrase subunit B [Thermomicrobium roseum]  clstr ali  52  2...TNSTTRYDASAIQVLEGLEAVRRRPGMYIGSTDIRGLHHLIYEIVDNSVDEALAGYCDRIEVTIHRDGSVRVWDDGRGIPVDIHPKVGKSALEVIMTTLHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVTVRRDGKIYHQRYERGVPVT-PVETIGETTDDHGTETVFLPDRLIFRSLDYQSDVLLQRFREVAYLTSGLTIHFVDERTD--LDMTFYFEGGIVSFVRHLNRTKEVLQPQPFYV----------KREQNGCLVEVAIQYTDGYAESTHAFANNINTIDGGTHVTGFKAALTRAINEYARRHGLLKENDPNLSGEDVREGLTAIISVMLPEPQFEGQTKTKLGNAEVAGIVQSIVYESFTSYLEEHPAIARRIIEKCLTXXXXXXXXXXXXXLVQRKGALDTFSLPGKLADCTERDPAKAELYIVEGDSAGGSAKQGRDRRFQAVLPLRGKILNVEKARLDRMLHNEEIRALITALGTGIGDQYDRSKLRYHRVILMTDADVDGAHIRTLLLTFFFRYLEGLIIDGHLYIAQPPLYRLQSGKEVHYVYSDEERDAILNRGDGKTWDIQRYKGLGEMNPEQLWETTMDPARRTLLQVTIEDAVRADETFNMLMGSAVPPRKRFIQAHAREVRNLDI 636
138 0.000e+00gi|503991045|ref|WP_014225039.1| DNA topoisomerase IV subunit B [Tannerella forsythia]  clstr ali  49  1MSDEEASKEYSSKNIQVLEGLEAVRKRPAMYIGDTGEKGLHHLVYEVVDNSIDEALAGFCKNIEVVINEDNSICVTDDGRGIPVDYHEKEGKSALEVVLTVLHAGGKFDKGTYKVSGGLHGVGVSCVNALSSHLKAEIHRNGKIYIQEFSQGKP-LGDIRETGTIDR-TGTIISFKPDDTVFTVTQYKYDILANRLRELAFLNAGIYLTLTDKREGSFKSEVFHSNEGLKEFVRYIDKSKESMIHDVIHI----------VTEKQGIPVEVAMTYNTSYNESVFSYVNDINTIEGGTHLSGFRRGLTRTLKKYAEDSKLLEKAKVEIQGDDFREGLTAVISIKVAEPQFEGQTKTKLGNNEVMGAVDMAVGEALGYYLEEHPKEAKAIVDKVILAATARQAARKAREMVQRKSPFSGGGLPGKLADCSSKDAAECELFLVEGDSAGGTAKQGRDRNFQAILPLRGKILNVEKAMEHRIFDSEEIQNIFKAMGVTIGKELNLSKLRYQKIIIMTDADVDGSHIATLILTFFFRRMRGLIEKGYVYLATPPLYLCKKGKVEEYCWTEQQRQKFIDTYGGGNIHTQRYKGLGEMNDHQLWDTTMNPENRTLKQITIENAVEADSTFAMLMGEDVAPRRDFIEENATYA-NID. 651
139 0.000e+00 GL0044053 [Complete] locus=scaffold19296_7:1119:3053:+  ali  49  5......ESHYSGQDIQILEGLEAVRKRPGMYIGSTGPRGLHHLVYEVVDNAVDEALAGYCDHIEVTIHEDNSITVVDNGRGIPVDKHPKEKIPTVEVVLTILHAGGKFGGEGYKVSGGLHGVGVSVVNALSTQVIVRVRRDGKEYEISFDHG-KTKEKLHEVG-TSKTSGTTVTFWPDPEIFETTIFDYETLKTRFREMSFLNKGLKITLADERDGKPRTEVFQALGGLQDFVKFLNEGKETLNK-PIYFEA----------ENEDGMVEVAMQWSSSYSSNVLSFANNIHTIDGGTHLDGFKQGVTRTINDYARSKGILKEKDSNLSGDDTREGLSAVVSVKLRDPQFEGQTKGKLGNTEIRGLVQTAVTKGLAEYLEENPTPAKRIINKASQALKAREAARKAREMTRRKGVLDSFSLPGKLADCSSKNPADSEIFIVEGDSAGGSAKQARDRKYQAIMPLRGKILNVERAGLHRSLSSDTISSLITAIGTNIGEDFNADAARYHRIIIMTDADVDGAHIRILLLTFFYRYMPELITRGYIYIAQPPLYKKKGSKKLEYIFNDDALAARLAEIPRDSISLQRYKGLGEMDPEQLWETTMEPSTRTMLQVSIEDAAEAERVVSELMGDQVEPRKEFIQKHAHDVRFLD. 643
140 0.000e+00gi|503696469|ref|WP_013930545.1| DNA gyrase subunit B [Runella slithyformis]  clstr ali  48  10..EQVDKSNYSAENIQVLEGLEAVRKRPAMYIGDIGVKGLHHLIWEVVDNSIDEALAGYCDRIEVVINTDNSVTVKDNGRGIPTGMHPKEKKSALEVVMTVLHAGGKFDKDTYKVSGGLHGVGVSCVNALSKHLRVEVHREGKIFEQEYSIGKP-LYPVRAIGSADD-TGTFVHFLPDDSIFTTSEYKYETVANRIRELSFLNKGITLTLTDLRDGQPRYEEFHSQGGLVEFVTYLDSTRDHLIPTPIYME----------NEKGVVPVEVAMIYNTSYSENVVSYVNNINTIEGGTHVSGFRMALTRTLKNYADKSGILAKEKIEISGDDFREGLTAVISVKVQEPQFEGQTKTKLGNSDVAGAVSQVVSEMLDNFLQENPKEARTIVDKVILXXXXXXXXXXXXEMVQRKTVLGGTGLPGKLADCSETDPAGCELYLVEGDSAGGSAKQGRNRAFQAILPLRGKILNVEKAQEYKIYENEEIKNMITALGVVFGKDLNMDKLRYHKVIIMTDADVDGSHIRTLILTFFFRYMKDLIDSGFVYIAQPPLYLVKKGKEERYCWTEAQREQAVMEIAGGKVYIQRYKGLGEMNPEQLWETTMDPSRRSLKQVSIESAAEADHLFSMLMGDEVAPRREFIERNAKYAR-VDV 656
141 0.000e+00gi|944181366|ref|WP_055669993.1| DNA topoisomerase IV subunit B [Clostridiaceae bacterium mt10]  clstr ali  53  3...EQNKQTYDENQIQVLEGLEAVRKRPGMYIGSTSARGLHHLVYEIVDNSIDEALAGFCKNINIIIHNDNSITVTDDGRGMPVGIHPKMGIPTVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEICEVTVKRDGAVWKQIYERGA-VKTPFEKIGDSD-EHGTITHFKPDAEIFEELEYDYDTLAHRLRELAFLNKGINIILEDQRND--KKEEFCYEGGIKSFVSYLNRNKEILHPEPIYVEGI----------KDDYMVEIALQYNDSYVENIFSFANNIDTIEGGTHLVGFKTALTRVFNDYAKKFGHLKESDKNLSGEDIREGLTAVVSIKLTDPQFEGQTKTKLGNSEARSIVDNIVGEGVSTFLEENPAVGKIVIDKXXXXXXXXXXXXXXXXLT-RKSVLERTSLPGKLADCSSKDPLECEIYIVEGESAGGSAKQGRNRRFQAILPLRGKIINVEKQRLDKILNSDSIRSMVTAFGAGIGNEFDLEKIRYNRIIIMTDADVDGAHIRTLLLTFFYRYMKELIEKGHVYIAQPPLYKITKGKKDYYAYSDQEQDRILAEIGGKSVAIQRYKGLGEMNAEQLWETTMDPESRTLLRATIEDAMAADEIFTILMGDKVEPRRDFIQTNAKKVSNLDI 636
142 0.000e+00gi|1004828082|gb|KYC53075.1| DNA gyrase subunit B [Arc I group archaeon ADurb1013_Bin02101]  clstr ali  50  2......SNEYGASNIQVLEGLEAVRKRPAMYIGSTDINGLHHLVYEIVDNSIDEALAGHCDTINVFITEDNSIIVEDNGRGIPVEPHPVYKKSAMEIVLTKLHAGGKFDNESYKVSGGLHGVGVSVVNALSEKTHVLVSKNGKKYEQEYERGIPK-YDVRECGKSTK-NGTVVTFKPDAKIFEETVYQFDILAKRFRELAFLNAGITINFKDLR-GKGKEAVFYFKGGLSSFIEFLTESKSPINKKPIYF----------HTQKDNIDIEIAISYIDSYNEIVYTYANNINTREGGTHLVGFKSALTRVLNESLKKEKYDKKI-QQLSGDDVREGLVGIISVKIPNPQFEGQTKMKLGNNEVKGIVESATNEHLSLYFDENPQVVRKILDKCIVSAQARIAAKKAKDLTRRKNALEHDALPGKLSDCSEKDPSKCEIYLVEGDSAGGSAKSGRDRRFQAILPLKGKILNVEKARLDKILSNDEIRTLITAMGTGIGEEFDISKARYHKLIIMTDADVDGSHIRTLLLTFFFRYMPELIRQGYLYIAQPPLYSVKYQQKITYAYSDDEKDGLVKSLPEGKYIIQRYKGLGEMNPDQLWETTMNPENRTLLKVNMDDEISAEGIFSVLMGDDVEPRRKFIEDNAKNVINLD. 631
143 0.000e+00gi|987325189|gb|KXB39012.1| DNA gyrase, B subunit [Clostridiales bacterium KA00274]  clstr ali  51  63..KTENDVVYSDDQIQVLEGLEAVRKRPGMYIGDTTSRGLHHLVYEIVANSVDEALAGRCDKIKVTLQADGSVEVVDDGGGIPVGIHPKMGIPTVEVVHTILHAGGKFGGGAYSISGGLHGVGASVVNALSEWMEVYVKREGTIHYIRFERG-KTVKPLTIVGSCQNETGTRTIFKPDPEIFPDTDFDFDLMLTRYREMAFLNKEVTLLLQDARGQDMVSKNLHYDGGIISFVEYLNKKKECLHSEPIYIAKADG----------DIFVEVAMQYNTSYVENVYSYANNIATVEGGTHLTGFRSALTKVINDYARKYKLLKDNDRNLSGDDVREGLTAIISVKLPDPQFEGQTKTKLGNAEIRTIVETTLGSELATYLEEHPTEAKIIVTKCIDAMSARDAARKARELTRRKSVFDSVSLPGKLSDCQEKDPELCEIFIVEGDSAGGSAKNGRERKYQAILPLWGKMLNVERARIDKVYNNEKLQPVVIALGTGIGSDFDITKLRYNKIIIMADADVDGAHIRTLLLTFFFRHMRPLIEQGHVYIACPPLYMIEGNNKKFYAYTDAELEKIKAEQNFKNPRIQRYKGLGEMDKDQLWETTMNPETRRLLQVNVKDFQNADETMSMLMGDQVEPRREFIQTNAALAT.... 701
144 0.000e+00gi|488917268|ref|WP_002828343.1| DNA gyrase subunit B [Weissella paramesenteroides]  clstr ali  52  1MAEEDVSQDYDASQIQVLEGLEAVRKRPGMYIGSTSSQGLHHLVWEIVDNGIDEALAGFANHITVTIEKDNSITVIDNGRGIPVDIQVKTGKPALETVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSTNLDVLVVRDGKGFAMDFERG-HVKTEMHEIAIDDKSRGTIVHFAPDPDIFETTVFDYKTLMNRVRELAFLNKGLRISITDMRPEEPVVESFHYEGGIKEYVDFLNVNKDVIFNEPIYVEGM----------ENDIDVEVSLQYTDDFHSNLLSFTNNIHTYEGGTHETGFKSALTRVINDYARKNKILKDNDDPLSGDDVREGLTAIVSVKHPDPQFEGQTKTKLGNSDARTAVDRMFSETFARFMMENPTTAKQIVEKGILAGKARMAAKRAREATRKKSGLEIANLPGKLADNTSKDPEISELFIVEGDSAGGSAKQGRERLTQAILPIRGKILNVEKASMEKILGNDEIRSLFTAMGTGFGTDFDVTKAKYHKLIIMTDADVDGAHIRTLLLTLIYRYMRPLLEAGYVYIAQPPLYQVRQGKFIKYLDADSELEALLPTLPSPKPIIQRYKGLGEMDASQLWETTMDPSVRRLLRVEMDDAIEADMIFSMLMGDKVEPRRKFIEENAQYAE-LDV 648
145 0.000e+00gi|503112677|ref|WP_013347408.1| DNA gyrase subunit B [Glutamicibacter arilaitensis]  clstr ali  48  21MT-SKVEHTYGAQDITVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEVVDNSVDEALAGYCDTINVTLQADGGVRCEDNGRGIPVDVHPTEGKPTVEVVMTILHAGGKFGGGGYAVSGGLHGVGISVVNALSEKVNTIVRRQGHAWRIGFGNGGHTTQQLTK-GEETDRTGTSQTFYPDPEIFETVEFDFETLRARFQQMAFLNKGLRITLTDERPQKPRTVDYLYKDGLLDYVKHLNAAKELVHDEVIAFESEDS--------KRGISLEIAMQWTNAYAESVHTYANTINTHEGGTHEEGFRAALTGLLNRYARDNKILREKDDNLTGEDAREGLTAVISVKLSEPQFEGQTKTKLGNSMARGFVQGVVNEELGDWFERNPNVARDIIRKAQLASQARMAARKARDNARRKSPMESFGMPGKLSDCSSKNPAECEVFIVEGDSAGGSAKRGRDPHTQAILPLRGKILNVERARLDRALGNAEVQAMITAFGTGIGEEFDMAKLRYHKIVLMADADVDGQHITTLLLTLIFRFMRPLIEHGYVYLAAPPLYRIKWSNAAHYVFSDKERDDALKRLPKDN-GIQRYKGLGEMDYSELWDTTMDPERRTLRQVTMDDAAAADEVFSVLMGEDVESRRNFIQQNAKDVRFLDI 687
146 0.000e+00gi|524073727|emb|CCY53927.1| dNA gyrase subunit B [Coprococcus sp. CAG:782]  clstr ali  52  3....NNYEEYDADQIQILEGLEAVRKRPGMYIGSTSERGLHHLVYEIVDNSVDEALAGFCTHIEVFINKDNSITVIDDGRGIPIGIQKKTGIPAVEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSNWLEVEVTRDGKVYKQRYERG-KVMYKLKEIGEAPDKSGTKVTFLPDDTIFEQTVYDFDTLRNRLREIAFLTKGLRITLTDLREEPAKVRSFHYEGGIKEFVQYLNRHKTPLYEKVIYCEGM----------KNDVMVEVALQHNDSYNESTYSFVNNIVTPEGGTHLTGFKAAITKVFNDYARKNGILKDKDDNLSGDDLREGLTAVISVKIGNPQFEGQTKQKLGNSEARPAVEGIVTEQITYFLEQNPDVAKIIVNKATLAQRARIAARKARDVARKANLGDNMALPGKLADCSDKDPKNCEIYIVEGDSAGGSAKTARSRATQAILPLRGKILNVEKARIDRILGNEEIKAMITAFGTGIHENFDISKLRYNKIIIMTDADVDGAHIATLLLTFFYRFMPDLIRKGHVYLAQPPLYKLEKNKKIWYAYSDDELNRILNEVGRDQNNIQRYKGLGEMDPEQLWETTMDPERRILLKVDDDDESEIDMTFNVLMGDKVEPRREFIEKNAKYVKNLDI 641
147 0.000e+00gi|503433990|ref|WP_013668651.1| DNA gyrase subunit B [Aerococcus urinae]  clstr ali  52  26....NQAGEYNASQIQVLEGLEAVRKRPGMYIGSTGAPGLHHLVWEIVDNSIDEALAGYADKIDIKIESDGSITVIDNGRGIPVDIQEKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTKLRVEVYRDGKIYQQEYSRG-HIVSDLKVVGESDK-TGTVVNFVADPEIFDTTDYDFQTLNKRVRELAFLNKGLHITLEDRREEDSQEVAYQYEGGIKEYVQYLNENKEILFEEPVYLEGQM----------DDIEVEVAFQYTAGYHSNFMSFANNIHTFEGGTHESGIKTALTRTINDYARSQNLLKEKDDNLSGEDVREGLTLIVSIRHPNPQFEGQTKMKLGNSEVRTITDRLFGQHLEQFLYETPNIARQIVDKGILASKARQAAKRAREMTRKKSGLEISNLPGKLADCSSRVPEECELFIVEGNSAGGSAKLGRDRHFQAILPIRGKILNVEKASMDRILANEEIRSLFTAMGTGWGNDFDVTKARYHKLVIMTDADVDGAHIRTLLLTLIYRYMRPLLDAGYIYIAVPPLYQVRQGKNVHYVNSDQELNDYMKTLARPRPAVQRYKGLGEMDAEQLWETTMDPTQRQMLQVTVDDAQEADRNISMLMGDLVAPRRDFIENNATYAT.... 657
148 0.000e+00gi|524498653|emb|CDC36117.1| dNA gyrase subunit B [Butyrivibrio sp. CAG:318]  clstr ali  52  1MS---KSNDYTADQIQILEGLEAVRKRPGMYIGSTSSKGLHHLVYEIVDNAVDEALAGYCTEIFVQINEDNSITVIDNGRGIPVGINTKSGLTGVEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVKVFQDGKVYEQRYERG-KVMFPLKVVDECPDKTGTEVKFLPDKEIFEETVYDYNILKQRLREMAFLTKNIKITLKDVRDDNHKEKVFHYEGGIKEYVKYLNKGNDALYDNIIYCEGT----------KDDVYVEVAFQHNNGYSDNVYGFVNNITTPEGGTHVTGFRNAVTKTFNDYARTNKILKDKDQNLSGEDIREGLTAIISIKIQDPQFEGQTKQKLGNTEARGAVESVVTEQLTYFLEQNPSVAKVICEKSILAQRAREAARHARDLTRRKTALDGFKLPGKLADCSDKDPSHCEIFIVEGDSAGGSAKSARKRETQAILPLRGKILNVEKARLDRILGNAEIRAMITAFGTGIHEDFDISKLRYDKIIIMTDADVDGAHISTLLLTFFYRFMPDLIKDGHVYLAQPPLFKLEKNKKVWYAYSDEELADILKEVGRDQNNIQRYKGLGEMDASQLWETTMDPEKRILKKVIYDDASEIDVTFSTLMGDKVEPRREFIEENAKFVKNID. 639
149 0.000e+00gi|502814049|ref|WP_013049025.1| DNA gyrase subunit B [Aminobacterium colombiense]  clstr ali  49  2...TTSAKQYTAKDIQVLEGLQAVRKRPGMYIGDTGPRGLHHLVYEVVDNSIDEAIAGYCDKISVVIYEDESVSVADNGRGIPTEPHPSSGRPASEVVLTILHAGGKFDNQAYKVSGGLHGVGVSVVNALSEWLEITIQRNGLSRTQRFERGVPVT-DLSE-GEPSTKTGTYVRFHPDTTIFEEVRFSADILSGRLREMAFLNPGLAITLEDHRSG--KCVEFHYEGGIKTFIEYLNKGKTPLFPEPIVIAG----------EKDGASVEIGIQYNDGYLERIFAFANMIHTIEGGTHVAGFRTALTRAVNEVARRAKILREKDENLSGEDLKEGLTCVLSIKLSNPQFEGQTKTKLGNSEIKGITDSVVYEGLLAYLDEHQEVLKPVVEKAIRARQARDAAKKARELV-RKTAMTGMNLPGKLADCSSRDPHVCEVYIVEGDSAGGSAKQGRDRGFQAILPLRGKILNVEKARFDKVLSNNEIRTIIQALGCGIGEDFDHSKLRYNKIIIMTDADVDGAHISTLLLTFFYRYMQDLIDKGHLYLAQPPLYRVQRGKNVTYCYSEKELRDIVDSTPDSRASVQRYKGLGEMNPDQLWETTMDPQNRVLKRIEVEDAMLADEYFSILMGDKVEPRRDFIAAHAHEVRNLDI 634
150 0.000e+00gi|497854596|ref|WP_010168752.1| DNA gyrase subunit B [Epulopiscium sp. `N.t. morphotype B`]  clstr ali  52  3......NNIYDESQIQILEGLEAVRKRPDMYIGSTSAKGLHHLVYEIVDNAVDEALAGFCDKVTVTIHKDNSISVLDNGRGIPVGIHKDKGISAAEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSSWLISRVYQHGKIYEQKFKKG-HVVESLHPIGTTD-QTGTFVHFLPDETIFEETVYDFAILKKRFQETAFLTKGLKIKLIDERVEPKLEKIFHYEGGVSEFVLFLNKNKTPIYENIFYCEG----------EKDDVSIEVAFCHNDGYNENIFSFANNINTIEGGTHLSGFKNALTKTVNDYAKKMKILKDNDKSLSGEDIREGITGVISIKISEPKFEGQTKTKLVNTNVRTIVDNIVSEKFMIFLEQNPTIAKIIIQKATMASHARDAARKARDLTRRKNVLENSTLPGKLADCSERDPKKCEIYIVEGDSAGGSAKSARSRQNQAILPLRGKILNVEKARLDKMLASEEIRNMITAFGAGINEDLNIEKLRYHKIILMTDADVDGAHIRTLLLTFFYRFYRELITGGFIYIAQPPLYLVEKNKKKHYAYNDRELELILTEIGRNGITMQRYKGLGEMNPDQLWDTTMNPATRTLVKVNIEDAVEADEIFTALMGDKVEPRREFIKEYAKLVKNLDI 635
151 0.000e+00gi|328672711|gb|AEB28757.1| DNA gyrase, subunit B [Carnobacterium sp. 17-4]  clstr ali  54  9.SKQDRAKEYDASQIQVLEGLEAVRKRPGMYIGSTSSEGLHHLVWEIVDNSIDEALAGFADEINLIIEKDESITVIDNGRGIPVDIQAKTGRPALETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSITLDVYVHKDGKIYHQQYAQG-KVVHDVEVIGETDK-HGTTVHFVPDPEIFETVEFHFDKLATRVRELAFLNKGLKITVEDKREGKEKFLEYHYEGGIKSYVEFLNENKTVLYDEPIFLEG----------EQQGITLEVAMQHTDGYHNNLLSFANNIHTYEGGTHEFGFKTALTRVINDYAKKNKIIKENEENLTGEDVREGLTIVLSIKHPDPQFEGQTKTKLGNSEARTITDRLFSAHFDKFLMENPQVARQIVEKGXXXXXXXXXXXXXXEVTRKKSGLEISNLPGKLADCSSKDPTISELFIVEGDSAGGSAKQGRSRLFQAILPIRGKILNVEKATLDRILANEEIRSLFTAMGTGFGNDFDVSKARYHKLVIMTDADVDGAHIRTLLLTLFYRYMRPVVEAGYVYIAQPPLYQVRQGKKMVYLDSEEELDNYLKEIPSPKPVIQRYKGLGEMDAEQLWETTMNPENRRMLQVTVDDAIEADKSCDMLMGDRVEPRRLFIEENARYVQNLDI 647
152 0.000e+00gi|553715372|gb|ESE30458.1| DNA gyrase, B subunit [Eubacterium brachy ATCC 33089]  clstr ali  50  6MAKEVKNHNYGADQIQVLEGLEAVRVRPGMYIGSTGEKGLHHLVYEIVDNSVDEALAGYCKNIDVVIEEDNSIMVQDDGRGMPVDMHPKEKIPAVEVIHTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTRMEVEVKRDGNVYGLSFEKG-KIVEKLHVIGSTSK-TGSKTRFWPDPEIFEETVYDYETLEHRLREMAFLNKGIKITLEDRREGRKVKKEFHYEGGIKEFVAYMNSNKEPVHNEIVYFEAHGSDKNG----KGDMEIEIAFQYVDRYSELITSYANNINTVDGGYHLSGFKSALTRVFNDYAKKNKLLKDNDPALSGDDVREGITAVVSVKLTNPQFEGQTKGKLGNSEMRGFVESNTTEHVSAFLQENPNQAKAIINKAIQASRAREAARKARDIIRKNNVLEGFSLPGKLSDCQEKDPALSEIFLVEGDSAGGSAKQGRDRKRQAVLPLRGKILNVEKARLDKILNSDEIKNMITAFGCNIGDDFDIEKLRYHKIIIMTDADVDGAHIRTLLLTFFYRYMKPLVEGGYVYAAQPPLFQVKKGNEVHYTYSDREQEKLLAELSEKKVNIQRYKGLGEMDYHQLWETTMDYNTRTLIQITLEDVTMADEIFTTLMGDKVPPRKKFIEDNAKYVKNLDV 651
153 0.000e+00 [EC:5.99.1.3][KEGG:K02470] DNA gyrase subunit B;|[COG0187] Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit  ali  46  1MSEEQNNGSYSADSIQVLEGLEAVRKRPAMYIGDISVKGLHHLVYEIVDNSIDEALAGYCTHIEVTINEDNSVTVQDNGRGIPVDMHHKEKKSALEVAMTILHAGGKFNKGSYKVSGGLHGVGMSCVNALSTHMLTQVFRNGKIYQQEYEIGKP-LYPVKEVGTCD-ITGTRQQFWPDGSIFTETVYKYEILAERMRELAYLNAGLKITLTDRRDGSFKSEVFYSEEGLREFVRHIDNAREHLINDVIYI----------NTEKQGIPIEAAIMYNTSYTENLHSYVNNINTIEGGTHLAGFRAALTRTLKKYAEDSKALEKAKVEISPEDFREGLTAVISVKVAEPQFEGQTKTKLGNSEVSGAVQQAIGEALVYYLEEHPKEAKMIIDKVVLAATARVAARKARESVQRKSPMSGGGLPGKLADCSSKNPDECELFLVEGDSAGGSAKQGRSRLFQAILPLRGKILNVEKSMWHKAFESDEVNNIIQALGIRFGMDANIDKLRYGKIIIMTDADVDGSHIDTLIMTLFFRYMPEVIREGHLYIANPPLYLCTKGKVKQYCYSDKEREEFIKTYGEGQVHTQRYKGLGEMNPEQLWSTTMDPETRRLKQVHIDNAAEADYIFSMLMGEDVGPRREFIEENATYA-NID. 652
154 0.000e+00JGI.Meta 7017131110 SRS020869_Baylor_scaffold_14633__gene_36359 DNA gyrase, B subunit [Human Stool microbiome from visit number 1 of subject  ali  52  3MDEKEAEKNYDSESIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVWEIVDNSVDEALAGYCNEINVEINVDNTIKVVDNGRGMPTDIHPKTHVSATETIFTVLHAGGKFDNNSYKVSGGLHGVGASVVNALSEWLEVDVHRNGHIYRQRFEKG-KVKSSLEIIGETDH-TGTVVTFCPDKEIFETTFFDYETLRHRIQELSFLNKGLRLTIKDLRPENIKSGDYHYEGGLKEYVSFLNKGKKALHNDVITVE----------EEIEGTYIEIAFQYTEDYSCNIKSFTNNIVNTEGGTHEEGFRNSLTRILNNYGKNANIFK-KDESLSGDDVREGLTAIVSCKISDPQFEGQTKTKLGNTEVRRIVSQVMTDKFEAYLLENPANAKLIVEKSILALRARIAAKKAREATRRKSPLDSLGFASKLSDCRTKDPTLAEMYIVEGDSAGGSAKMGRESYYQAILPLRGKVLNVEKAAMSRALGNKEILSMIQAIGTGIGSEFQIENARYHKIVIMTDADVDGAHIRTLLLTFFYRFMPQIIEKGYVYIAQPPLYKIQQGKKIEYAYSDEELNLKLSEMSGKR-DIQRYKGLGEMNAEQLWETTMDPKKRILLQVTMDDGEKADEVFSMLMGEDVEPRRKFIEENAVFVQNLDI 649
155 0.000e+00gi|524502672|emb|CDC41993.1| dNA gyrase subunit B [Firmicutes bacterium CAG:449]  clstr ali  55  16.DDEKAKADYSASDIQVLEGLEAVRKRPGMYIGTTSSTGLHHCVWEIVDNAIDEALAGYCDTIHVTINKGDTITVKDNGRGIPVGIVAKSGKSAVETVYTILHAGGKFGEGGYKVSGGLHGVGASVVNALSEWLEVTVHKDGGIYYIKFANGGHTVEPLKQIGTCDD-TGTIVTFKPDGTIFETTVFSYEIIRDRIRQMAFLNKGVRIIVKDDRGEEPIVEEFCYEGGLKEYVTYLNRNKESQESDVIYCEG----------KQDGINVEIAMQYNESYQSMIYSFCNNINTADGGTHEEGFRLALTRVINKYARNNKFLKDNDESLTQDDVREGLTAIISIKHPDPQYEGQTKGKLGNSEVRQITSSIFGEQLERYLIENPKQAKVIMAKVTLAANARIAARKARETT-RKSGMELTSLPGKLADCSSKNAEECELYIVEGNSAGGSAKNGRDRKTQAILPLRGKILNVEKAQTKRIFANAEIGNMIIAIGGGYGNDFDVSKIRYHKIVIMTDADVDGSHIRILLLTFFYRFMKPLVEQGYIYIAQPPLYKASRGNKDYYCYNDEQLNQLRAKLGSKLLKLQRYKGLGEMDAQQLWETTMDPDKRKMIKVTIDDAMAADKVFDELMGEDVICRKQFIKENAKFVNNLDI 659
156 0.000e+00 GL0004097 [Complete] locus=scaffold11631_10:413:2377:-  ali  48  1MSVEEKDQAYSASSIQVLEGLEAVRKRPAMYIGDVGVRGLHHLVYEVVDNSIDEALAGYCSRIDVFVNEDNSITVKDDGRGIPTDMHEKEGRPALEVVLTVLHAGGKFNKDSYKVSGGLHGVGVSCVNALSTLLVAEVHRGGKIFRENFSKGVPQ-GTMEIIGETEDDHGTIITFKPDSSIFTVTEYDYETLASRLRELAYLNKGIKLNITDLRTGESVHDEYYSTEGLKEFVKFLDASRESLIENTIYID----------TEKDGVPVEVAMQYNTSFSENVHSYVNNINTIEGGTHLTGFRRALTRTLKKYAEDSGMLTKLKFEIKGDDFREGLTAVISVKVAEPQFEGQTKTKLGNGEVAGVVDQAISGALTHYLEENPKDARAIVSKVILAATARHAARKARELVQRKTVLSGSGLPGKLADCASRDRDQAEIFFVEGDSAGGSAKQGRDRNFQAIMPLRGKILNVEKAMEHRIFENEEIRNIFTALGVTIGTELNLDKLRYGRVIIMTDADVDGSHIATLMLTFFFRYMNNLIKNGHVYIATPPLYQVKKGKNSRYCWTEEEREAALAEFGSKGAHVQRYKGLGEMNPEQLWETTMSPETRILRQVNIESAAEADRIFSMLMGDDVPPRREFIERHAKYA-NIDI 654
157 0.000e+00gi|544192673|gb|ERK28663.1| DNA gyrase subunit B [Clostridium intestinale URNW]  clstr ali  53  3...EENKQKYDDSQIQVLEGLEAVRKRPGMYIGSTSSRGLHHLVYEIVDNSIDEALAGYCKNIDVYIHEDNSITVIDDGRGMPVGINDKLGKATVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEACEVIVTRDGYIWKQSYSKGN-VLTPLIKLEESEPEHGTKTHFKPDVEIFEETVYDFEILSKRLRELAFLNKGINIRLVDERDEN--EELYYYEGGIKSFVSYLNRNKEVLHKEPIYVEGV----------KDGVAVEVALQYHDGYNENIFSFANNIDTIEGGTHLVGFKTALTRAVNDYGKKFGHLKDADKNLSGDDIREGLTSVVSVKISDPQFEGQTKTKLGNSEVRGIVDGVVGETVSLFLEENPNIGKIIIDKALVXXXXXXXXXXXXXLT-RKSVLERSSLPGKLADCSSKDPLECEIYIVEGDSAGGSAKQGRNRRFQAILPLRGKILNVEKQRLDRILNADSIRSMITAFGAGIGTDFDVEKIRYNRIIIMTDADVDGAHIRTLLLTFFYRYMRELIDGGHVYIAQPPLYKVTRNKKEWYAYTDAELEVVLKEIGGKNTNIQRYKGLGEMNASQLWETTMDPDKRTLLKATVDDAMAADEIFTILMGDKVEPRREFITNNAKKVVNLDI 638
158 0.000e+00gi|1000256274|gb|KXK19148.1| DNA gyrase subunit B [Bacteroidetes bacterium OLB8]  clstr ali  49  1MSENQNNGNYDASNIQALEGLEAVRKRPGMYIGSTDTKGLHHLVYEVIDNSIDEHLAGYCDRITTIIHPDNSISVIDNGRGIPVGMHEKLQKSALEVVMTVLHAGGKFDKNTYKVSGGLHGVGVSCVNALSTYLKAEVHRNGHIYQQEYSEGKP-TSEVEVVGDAED-TGTIITFRPDAKIFETLEYKFETLSNRMRELAYLNKGLTLILIDERPDENRNETYRSDGGLAEFVTYLDQSRTSIISKPIHVIG----------KEDHIEVEVALQYNTSYAENIYSYVNNINTREGGTHVRGFRMAVARLFKQYGEDNGFFKKLKFTVSGEDFREGLTAIVSVKVPEPQFKGQTKGELGNSEVTSVVSQIVGETLRHFLEENPNEAKRILEKVVLAATAREAARKAREMVQRKNVLTGGGLPGKLADCSNRHPEESEIFLVEGDSAGGTAKQGRDRHFQAILPLRGKILNVEKAMEHKIYENEEIKNMFIALGVSIEEKLNIEKLRYHKIVIMTDADVDGSHITTLILTFFFRFMRPLIDNGYIYIATPPLYQVKKGQQAIYAWTETDRKEAVAALSRDSVKIQRYKGLGEMNAEQLWETTMDPSRRTLRQVTIEDAIECDRVFSMLMGDEVPPRREFIEANATYAK.... 650
159 0.000e+00gi|502939241|ref|WP_013174217.1| DNA gyrase subunit B [Syntrophothermus lipocalidus]  clstr ali  51  1MNINGSKNEYTALDIQVLEGLEAVRKRPGMYIGSTDSRGLHHLVFEIVDNSIDEAVAGYCDEIKVIILDDSTVTVTDNGRGIPVDMHPKMGIPALEVILTTLHSGAKFGGSGYTISGGLHGVGLSVVNALSRWLEVEVARDGQLYHQRYERGKPVT-PLAVTGAC-QTTGTKITFSPDPEIFEEICFSAEIIGQRLRELSYLNQGTRIVLCDKRTG--RDVEYYHTGGIRDFVKYLSKNREPLSPEPIYF----------RIGKEGTVVEVAIQYNTGYTETLLSYANNIHTQEGGTHELGFKNGLTRVVNEYAKKQGMLKENEGNLLGEDIREGMTAVISVLVQDPQFEGQTKTKLGNAFIRSLVEGAVSDFVGAFFDENPSLAKKIVEXXXXXXXXXXXXXXXXXLTRRKNLLDSTSLPGKLADCSEKDPALSELYLVEGDSAGGSAKQGRDRNFQAILPLRGKILNVEKARLDKVLSNEEIRALITAIGTGIGEDFDINKARYHRLIIMTDADVDGSHIRVLLLTFFYRYMRPLIEAGYVYVAQPPLYELKRGKEVHYIYNDRELQRFLEQQGNKKYGVKRYKGLGEMNPEQLWETTMNPENRTLLQVRIEDAIAADVIFSSLMGEKVEPRREFIQENARLVTNLDI 636
160 0.000e+00gi|984720441|gb|AMB94002.1| DNA topoisomerase IV subunit B [Aerococcus sanguinicola]  clstr ali  52  31.......ESYDASQIQVLEGLEAVRKRPGMYIGSTSETGLHHLVWEIVDNSIDEALAGFAKHIQIEILEDNVIRITDDGRGIPVDIQQKTGRPAVETVFNVLHAGGKFGGGSYKVSGGLHGVGASVVNALSEWLHVDVYKNGKIYHQEYSRG-KIMTELEVTGETDQQ-GTVVTFKADSEIFETTVYNREILNKRTRELAFLNKGLRISLTDKREEETVEYSYHFEGGIKEYIDFLNQNKTPLFPEPIYLEG----------EQDDIEVEVALQYTDDFHVNFMSFANNIHTFEGGTHESGVKTALTRTINDYARNVNILKDNDENLTGEDVREGLTLIVSVRHPDPQFEGQTKMKLGNSEVRTITDRLFGQHFSTFLLENPNIGRQIVDKGLVASKARKAAKRAREMTRKKSGLEISNLPGKLADCSSRVPEECELFIVEGNSAGGSAKNGRDRHFQAILPIRGKILNVEKASMDRILANEEIRSLFTAMGTGWGNDFDVSKARYHKLVIMTDADVDGAHIRTLLLTLIYRYMRPLLDAGYVYIAVPPLYQVRQGKKIQYIESDAELEAYMASLPRPKPVVQRYKGLGEMDAEQLWDTTMDPSTRRMLQVSVEDGVEADQMISMLMGDHVAPRRNFIEENATYAT.... 659
161 0.000e+00gi|149356274|gb|EDM44830.1| DNA gyrase subunit B [unidentified eubacterium SCB49]  clstr ali  48  10MSEENKKGNYGADQIQALEGMEHVRMRPSMYIGDVGVRGLHHLVYEVIDNSIDEALAGHCDTVDVWINEDNSITVRDNGRGIPVDIHKKEGVSALQVVMTKIGAGGKFDKDSYKVSGGLHGVGVSCVNALSVHLKATVFRNGSIYEQEYERG-KAMYPVKQVGSTED-RGTEVTFKPDEEIFQTREYNYDTLASRLRELAFLNKGITITLEDKREGSFKGETFHSTEGLKEFVRFLDGNREMLIADVISMEG----------EKNDIPVEVAMVYNTSYNENLHSYVNNINTHEGGTHLSGFRRGLTHTLKKYADASGMLDKLKFDISGDDFREGLTAIVSVKVQEPQFEGQTKTKLGNREVTSAVSQAVSEMLENYLEENPNDAKTIVQKVILAATARHAARKAREMVQRKTVMSGGGLPGKLSDCSEQDPERCEVFLVEGDSAGGTAKQGRDRNFQAILPLRGKILNVEKAMQHKVFENEEIRNIFTALGVTIGTELNLSKLRYHKVVIMCDADVDGSHISTLILTFFFRYMRELVESGYVYIATPPLYLVKKGAKKEYAWSDAERDALNEKFGGS-ASIQRYKGLGEMNASQLWDTTMNPDFRTLRQVAIDNGTEADRIFSMLMGDEVPPRREFIEKNAVYA-NID. 654
162 0.000e+00gi|663510178|gb|AIF00810.1| DNA topoisomerase IV, B subunit (gyrB) [uncultured marine group II/III euryarchaeote KM3_139_C07]  clstr ali  52  1MADKTK--GYGAKNIQVLEGLQAVRKRPAMYIGSVGLRGLHHLIYEAVDNSIDEALAGHCTKVAVIIHKNNWVTIQDNGRGIPVDKHPKFNMSALEVVMTKLHAGGKFDKNTYKVSGGLHGVGISVANALSENLFVEIKRDGKVYRQDYARGKP-TNKLKIIGET-KETGTKVSFLADKDIFDTLDYNYDTLLVRLRELAFLNNGLEISIVDERS--KKERVFQYKGGIVSFVRYLNYKKNVVN-EPIYF----------RKEVKDVQVEVALQYNEGFVEGVFSFVNNINTHDGGTHLIGFKTALTRTLNNYVERMKM---KDIKLSSMDVREGLVGIISVKMHSPQFEGQTKTRLGNSNVRGIVDSAVSTYLSSFLDENPKVAKIIIEKCSSAAKAREAAQKAREIIRGKGLLGGRSLPGKLADCSSRDPKECEVYLVEGDSAGGSAKQGRDRNFQAILPLRGKILNVEKARLDKMLSNNEIVTMVSALGSGIGDEFEIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMQPLISAGYVYIAQPPLYMVKKSKKIYYAYSDKELEGIFDKVGRTGISLQRYKGLGEMNPKQLWETTMDPEHRTLMRVTLEDAIEADEVFRTLMGERVEERRKFIEEHAKEVVNLDV 630
163 0.000e+00gi|948985566|gb|KRN97338.1| DNA gyrase subunit B [Lactobacillus siliginis]  clstr ali  51  43.EREAEVGNYNADQIQVLEGLEAVRKRPGMYIGTTTSQGLHHLVWEIVDNGIDEALAGFADEINVVVEKDNSITVTDNGRGIPVDIQKKTGKPALETVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSSSLDARVLRNGKVYYMDFETG-HVKTSMKIIGDTDHAHGTIVHFKPDADIFETTVYDIKTLTTRIRELAFLNKGLKITITDNRVDDPKTEVFHYEGGIKEYVKFLDDGKDVLFNDPVYVEGT----------QNGIVVEVSLQYTDDFHSNLLTFTNNIHTYEGGTHETGFKSALTRVINDYSHKSGQLKDNDDALSGDDVREGLTAVVSIKHPDPQFEGQTKTKLGNSDARTATDHLFSDTFSRFMMENPDTARKIVDKGILASKARVAAKRAREVTRKKSGLEISNLPGKLADNTSKDPAISELFIVEGDSAGGSAKQGRSRLTQAILPIRGKILNVEKASLDRVLANEEIRSLFTALGTGFGEDFDISKANYHKLIIMTDADVDGAHIRTLLLTLFYRFMRPMIDAGYVYIAQPPLYRVAQGKMMQYIDSDEELNTVLGQLPSPKPMIQRYKGLGEMDAEQLSETTMDPEKRRLLRVDPQDAIEADKVFTMLMGDKVEPRRQFIEENAKFVENLD. 682
164 0.000e+00gi|948676832|gb|KRL05867.1| DNA gyrase subunit B [Lactobacillus oeni DSM 19972]  clstr ali  52  31.SKEERAKKYDASQIQVLEGLEAVRKRPGMYIGSTSSQGLHHLVWEIIDNGIDEALAGFADEINVTVEKDNSITVKDNGRGIPVGIQHKTGRPALETVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSTSLSVQVKHSGKIYAMDFSYG-KVAHEMHVIGECEHEHGTLVHFSPDPDIFETTVFDIKVLTTRIRELAFLNKGLRITIRDERPEKPTTKEFHYIGGIRHYVEFLNKGKEVLFEEPIYLEG----------EQKGIIVEVALQYTNDFHSNLLTFTNNIHTYEGGTHEAGFKTALTRVINDYARKSNIMKDSEDNLSGEDVREGLTAVVSIKHPDPQFEGQTKTKLGNSDARTVTDRLFAEHFNKFMFENPTTARKIVEKGMLASKARVAAKRAREVTRKKNGLEISNLPGKLADNTSKDPSISELFIVEGDSAGGSAKQGRARLTQAILPIRGKILNVEKASLDRVLANEEIRSLFTALGTGFGSEFDVSKANYHKLIIMTDADVDGAHIRTLLLTLFYRFMHPMIDKGYVYIAQPPLYQVRQGKMIKYIDTESELEEILGQLPSPKPVVQRYKGLGEMDAEQLWETTMNPENRRLLQVKLSDAEEANRVFEMLMGDKVEPRREFIEKNATYVENLDV 671
165 0.000e+00gi|496513338|ref|WP_009221621.1| DNA gyrase subunit B [Peptoniphilus sp. oral taxon 386]  clstr ali  49  2..KENKNRQYGAEDIQVLTGLEPVRKRPGMYIGSTGSKGLHHLVYEVVDNSIDEALAGICDHILVEIYEDNSVSVSDNGSGIPTEIHPQTGKSTVETVLTILHAGGKFNNGAYKVSGGLHGVGVSVVNALSTELIVNVKRNGNIYEQKFSRGIAKTQLIEVEKLKKEETGTKIFFRPDPEIFDTVEFEFEILSKRFREMAFLNKGIKIQFIDHRIG--KDETYHYEGGIKSFVEYINRKKTAIHKEIIYIDEI----------RENTAVEIALQYTDSYTENILTFANNINTEEGGSHLSGFRSALTRCINDYGRKYNIIKEKEENLSGEDVREGLTGVISVKLPNPQFEGQTKAKLGNSETRGIVDSSVSENLSSFLEENPKVAKTILEKSLSXXXXXXXXXXXXDLTRKKNILESMTLPGKLADCQNSDNETTEIFLVEGDSAGGSAKDARDSVFQAILPLRGKIMNVEKARLDKILNSDEIKAMITAFGTGIGSEFSIDNLRYNKIIIMTDADVDGAHIMTLLLTFFFRYMRPLIEEGHVYVAQPPLFGILKGKALRYCYDDRELQRALNELGRDKFDIKRYKGLGEMNPEDLWETTMNPDHRILLKVEIKDAIEADETFSMLMGSEVEPRRDFIQENALFVENID. 638
166 0.000e+00gi|915396316|ref|WP_050781701.1| DNA gyrase subunit B [Lactobacillus coryniformis]  clstr ali  53  24...EELAKSYDASQIQVLEGLEAVRKRPGMYIGTTTSQGLHHLVWEIVDNGIDEALAGFADEINVTVEKDNSIRVTDNGRGIPVDIQQKTGRPAVETIFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSSKLTVEVIKEGHRYYMDFKRG-KVATQLKEISTAEHEHGTIVRFWPDPDIFETTVYDIKILTTRIRELAFLNKGLRITIEDLRGEEPSKQEFHYEGGIKSYVEFLDNGKQDLFPEPIYVEGVEK----------GITVEVALQYTEDYHTNLMTFTNNIHTYEGGTHEAGFKTALTRVINDYAHKNGLMKENEGNLSGEDVREGMTAVVSIKHPDPQFEGQTKTKLGNSDARTVTDHTFAETFSRYLMENPKIAKQVVDKGLLASKARLAAKRAREVTRKKSGLEISNLPGKLADNSSKDPEISELFIVEGDSAGGSAKQGRSRLTQAILPIRGKILNVEKASIDRILANEEIRTLFTAMGTGFGDEFDLAKARYHKLIIMTDADVDGAHIRTLLLTLFYRFMRPVVEAGYVYIAQPPLYQVRQGKMQRYIDSDEELEQILGTLPSPKPVIQRYKGLGEMDASQLWETTMDPDYRRLLRVDVTDAKEADEVFSMLMGDKVDPRRKFIEENAHYVENLDV 662
167 0.000e+00gi|490957819|ref|WP_004819632.1| DNA gyrase subunit B [Peptoniphilus indolicus]  clstr ali  50  2...EKNNQHYGAENIQVLTGLEPVRKRPGMYIGSTGSKGLHHLVYEIVDNSIDEALAGRCSEITIEIEKDGSVSVSDDGRGIPTDIHPQTKKSTVETVLTILHAGGKFSNDAYKVSGGLHGVGVSVVNALSTKLTATVKREGKIHQQTFSRGIP-TSELEIIGKAESDTGTKISFSPDPEIFDTLIFEWDILSKRFREMAFLNKGVRINFRDYREEKVREEVYHYEGGIKSFVEYINRKKTPIHKEIVYID----------QEKDKTLVEIAIQYTDAYSENVISFANNINTEEGGSHLSGFRSALTRTINEYGRKYNIIKEKEENLSGDDVREGLSAVISVKLPNPQFEGQTKAKLGNSETRGIVDSVVSDVLTDFLEENPKVGKLILDKALSXXXXXXXXXXXXDLSRKKNMLDAMPLPGKLSDCQLSDNENTEIFLVEGNSAGGSAVEARDSVFQAILPLRGKIMNVEKARLDKMLASDEIKAMITAFGTGIGQDFNIENLRYNKIVIMTDADVDGAHIMTLLLTFFFRYMRPLIEQGHVYVAQPPLFGILKGNKPKYVYDELELKKSLEELGRDKYDIKRYKGLGEMNAEDLWETTMDPEKRVLLKIDIEDAVEADETFSILMGSDVEPRREFIEENALFAENID. 639
168 0.000e+00gi|503021859|ref|WP_013256835.1| DNA gyrase subunit B [Spirochaeta smaragdinae]  clstr ali  50  2......QNSYSAQNIQVLKGLDAVRKRPGMYIGSTGPEGLHHLVYEIVDNSIDEALAGFCDEILVVIEKGNIIRVEDNGRGIPTDLHKEEGVSALEIVMTKLHAGGKFNKDTYKVSGGLHGVGVSVVNALSEWCDVFVHRDGSIFYQKYDRGNP-EKDVATVGETTR-HGTITRFKPDGEIFETVEFSFDVLSRRLRELAFLNKGIRIIIEDERLPQKKTKEFQFEGGVKSFVSFLSESKKPIHKEPIYFEGI----------RDGIDLECALEYNEGYSENIFSFVNNINTREGGTHLVGFKTALTRTFNDFLKKSKFAKKMDETFSGDDVREGLTAVVSVKVPDPQFEGQTKAKLGNSEVRGVVESLVAEHLTYYFEENPKLIEKILEKITMXXXXXXXXXXXXDLTRRKSALESSSLPGKLADCAEKDPSKSEVYIVEGDSAGGSAKQGRDRQFQAILPLWGKMLNVEKTRADKVLTNDKLQPIIATLGAGAGKEFDISKVRYHKVIIMADADVDGSHIRTLLLTFFFRYMPELVERGYVYIAMPPLYKMQLGKSITYAYDERDREKIMKSLETEKVAIQRYKGLGEMNPNQLWETTMDPDSRKIMQVRLEDAVEADQIFSTLMGEDVEPRRKFIEDNALMVSNLDI 636
169 0.000e+00gi|973090491|gb|KUK50414.1| DNA gyrase subunit B [candidate division TA06 bacterium 32_111]  clstr ali  52  16..KKDKSVNYDAKSIQVLKGLEAVRKRPAMYIGDTTTRGLHHLVFEVVDNSIDEALAGFCDKIKVTINEDGTCSVEDNGRGIPVDLHPEQGKSALEVVMTILHAGGKFDRKSYRISGGLHGVGVSVVNALSEWLEVFVQKDGNVYYQKYQRGIP-EDDVKIVGKT-KKSGTTVTFLPDREIFETTKFSYDILSERLREIAFLNKGLEVEIEDKREKREKKHTFKFKGGIKEFVEFLNENKNSLHKT-IYMS----------NQKDGIEVEVAMQYNDSYIENLYSYANNINTREGGTHLIGFKSALTRVINDYAKRTNALKNMD-SISGDDCREGLTAVISVKIPNPQFEGQTKTKLGNSEVKGLVESLISEKLQTFFEENPSVANKIINKVVXXXXXXXXXXXXXELTRRKSALDSSSLPGKLADCSINDPKIAELYLVEGDSAGGSAKQGRDRTYQAILPLRGKILNVEKARLDNILSDETIKTIIQAIGTGIGEEFDISRLRYGKIIIMTDADVDGSHIKTLLLTFFYRYMTKLIENGNIFIAQPPLYKITSGKNPLYAYSDEELQDILKTLDKDRVNIQRYKGLGEMNPEQLWETTMDPERRMLKLVTLEDAVEADRIFTILMGSEVEPRKKFIEENAKFAENID. 651
170 0.000e+00gi|551261664|ref|WP_022881897.1| DNA gyrase subunit B [Gryllotalpicola ginsengisoli]  clstr ali  48  1MTDEPTTSDYGANQIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVTEIVDNAVDEYLAGYGDRIVITLTKDGGVRVVDNARGIPVGIHQPEGISTVELVLTVLHAGGKFGGGAYQVSGGLHGVGSSVVNALSHRLEVEVKQKGHVWRQTYHDGKP-DSPLTQ-GEETDETGTTITFWPNGDIFESIEFDYDTLRTRFQQYAFLNKGLTIELFDEREQEKRHDVFLYQRGLEDYVEYLNSIKEVVNEEIIHFESEDTEKK--------IALELAMQWTTAYSESVHTYANTINTHEGGTHEEGFRAALTTLVNKYAREKGILKEKDDNLSGEDIREGLTAVISVKLAEPQFEGQTKTKLGNTEAKAFVQKVVGEQLGDWFDRNPNAARDIIRKGIQAATARLAARKARETARRKSLLEGGGMPGKLKDCQSKDPSISEIFLVEGDSAGGSAVQGRNPMTQAILPLRGKILNVEKARLDRALANLEIQSMITAFGAGLGEEFNAEKVRYHKIVLMADADVDGQHITTLLLTLIFRYMRPLIELGYVYLAQPPLYRLKWTNEHEFVYSDAERDALLKAGQAEGNGVQRYKGLGEMNYEELWETTMNPETRTLRQVTMEDAASADEIFATLMGEDVDSRRHFIQKNAKNVRFLDI 662
171 0.000e+00gi|492845170|ref|WP_005999124.1| DNA gyrase subunit B [[Eubacterium] infirmum]  clstr ali  50  1MSEEKVNTQYDAAQIQVLEGLEAVRKRPGMYIGSTGARGLHHLVYEVVDNSVDEALAGYCKHIKIIINKDGSLTVEDDGRGMPVDNHPKLGIPAVEVIHTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTDMVVEIKRNGKIYRQEYKRGKTVT-PLEVIGES-KSTGSKTTFWPDAEIFETIEFDYDTLQHRFREMAFLNKGIKISITDERDTPKKKEVFHYEGGLKEYVHYINQNKEVLHKEVIYFE---------VENKNSMEVEVALQYTDRYNEFILSYANNINTTDGGTHMAGLKSALTRAINDYAKKSKILKDSDPALSGEDIREGITAIVSVKLAQPQFEGQTKAKLGNSEVRGFVETATNDNLTAYLEEHPQEAKIIIEKCIRASRAREAARKARDITRRKNALDSTSLPGKLADCSEKDPALSEIFLVEGDSAGGSAKQGRDRSRQAVLPLRGKILNVEKARLDKILNSEEIKNMITAFGCGVGNDFDASKLRYHKIIIMTDADVDGAHIRTLLLTFFFRHMTPLIEGGYVYAAKPPLFMTKQGKDVYYTYSEPEQDKLLAELSGKKIDIQRYKGLGEMDFHQLWETTMDFNNRTLVQITMDDASQADEIFTILMGDKVPPRKKFIEDNAKYAE-IDI 641
172 0.000e+00gi|973032827|gb|KUK11298.1| DNA gyrase subunit B [Clostridia bacterium 41_269]  clstr ali  52  5...EEKKAAYDANKIQVLEGLEHVRRRPGMYIGGTGIRGLHHLVFELVDNSIDEVEAGACDTIEIMIHKDNSVTVKDNGRGIPVDIHEKTGKPALEVALTMLHAGAKFGGGGYKVAGGLHGVGLSVVNALSERLIAEVYRDGKVYRQEFKRGKP-LGPMKIVGEADH-SGTKITFYPDPKIFDEINFDTDILGERLQELSFLNRGVRITLKDER--KNFKVVYKQDGGIVDFVKHINRNREVLH-QPIYIKG----------EENDVLVEIAMQYHDGYVENVLSFANNIHTREGGTHEVGFKTALTRVINSYARRYKYLKEKDENFLGEDIREGLTAVVSVKVFEPQFEGQTKMKLGNPEVRRIVDSIVGNFLSSYLEENPKVARAIVNKAILXXXXXXXXXXXKELTWRKSALEITSLPGKLADCSIKDPSKCELFLVEGDSAGGSAKQGRDRRFQAILPLRGKILNVEKSRVDKILNNEEIRAIITAMGTGVGSEFEIDKARYHKLIIMTDADVDGAHIRTLLLTFLYRYMTPLIEKGYVYIAQPPLYKVTKGKKEYYLYNDEELEKLLNEIGRQGYSIQRYKGLGEMNPTQLWETTMNPETRNILKVTLEDAQKADEIFTILMGDRVEPRRRFIEAHAKEVQNLDI 636
173 0.000e+00gi|502443638|ref|WP_012788077.1| DNA gyrase subunit B [Chitinophaga pinensis]  clstr ali  49  1MSEELVQSGYDAGSIQVLEGLEAVRKRPAMYIGDIGVKGLHHLVYEVVDNSIDEALAGYCKNISVTICEDNSILVTDDGRGIPTGMHPKEGRSALEVVMTVLHAGGKFDKNTYKVSGGLHGVGVSCVNALSDKLHVTVRREGKLFEQEYQRGVPQ-YAVREIGTSDS-TGTTVHFKPDNEIFKETIYNREILAGRLRELAYLNRKIKITLTDDREGNSVTETFYSEGGIIEFVQMLDRNRNGLLPDPIFIEAHDASS--------NVAVEVAVIYNDSFSENIFSYVNNINTIEGGTHVAGFRRAITRIFKSYGDKNKMFEKTKIEVTGDDFREGLSAIISVKVPEPQFEGQTKTKLGNSDVMGVVDSSVAAVLDAYLEEHPREAKIIINKVVLAAQAREAARKARQMVQRKSVLSGSGLPGKLADCSENDPEKCELYLVEGDSAGGTAKQGRNRSFQAILPLRGKILNVEKAMEHKIYENEEIKNIFTALGVTIGTELNLSKLRYHKLIIMTDADVDGSHIATLILTFIFRYMKAMVEQGYVYIAQPPLYLVKKSKEQIYAWTEEDRKAAIAKIAGGKVTIQRYKGLGEMNAEQLWETTMNPDNRTLKQVTIESAAEADRVFSMLMGDEVPPRREFIESHAKYAK.... 656
174 0.000e+00gi|873915173|ref|WP_048621185.1| DNA gyrase subunit B [Ruminococcaceae bacterium GD1]  clstr ali  53  2......SAEYGGDQIQILEGLEAVRKRPGMYIGSTSARGLHHLVYEIVDNAVDEALAGFCDTIEVKVNADNSVTVIDNGRGIPTGINHKSGLPAVEVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSDWLIVEVRREGKIHEQRYERGR-VVTPLTVIGECDNETGTKVTFLPDGTIFEETLFDYGVLKQRLREMAFLTKNLRIQLKDDREEK-REDSFHYEGGIREFVSYLNRSNQPLYEQIIYCEGT----------RDDVYVEVAMQHNDSYTESTYGFVNNITTPEGGTHIVGFRNALTKTFNAYAKKNKLIKENEQSLSGEDIREGMTAIVSVKLPEPQFEGQTKQKLGNSEARGAVDSIVSSQLEIFLEQNPAVAKNIIEKSVMAQRAREAARKARDLTRRKSALEGMSLPGKLADCSDKDPKNCEIYIVEGDSAGGSAKTARERRTQAILPLRGKILNVEKARLDKIYANAEIKAMITAFGTGIHEDFDITKLRYDKIIIMTDADVDGAHISTLLLTFLYRFMPDLIREGHVYLAKPPLYKLEKNKKVWYAYSDEELSNILEKVGRDQNNIQRYKGLGEMDADQLWETTMDPKQRILIRVTMDESSELDLTFTTLMGDKVEPRREFIEENAKYVKNLDV 637
175 0.000e+00gi|524022582|emb|CCY03644.1| dNA gyrase subunit B [Faecalibacterium sp. CAG:1138]  clstr ali  52  3...ERVESNYDESAIQVLEGLEPVRKRPGMYIGSTDERGLHHLVYEVVDNAIDEASAGYCDYIRITLQHDGSCMVEDNGRGIPTGIIEKEGKSAVEVVLTKLHAGGKFGGGGYKISGGLHGVGVSCVNALSEWLEATVYQNGKVFKQVFNRGVAQ-APLKEIGPSDGRTGTTITFYPDDEIFETLDFNYDTLKVRIRELAYLNRGITIEFNDLRPDEPRREKFHYEGGIVQFVNTLNQGKETVFPEVIYIDDTY----------ENGEIELALQYNDSYTDTVYAFANNINTVEGGTHLEGFKASLTKIINDYAKKANIIK-GDEKLSSEDVREGLTAVLSVKLTNPQFEGQTKTKLGNSEMRSVVSKAVTEHLGSYLEEHPKEAKDLIMKSVLAAKAREAARSARDLARRKSALESTTLPGKLADCTDKDPSLCEIYMVEGDSAGGTAKTGRDRRFQAILPLRGKILNVEKARLHRVLENEEIKSMITAFGCGINQDYNEEKLRYNRIICMTDADVDGSHIRILLLTFFFRFMRPLIENGHVYIAQPPLYKVQRQKTIKYCYSDDELRQTLAEMGGKGTEVQRYKGLGEMDAEQLWETTMNPQTRILLKVTMEDAVSADQTFSLLMGEQPELRRKFIEDNATLVADLDI 637
176 0.000e+00gi|909539245|dbj|GAP43301.1| DNA gyrase, B subunit [Bacteroidales bacterium TBC1]  clstr ali  49  24.........YTAENIQVLEGLEAVRKRPAMYIGDIGSRGLHHLVYEVIDNSIDESLAGYCDNIEVFIHPDNSITVSDNGRGIPTDLHEKEKRSALEVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSSMLKVTVCREGKVFEQEYSIGKP-LYPVREAGTTGKTG-TTVHFKPDTSIFTNDIYDLEILSSRLRELAFLNKGIRLSITDEREGNHPHFSFYSENGLRDFIEYLDGMREKLMPEPIYIEG----------EKNDIPVEISMQYNTSFSENIHSYVNNINTHEGGTHLAGFRRALTRTLKAYADKSGMLAKLKFDINGDDFREGLTAIISVKVQEPQFEGQTKTKLGNNEVMGAVDTLVSELLNYYLEEHPKEARTIVNKVILAATARHAARKARELVQRKNVLSGSGLPGKLSDCSERDPELCEIYLVEGDSAGGTAKQGRDRRFQAILPLRGKILNVEKAMQHKIFDSEEIKNIYTALGVSVGTELNLSKLRYHKVVIMTDADVDGSHIATLILTFFFRYMRELIENGYVYIATPPLYLIRKGNNERYCWSEEEREATVAEFKESNVHIQRYKGLGEMNAEQLWLTTMNPEFRTLRQVTIENGTEADRIFSMLMGDEVPPRREFIEKNAKYAK.... 661
177 0.000e+00gi|524089788|emb|CCY66658.1| dNA gyrase subunit B [Clostridium sp. CAG:678]  clstr ali  49  19..DTSVTEEYSAKDIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNSIDEALAGVCTHIECEILPDNVIGVRDNGRGIPTGINEKTGLPAVTVVLTVLHAGGKFGGSGYKVSGGLHGVGSSVVNALSEWLEVEVTQNGHIYSQRFERGNPV-NDLHIIGDSD-GHGTYIKFKPDGEIFETLVYDFDVLSRRLREQAFLNAGLSITLSDLRPEEQKKEVYHYEGGIKSFVEYINKTRNPVQDEVIHIS----------TTKEDRSAEVALCYTDSYNEILLSFANNINTIDGGTHETGFKTALTRVFNDYGKKFNILKDSDKKLSGDDVREGLTAVISVKLTEAQFEGQTKGKLGNTDITGLVSSMVYEKLMTYFEENPQTAKTILNKALDASRAREAARKARDNARNKSGIENAKLKGKLANCSSNEPELCEIYIVEGDSAGGSAKEGRDRVHQAILPLWGKMLNVEKARLDKVYGNEKLMPIVMALGTGIGEDFDLSKLRYHKIVIMADADVDGAHIRTLLLTFFFRYMKPLVEGGYIYLAQPPLFKITKGKKNAYAFSDEERDSLIQEMGGQ-CDVQRYKGLGEMDPEQLWETTMDPEFRTMLRVTVEDAQQADETFSILMGDNVEPRRDFIEKNAKYVENLDV 659
178 0.000e+00JGI.Meta 7021695760 C4703217__gene_275108 DNA gyrase, B subunit [Human Supragingival plaque microbiome from visit number 1 of subject 158479  ali  50  5........SYSAENITVLKGLDAVRKRPGMYIGSTGPDGLHHLVYEVVDNCIDEAMAGYCDTILVVLEKNDTVRVEDNGRGIPVDIHPEEGVSALELVLTRLHAGGKFDKGSYKVSGGLHGVGVSVVNALSTNMEAIVCRDGFEYVQKFARGEP-LGPVTKRGET-QKRGTTIRWTADPTIFETTTYNFDVLAVRLRELAFLNNTISITLRDERLSTPKEVTFAFDGGISHFVRYLNESKQVLPKEPIYFDG----------EKSDVVVELAMQYNDGYKENVLSFVNDINTREGGTHLEGFKTALTRVMNEFLKKNKLSKEKEEKLMGEDVRAGLTAVLSVKVPEPQFEGQTKTKLGNSDVRSIVDTFINEKLTLFFEQNPTEIDKILEKAVGEATARIAARKAKEATRRKSGLDSFGLPGKLADCSSKDPEKCEVYIVEGDSAGGSAKKGRDSKTQAILPLWGKMLNVEKTRLDKVLNNEKLQPIIATLGTGIGEDFNLDKIRYHKIIIMADADVDGSHIRTLLLTFFFRYMPELIEHGYVYLAMPPLYKISYNKKEWYVYDDSERDSILNEIGRNSPAVQRYKGLGEMDGTQLWETTMDPARRKMMRVTLPDAVEADRIFSTLMGEEVEPRRKFIEENAVYA-NLDV 638
179 0.000e+00gi|737388397|ref|WP_035369867.1| DNA gyrase subunit B [Acholeplasma hippikon]  clstr ali  55  1MEDVKK---YTADNIQILEGLEAVRKRPGMYIGSTGERGLHHLVWEIVDNSIDEALAGYANEVNIEILPDNIIKVRDNGRGIPVDIHPKTGRPAVETILTTLHAGGKFDKGSYKVSGGLHGVGASVVNGLSLWYLVQIHKDGKIYEQKYERGIPA-YDLREIXXXXXXX-XXXXFLADPLIFETTVYNYETLRNRVQQLAFLNKGIKLTLEDKRIEHPMKEEFHYEGGIVEYIQHLNQSKSKIHQDAIYIDK----------EQDGVTVEIALQYVDTYTPNIYSFTNNINTTEGGMHEDGFKLALTRVISKYADDNKL--KKDDAISGEDTREGLTAIISVKHPEPQFEGQTKTKLGNPEVRAIASQITSEALERFLLENPNQAKLIVEKVISATRARVAARKAKELARRKSPLDALGFASKLADCRSKDPEKSEIYIVEGDSAGGSAKQGRDSEFQAIMPLRGKVLNVEKVRFDKMLNNKEIVNLIQAFGTGIGDEFDINKLRYHKIVIMTDADVDGAHIRTLLLTFLFRHFKPLIEHGYVYAAQPPLYKVSYGKNIQYAYSDEQLNTILASIEG-KPSIQRYKGLGEMNYEQLWETTMDPAARTLLQIKLEDAIEADQVFSMLMGEEVEPRKEFIQKNAQYATDID. 632
180 0.000e+00gi|491900701|ref|WP_005660652.1| DNA gyrase subunit B [Dethiosulfovibrio peptidovorans]  clstr ali  50  1MTATSAQSQYTAQSIQILEGLEAVRKRPGMYIGDTATRGLHHCVYEVVDNAVDEALAGYCSEIKVTIHTDGSVSVSDNGRGIPVDPHPSNGRPACEVVLTVLHAGGKFNNDTYKVSGGLHGVGVSVVNALSSWLELDICRNGKTWGQRFEKGIPVT-DLE-GGYETDKSGTTVHFMPDDEIFEEVCFSAEILGNRLREMAFLIPGLKITLIDDREE--KEWTFHYEGGLASFVEYLNRDKSSLFPKPIVVSG----------ERDSIFVEVGLQYNDGYHERLFSFANLIHTMEGGTHVIGLRSAITRAINESARRNKVLKDKDANLSGEDLKEGLTCVISVKLGDPQFEGQTKTKLGNSEVKGIVDSIVYEGLLVALDEDPSVLKPVVDKAVKARQAREAAKKARELV-RKTAMTGLNLPGKLADCSGRIPENCEVYIVEGDSAGGSAKQGRDRAFQAILPLRGKILNVEKARLDRILSSKEIRTIIQALGCGIGEDFDTTKLRYHKIIIMTDADVDGAHISTLLLTFFYRYMKELVEGGYIYLAQPPLYRVQIGRHSEYIFSDKDLRTFMNSHKGKKIGVQRYKGLGEMNPEQLWETTMDPENRVMKRIEVDDALAADEYFSILMGDKVEPRREFIQAHSHEVQNLDV 637
181 0.000e+00gi|1016801876|emb|CVH74747.1| DNA gyrase subunit B [Clostridiales bacterium CHKCI006]  clstr ali  55  4MEEEKVHHSYSDSDIQVLEGLEAVRKRPGMYIGSTSSTGLHHLVWEIVDNSIDEALSGYCNEIRIILKPDDVVTVIDNGRGMPTGINAKTGKSTVETIFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTWLEVYVDRDGHRYYQRFENGGAPVDDFKMIGDSDRQ-GTTVTFKADATIFETTTYDYETIRDRIRQLAFLNKGLKLILIDERLEPARSHEYHYEGGLKEYIQFLNQNKTPVHEEIVYVE----------DVQDEILVEIAMQYNDGYQPNIYSFCNNINTHEGGTHEEGFRLALTRVINNYAKNNGFLKKDEDSLSGEDCREGLTAIISVKHPDPQYEGQTKTKLGNAEVRKIVSNIFSEAFDKFLMEHPNTAKAIMDKCLLASRARLAAKRAREMTRRKNVLEVSSLPGKLADCTSKDPTLSEIFIVEGDSAGGSAKMGRNREYQAILPLRGKILNVEKARVDKIFNNNEIRSMITAFGTGINEEFDINKLRYHKIVIMTDADVDGGHIRTLMLTFLYRYLKPLIEQGYVYIAQPPLYLLKQGKEEHYLYSKEELDHLIEELGNARYSIQRYKGLGEMNADQLWETTMNPEHRVLLQVKLEDAMQADLIFDMLMGERVEPRREFISQNAKYAT-LD. 643
182 0.000e+00gi|517171979|ref|WP_018360797.1| DNA gyrase subunit B [Porphyromonas macacae]  clstr ali  49  14.....QNQSYSAQNIQVLEGLEAVRKRPAMYIGDISEKGLHHLVYEVVDNSIDEALAGYCNRIDVIIHEDNSIEVRDNGRGIPVDFHKKEKKSALEVVLTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSNSLKAIVRRDGKIYQMDFSRG-KALTELQVIG-TTNETGTTIIFTPDDSIFTTKVYNFHTLAMRLRELAFLNAGITLTLTDRRDGSFHCERYFSKDGLKEFVHYLDRSKESLIHDVIHI----------TAEKQGIPVEVAMTYNTTFNENLYSYVNDINTIEGGTHLAGFRRGLTRTLKKYAIDSKMLDKVKVEITGDDFREGLTAVISIKVAEPQFEGQTKTKLGNSEVMGAVDMAVGEALEAYLEEHPKEAKTIVDKVILAATARQAARKARELVQRKSPLSGGGLPGKLADCASKDAAMCELFLVEGDSAGGTAKQGRDREFQAILPLRGKILNVEKAMQHRILESEEIRNIYTALGVTIGTELNLSKLRYHKVIIMTDADVDGSHIATLILTFFFRNMRALIDNGYVYIATPPLYLCKKGKEEEYCWTEQQRQAFINRVADGKVHVQRYKGLGEMNDEQLWETTMNPANRTLRKITIDNAAEADAIFSMLMGDDVGPRREFIEDNATYAR.... 654
183 0.000e+00gi|524789021|emb|CDE87684.1| dNA gyrase subunit B [Prevotella sp. CAG:891]  clstr ali  47  1MEEIEKQGEYSASNIQVLEGLEAVRKRPAMYIGDISEKGLHHLVYETVDNSIDEALAGYCTHIEVTICEDNSIIVQDNGRGIPVDMHPKEGRSALEVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTKMVSKVFRDGKIYRQEYAKGHPQ-APVEVVGETD-LRGTCQHFWPDPTIFTTTTYKYDILANRMRELAFLNAGITITLTDLREGNTRQDVFHSDLGLREFVRYIDSSRTHLFDDVIYI----------NTEKNNIPIEVAIMYNTSYSENLHSYVNNINTIEGGTHLVGFRSAVTRVLKKYAEETKQLEKAKVEIAGEDFREGLTAVISVKVAEPQFEGQTKTKLGNSEVAGAVNQAVGEALTYYLEEHPKEAKLVVDKVILAATARVAARKARESVQRKSPFSGGGLPGKLSDCSSKDPSICELFLVEGDSAGGSAKQGRSRATQAILPLRGKILNVEKAMWHKAFESDEVNNIIQALGIGMGEDANLDKLRYHKVIIMADADVDGQHIATLIMTLFYRYMPQIIQDGYLYIAMPPLYRCTKGKIQEYCYTDRDRQIFMDKYGDDSIKTQRYKGLGEMNPEQLWETTMCPETRMLKQVSLENAADADYVFSMLMGDDVGPRREFIEKNAIYA-NID. 651
184 0.000e+00gi|500029888|ref|WP_011710606.1| DNA gyrase subunit B [Gramella forsetii]  clstr ali  48  1MSEEAKKHNYSADSIQALEGMEHVRMRPSMYIGDTGVRGLHHLVYEVVDNSIDEALAGHCDNIKVTINEDNSITTEDNGRGIPIDLHKKEGVSALQVVMTKIGAGGKFDKDSYKVSGGLHGVGVSCVNALSEHLTAIVFRDGQVWQQEYELGKP-LYPVKPTGETE-LSGTIVTFKPDPSIFTTLEYNYDTLASRMRELAYLNKGIRISLTDKRNGEFVHDDFHSEEGLKEFIRFLDGNREPIIGDVISMEG----------EKNDIPVEVAMVYNTSFSENLHSYVNNINTHEGGTHLSGFRRGLTTTLKKYADSSGLLDKVKFEITGDDFREGLTAIISVKVAEPQFEGQTKTKLGNREVTSAVSQAVSEMLENYLEENPNDAKTIVQKVILAAQARNAAKKAREMVQRKTVMSVGGLPGKLSDCSDQDPEQCEVFLVEGDSAGGTAKQGRDRKFQAILPLRGKILNVEKAMSHRVFDNEEIKNIYTALGVTIGTELNLSKLRYHKVVIMCDADVDGSHIETLILTFFFRYMKELIENGHIYIATPPLYLVKKGQKKRYAWSEKERDEIAESY-SGGVQIQRYKGLGEMNAEQLWDTTMDPEFRILRQVNIDNGGEADRIFSMLMGDEVPPRREFIEKNAKYA-NID. 645
185 0.000e+00 [EC:5.99.1.3][KEGG:K02470] DNA gyrase subunit B;|[COG0187] Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit  ali  48  6..EKHIEEEYSASSIQVLEGLEAVRKRPAMYIGDIGIKGLHHLVYEVVDNSIDEALAGYCSNIEVYINEDNSITVEDDGRGIPTDMHEKEGKSALEVVLTVLHAGGKFNKDSYKVSGGLHGVGVSCVNALSNLLIAEVHRQGKIHIQKFSKGTP-LGPMEITGDTD-THGTIITFKPDDAVFTSTEYNYDILASRLRELAYLNKGVRLNLTDKREGNYRRDEFYSVDGLKGFVKFLDESREPLIENVIYID----------TERDGVPVEVAMQYNTSFTENVHSYVNNINTIEGGTHLTGFRRALTRTLKKYAEDSGMLSKVKFEINGDDFREGLTAVISVKVQEPQFEGQTKTKLGNSETAGAVDQAITTALTHYLEENPKDARAIVNKVVLAATARHAARKAREMVQRKTVLSGSGLPGKLADCSSRDREKTEIFFVEGDSAGGTAKQGRDRTFQAIMPLRGKILNVEKAMKHRVWENEEISNMFKALGSGDGNDVSLEKLRYGKVIIMTDADVDGSHIATLMLTFFFRHMTSLIQNGHVYIATPPLYLVKKGKNSRYCWTEEEREATLAEFGAKGAHVQRYKGLGEMNAHQLWETTMSPKSRILRQVTIESAAEADRIFSMLMGDDVPPRREFIERHAKYA-NIDI 652
186 0.000e+00gi|315487544|gb|EFU77852.1| DNA gyrase, B subunit [Lachnoanaerobaculum saburreum DSM 3986]  clstr ali  52  15......NTEYGASQIQILEGLEAVRVRPGMYIGSISSRGLHHLVYEIVDNSVDEALAGFCTEIEVSINEDNSITVKDNGRGIPVDIQKKAGIPALEVVFTILHAGGKFGGGGYKTSGGLHGVGASVVNALSTWLDVKVYRDGKVYHMRFEKG-KVVEKIEVIGECDQKTGTEVSFLPDAGIFEETVYDFDILKIRLRETAFLTKALKITLIDNREEK-RKMSFHYEGGIKEFVTYLNKGKVPIYEDVIYCEGT----------KEKVMVEVAMQHNDNYSESIYTFVNNINTPEGGTHLSGFKNALTKTFNEYARSNKLLKDSDENLSGEDIREGLVAIISVKIEDPQFEGQTKQKLGNSEAQTAVNSIVSEQLTYFLEQNPTVAKIISEKAITXXXXXXXXXXXXDLTRRKSALDNMSLPGKLADCSSKNPKECEIFIVEGDSAGGSAKGARRRDTQAILPLRGKILNVEKARLDKIYSNAEIKGMITAFGTGIHDDFDITKLRYNKIIIMTDADVDGAHIDTLMLTFIYRFMPELIKEGHVYLAQPPLYKLEKNKKVWYAYSDEELNNILKEVGRDQNNIQRYKGLGEMDAEQLWETTMDPERRVLKKVVLDESMETDVVFSTLMGDQVAPRREFIEANAKYVSNLDI 650
187 0.000e+00gi|493200135|ref|WP_006189397.1| DNA gyrase subunit B [Treponema vincentii]  clstr ali  50  5........SYSAENITVLKGLDAVRKRPGMYIGSTGPDGLHHLVYEVVDNCIDEAMAGYCDTILVVLEKNDTVRVEDNGRGIPVDIHPEEGVSALELVLTRLHAGGKFDKGSYKVSGGLHGVGVSVVNALSTSMEAIVCRDGFEYVQKFALGEP-LGPVTKRGET-QKRGTTIRWTADPSIFETTTYNFDVLAVRLRELAFLNNTIKITLRDERLSTPKEVTFAFDGGLSHFVRYLNESKQVLPKEPIYFEG----------EKNDVVVEIAMQYNDGYKENILSFVNDINTREGGTHLEGFKTALTRVMNEFLKKNKLSKEKEEKLMGEDVRAGLTAVLSVKVPEPQFEGQTKTKLGNSEVRSIVDTFINEKLTLFFEQNPIEIDKILEKAVGEATARIAARKAKEATRRKSGLDSFGLPGKLADCSSKDPEKCEVYIVEGDSAGGSAKKGRDSKTQAILPLWGKMLNVEKTRLDKVLNNEKLQPIIATLGTGIGEDFNLDKIRYHKIIIMADADVDGSHIRTLLLTFFFRYMPELIEHGFVYLAMPPLYKISYNKKEWYVYDDSERDSILNEIGRSSPAVQRYKGLGEMDGTQLWETTMDPARRKMMRVTLSDAVEADRIFSTLMGEEVEPRRKFIEENAVYA-NLDV 638
188 0.000e+00gi|1008841384|gb|KYK24662.1| DNA topoisomerase IV subunit B [Thermoplasmatales archaeon SG8-52-4]  clstr ali  51  2...NDQTGSYDTDSIQVLEGLAAVKKNPAMYIGSTDERGLHHLVYEVVDNSIDEAMAGYCTKIQVILNKDGSVTVVDNGRGIPVSMHKKYNKSGVELVMTTLHAGGKFDSNAYKVSGGLHGVGVSVVNALSKWLEVKVRRNGAEYYQKYDHGMTVDT-LKQIGKAD-TNGTTIVFLPDEEIFETVDIKYETISARLKEMAYLNAGLEIEIIDEKTG--KCEIFKYEGGICEFVQHINRNKTTLHPAPIYLKA----------EKEDVEVEIAIQYTDGYTENIFTFANNINTHEGGTHLSGFKGALTRVLNDYGKKNNIFDGESFSLSGEDCREGITTVISCKVRHPQFEGQTKTKLGNSEVRGIVESLTNEKLSYFFEENPSVARIIIDKTITASRAREAARKARELTRRKGLLESSALPGKLADCSSREPGKTELFIVEGDSAGGSSKQGRDREFQAILPLRGKILNVEKSRMDKILKNNEILALITAIGTGIGEEFNIENARYHKIIIMTDADVDGEHIRTLLLTFFFRYMRPLIEEGYLYIAQPPLYKIGRGRDIAYAYSERERLQKMNEMGGKGLSIQRYKGLGEMNPTQLWETTMNPEKRTIVNVTVDDAVEADELFTILMGEKVEPRREFIETHAKDVVNLDI 634
189 0.000e+00gi|502880175|ref|WP_013115151.1| DNA gyrase subunit B [Brachyspira murdochii]  clstr ali  51  1MAAAEKT--YSSKNIQVLEGLDPVRKRPGMYIGSTGAQGLHHLVYEVVDNSIDEAMAGYCKNITVTIEKDNIIKVEDDGRGIPVDMHPKLKISALEVVMTKLHAGGKFDNETYKVSGGLHGVGVSVVNALSTELIAEVRKDGKLYRQVYHRGVP-EEPVKEVGTSTK-NGTTVIFKADADIFETTVYDYKILANRLRELAFLNRGIRITLTDKREAETVSNEFYYEGGIEMFITHLNENKKALHDKPIYLHKT----------EDKTDVEVAMQYVDAYNENIFTYCNNINTTEGGTHLVGFRTALTRVYTDFAKKLELDKKNKITFMGEDTREGLVAVVSVKIPNPQFEGQTKTKLGNTEVRAVTEKLVVEGLNDYFSQNPKVIKAILEKIISAANAREAARKARDLARRKNALESDSLPGKLADCSEQEVDKCEVYLVEGDSAGGTAKGGRDRHFQAILPLRGKVLNVEKARLDKIIDNESLKPIIAALGCGVGASFDISKIRYGRVIIMADADIDGSHIRTLLLTFFFRYMRPLIDLGHIFIAVPPLYKISFDKKNFYAYSDEQRDKILSENKDRKYDIQRYKGLGEMNADQLWETTMNPETRLMYQVLTEDAEKADQLFSMLMGDEVKPRRDFIEANARYVKNLDV 637
190 0.000e+00gi|402286079|gb|EJU34558.1| DNA gyrase, B subunit [Capnocytophaga sp. CM59]  clstr ali  48  10MSEQLDPNKYSADNIQSLEGMEHVRMRPSMYIGDVGVRGLHHLVYEVVDNSIDEALAGYCDTISVIINPDNSVTVEDNGRGIPVDIHKKEGVSALEVVMTKIGAGGKFDKGSYKVSGGLHGVGVSVVNALSTHLTATVYRDGKIWEQEYERGV-ALYQVKEKSVTDK-RGTKVTFLPDTEIFQTIEFSYDVLANRMRELAFLNKGIRITLTDLRNGEPISQVFYSEKGLEEFIQYLDGNRTPIIKKIIAMEG----------EKNDIPVEVAMIYNDSFNENLHSYVNNINTHEGGTHLQGFRMGLTRTLKNYADKSGLLKKNPLEISGDDFREGLTAIISVKVAEPQFEGQTKTKLGNREVTAAVSQAVSDMLESYLEENPEDAKTIVNKVILAAQARLAAKKAREAVQRKSPMGGAGLPNKLADCQDRNPANCELFLVEGDSAGGTAKQGRDQKFQAILPLRGKILNVEKAMQHRVFDNEEIKNIYTALGVTIGTELNISKLRYHKVIIMSDADVDGSHIATLILTFFFRYMRELIEEGHVYIATPPLYLLKQGKKEQYAWSDEERDTLTKEFAQTKVTVQRYKGLGEMNADQLADTTMNPAHRTLRKVNIENAVEADRIFSMLMGDDVPPRREFIEKNAKYA-NID. 664
191 0.000e+00gi|497012943|ref|WP_009437116.1| DNA topoisomerase IV subunit B [Prevotella sp. oral taxon 473]  clstr ali  46  1MEEEQKPAGYSASNIQVLEGLEAVRKRPAMYIGDISEKGLHHLVYETVDNSIDEALAGYCTHIEVTICKDNSIIVQDNGRGIPVDIHEKEGVSALQVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTHMKSQVFRDGKIYQQEYSAGKP-LYDVKVVGQTDR-RGTRQQFWPDPEIFTTTTYRYDILANRMRELAFLNAGLTITLTDEREGKPLSETFYSEQGLREFVRYQDSMRNPLIPDVIYI----------NTEKEGIPVEVAIVYNTSYSENLHSYVNNINTIEGGTHLAGFRSAVTRVLKKYAEEQKQIEKAKIEITGEDFREGLTAVISVKVAEPQFEGQTKTKLGNSEVMGAVNQAVGEALTYYLEEHPKEAKLIVDKVILAATARVAARKARETVQRKNPMSGGGLPGKLADCSSKVPEECELFLVEGDSAGGSAKQGRSRATQAILPLRGKILNVEKAMWHKAFESDEVNNIIQALGIRFGKEANIDKLRYHKIVIMADADVDGQHIATLIMTLFYRYFPQVIRENHLYIAMPPLYRCRKGKTEEYCYNDREKDAFIEKYGDPSITLQRYKGLGEMNPTQLWDTTMNPETRMLKLVTIENAAEADHIFSMLMGDDVEPRRDFIERNAKYAT.... 658