current user: public




Query: gi|13507754|ref|NP_109703.1| hypothetical protein MPN015 [Mycoplasma pneumoniae M129], from M.pneumoniae

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MAKIKLKNRKALVVYNKTDFDKNKHFAQALVDELNKKKLVGHILLLDDETADHKHIKNVELIINRSRRIDFLTKHNFLNSFLINPQNIVLVANDKYETYRWLKQHKFLTVDTTIFDPKKIKTFPIVIKKRDSYGGEDVHLIQNAEEIKQLPIQNPNEWIVQPFLSIGKVEYRAYILFGKVLKTIRRTASGDDFRANYSQNAAVDLFKLKWYIKHKIKRIAKKLGHGYYAIDFFLNKYNRIVVNEIEDAAGARALTKMCPDLNLPRVIIKSSLTHFKHHLKRQMIPLast
1 -29.500[HJ] COG0189 Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase)  ali follow..  16  16WRHYRRGFMRIAFFVNSIETEGPTFATGLLAMAALNRGHDVVYLTPGDFTLRSDDVEEIDALMLRHAGILFGRLAEQRGVVVLNDPEGLALAQNKLYFQSF---PEIVRPTTLISRNVEEIPKGVIVKPLQGSGGKNVFKIGSSKELNQIFEAVSLELIAQAYLPAAKEDVRFFMMNGRPLAALRRVPAKGDLRSNIHANGTAEAVKVTDEIVELAEMMRPKLGMFLVGLDIVGDK-----ILEVNSPGGLSNILEL-TNVDFSDTIIEAVETKVSMQAA..... 358
2 -26.800[R] COG1821 Predicted ATP-utilizing enzyme (ATP-grasp superfamily)  ali follow..  16  58.........................SMDSMEKYLEKSDAFLIIAPEDDFLLY-----------------TLTKKAEKYCENLGSSSRAIAVTSDKWELYKKL-RGEVQVPQTSLRPL----DCKFIIKPRTACAGEGIGFSDEVPD----------GHIAQEFIE--GINLSVSLAVGEDVKCL---SVNEQIINNFRYAGAVVPARISDEVKREVVEEAVRA-NGYVGVDIVYSDQ--PYVIEINARTTPVVAFSRAYGASVADLLAGGEVKHVRRQMVRK... 282
3 -24.700[M] COG1181 D-alanine-D-alanine ligase and related ATP-grasp enzymes  ali follow..  13  1........MKIAVLYGGTSAEREVSLSKGIMEALKANGHEVIGIDFHPDQVRDLVDLDVDLVFIGLHG-KVQALLDLLNIPYVGTGQGSALAMDKAKAKLFFEKAGIRVAEEVVLHSFTYGTYPVVVKPNQEGSTIGLTVAETEEELLQGIERHDDTILIEEFIA--GTEVTVAVLGNK-VVEIVPKNKLYDYESKYAPGMSEHIVEHTAYVQQAAVRAHQALGCVYSRVDFIVPNDGDPVILKVNTLPGMTPTSLYGVGMSYEEMIQTFVNLSLKK........ 305
4 -22.200[R] COG3919 Predicted ATP-grasp enzyme  ali follow..  12  54....................PHDDGAMAFLREMAEKPGLKGCLLVPSG--------DGEVQLVSQHRE-----ELSALYKIILPEWTNLQWLCEKPLLYKRAAELGVSIPRTYALTSAADVMFPVILKPHMGGARAKVIRADDREELKAAFVDAPDNVVVQELIPGGGESQFSYAANGEPIAEFTARRAR-QYPVDFGYTSTRVEVVDNRQAIEAARKILKSAGHGLVEVEFKLDRDGALKLLDVNPRPWSWFGLCSAAGINLGGLLWRVANDM........... 313
5 -20.200[R] COG1759 ATP-utilizing enzymes of ATP-grasp superfamily (probably carboligases)  ali follow..  11LEKYDKDKITIGVIGSHSALD--------IADGAKEEGLPTLVVAQRGRHRTYEKYFRMRIVLDKFAQTGIDRVENEFLVPMFGTRSLTEERSEEKSYYWLLEKAKLPYPEPVSPEEIDD-VGLVIVKLPHKRLERGFFTAASYKEFKEITREDLAKARIERYII--GPVFNFDFFYSPIDGEIELLGIDWRFETSLDHASSTLRESLLEKVFDMAEKYVEATKKGIIGLQTAVDKDLNFYIYDVAPRTGGGTNIHMAMGHPYGNSLWRRIALEIKRAIELDEL. 375
6 -20.000[TU] KOG3895 Synaptic vesicle protein Synapsin  ali follow..  14  82.PAFSKDKYFTLLVLDDQNTDWSKYFFDIRVEQAEFRDITVVSSADTGPVVTMAAYRSPDFVLIRQP--STILGLKYGGVPSINSLHSIYQFQDKLQLQRRLGRDGFPLIEQTFFPNPRDLKFPSVLKAGHCHGGVATARLENQSALQDAAGLVSCYCTIEPYI-DAKFSVHIQKIGNN-YKAFMRKSITGNWKTNQG-SAMLEQITLTEKYKSWVDEISELFGMEVCGLSVVVAKDGREYIISACDST.................................... 428
7 -19.300[R] COG2232 Predicted ATP-dependent carboligase related to biotin carboxylase  ali follow..  12  1.....MSKMEEILVIG--------VNTRPVVESAFRLGYRVYSAGYHENFSQEKLLEAASDFIERADGIIPLTGAPPLPGEKVLGNSRVDHVEDKYRLYRRI-RNSYPTPETHLISDPAEAEKKYIAKPVSGAGGFGVTEFREGDG----------EFLLQEYIEGVPVSASVLSTGEDAITVLTSRRGVPGFEGQFVYAGNMTP-GPSGEIEDLASDLILDLSLGSNGVDLIMRDSELYVI-EVNPRIGTFECAEASLGINMVDAHIRACMGELIEKPD..... 294
8 -15.100[I] COG0439 Biotin carboxylase  ali follow..  15  86.................................................................AENPDFAEMCREHGIVFIGPTESMRALGSKAGGREIAAQSNVPTVPDAALLAAKQIGYPVLLKASAGGGGRGQKVIRTQEELQKGFNQAQEEIIMEKFLEEF-RHIEVQVMGDGQGHVIHIGERDCSIQRRNQKLIEEAPSTLPESLRAAGVRLAQFVNYAGAGLEFIMDRDGNYYFMEMNTRIQVEHVSEMISSLDLVRLQIE................ 312
9 -14.100[F] COG0026 Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase)  ali follow..  13  24...........................RMLAMAAARLNHRTIVLEPDDEKALAELASRCDVVTYEFENVPVAAEKLSASVPVYPPAQALSASQDRLTEKRFLNGCGIPTADDELEAALTAFGGKGVLKTRRGYDGKGQRLFRGGENLTGAFAALGGVPLILESFVAFEREISIIAARFQDGTVTCYDPAENVHLNGILHTSTVPA-AAKAVAVQSAEKLLAALEVGVIGIEFFVLPDGSLVANEMAPRVHNTG................................ 280
10 -13.100[I] COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit  ali follow..  20  85.................................................................SERAEFAQAVIDAGLIWIGPDDVIEALGDKVMARRIATGVGAPLVAAEVTAFAEQHGLPVAIKAAHGGGGRGLKVAWKMEEIAELYESAVRECFLERFLDRP-RHIEAQVIAGNVLVLGTRDCS----RRNQKLIEEAPAPFLSDEQRQKIHDAAKAIAAGYSGVEFLLGVDGTISFLEVNTRLQVEHVTEETTGIDLVIEQFR................ 313
11 -12.600[F] KOG2835 Phosphoribosylamidoimidazole-succinocarboxamide synthase  ali follow..  14  16...........................RMIVEAANRLNIKTVILDAENS--AKQISNSNDHVNGSFSNPLDIEKLKHPKLKIYPSPETIRLIQDKYIQKEHLIKNGIAVTQTSLLNVGRDLGFPFVLKSRTAYDGRGNFVVKNKEMIPEALEVLKDRPLYAEKWAPFTKELAVMIVNGLVFSYPIVETIHKDNICDLCYAPARVPDSVQLKAKLLAENAIKSFPCGIFGVEMFYLETGELLINEIAPRPHNSGHYTI............................ 282
12 -12.500[F] COG0027 Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase)  ali follow..  15  74........................................................EKPDYIVPEVEAIATLVELEQAGFTVIPTAKATQLTMNR-EGIRRLAAEELGLPTS-FKRAVEKIGIPCVVKPIMSSSGHGQSILKSVEQIPSA-RAGAGRVIVEGFVK----DYEITLLGTSFLAPIGHIQIDGDYRESW------QPQAMSAVALEKAQAIAEKIGRGIFGVEMFVCGD-EVIFNEVSPRPHDTGMVTLISQ......................... 295
13 -12.300[IE] KOG0238 3-Methylcrotonyl-CoA carboxylase, biotin-containing subunit/Propionyl-CoA carboxylase, alpha chain/Acetyl-CoA carboxylase, biotin carboxylase subunit  ali follow..  12  65IKTARAMGIKTVAVHSDVDSNKSYLRADRILQAVEDTGAQA---------------PGYGFL---SENTKFAAELEKAGAKFIGNSKAILDMGDKIHSKKIATAARVSMIPDMCVKVSRDIGYPVMIKASAGGGGKGMRVAWNDKQAREGYRLSKQEMLVEKFIDNP-RHIEMQVLCDKALWLNERECS----RRNQKVIEEAPSSFVPPEMREQAVQLAKAVGYDSAGVEFLVDSQRNFYFLEMNTRLQVE-ITECITGIDIVQQMLR................ 361
14 -11.800[C] COG1038 Pyruvate carboxylase  ali follow..  13  115.................................................................SESPEFVEACNKAGITFIGPTDTMRQLGNKVAARNLAISVDVPVVPATVERMAEEIGYPVMLKASWGGGGRGMRAIRKKEDLAREVTEAKREVYLEKLVERA-RHVESQILGDTVVHLFERDCS----RRNQKVVERAPAPYLSEAQRQYSLKIAAATNYIGAGVEYLMDADGKFYFIEVNPRIQVETVTEVVTGIDIVKAQI................. 343
15 -11.200[F] COG0151 Phosphoribosylamine-glycine ligase  ali follow..  13  53..........................IPALVKFAQDKQIGLTIVGPEAPLVIG-----------------VVDAFREAGLKIFGPAKAAQLEGSKAFTKDFLARHKIPTAEYQNFTEVEPAGTPIVVKADGLAAGKGVIVAMTLQEAEDAVRDMGSRVVIEEFLDGEEASFIVMVDGKNVEASSQDHKRVGENDTGLNTGGMGAYSPAPVITPEIHSRIMKEVGNVYTGFGLMIMPNGQPKVIEFNCRFGDPETQPIMLRLDLVELCLKACDGKLDEVISQ.... 325
16 -9.540[O] KOG2158 Tubulin-tyrosine ligase-related protein  ali follow..  12  238..........................................................................................................LPADYGDAMNYALNHKRTFILKPDSGAQGRGIWLTNDLKTIGP-----HERLICQTYIHRP--DLRVYTL--RFATNKYVEPTPGNANTNYSVNKRNSHYELCDNDDDVIIKTVLSAWFEILGFDILVDWKLKPYILEVNHSPSFHT--NEQVDREVKRPLIRDTLNLV.......... 475
17 -9.420[F] KOG0237 Glycinamide ribonucleotide synthetase (GARS)/Aminoimidazole ribonucleotide synthetase (AIRS)  ali follow..  11  59..........................FEQLVKFALDKDVNLVIPGPELPLVEG-----------------IEGHFRRVGIPCFGPSAAARMEGSKVFSKDFMHRNNIPTAVYKSFSNYDHATFDVVIKADGLAAGKGVIIPKTKKEAFEALESIGKNVVIEELLEGEELSILTFSDGYTCRSLPHKRAFDGDKGPN--TGGMGCYAPTPVASPKLLETVQSTIGYPLVGIGLMLTPSGPRVL-EYNVRFGDPETQAVLPESDLAEIILACVNHRLDA........ 326

FFAS is supported by the NIH grant R01-GM087218-01
8 5 6 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.