current user: public




Query: gi|13507745|ref|NP_109694.1| thymidylate kinase MPN006 [Mycoplasma pneumoniae M129], from M.pneumoniae

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210
# Score Template Links and tools%idFirst MKQGVFVAIEGVDGAGKTVLLEAFKQRFPQSFLGFKTLFSREPGGTPLAEKIRALLLHEAMEPLTEAYLFAASRTEHVRQLIQPALQQKQLVIVDRFVWSSYAYQGLIKKVGLDVVKKLNADAVGDSMPDFTFIVDCDFETALNRMAKRGQDNLLDNTVKKQADFNTMRQYYHSLVDNKRVFLLDGQNQTGCLEQFIEQLSQCLTQPTLSLast
1 -91.100[F] COG0125 Thymidylate kinase  ali follow..  32  2..SGLFITFEGPEGAGKTTVLQEIKNILTAE--GLQVMATREPGGIDIAEQIREVILNILMDPKTEALLYAAARRQHLVEKVKPALEQGFIVLCDRFIDSPLAYQGYARGLGIDEVLSINEFAIGDMMPHVTVYFSIDPEEGLKRIYANGSREKNRLDLEKLDFHTKVQEGYQELMKPERFHSVDAGQSKDLVVQDVLKVIDEALKK... 209
2 -49.600[F] KOG3327 Thymidylate kinase/adenylate kinase  ali follow..  15  1......................................MNFPERSSSIGQVINSYLTNSDLPDEVIHLMFSANRWEHI-NQVKEKLLEGTTLVVDRYSFSGVAYSA-AKGLDFDWCYAPERGL---IKPDAVFYLRAPPNDLTHRGQYGKER------YEKVEFQGRVAEVFNRICSGSYFHQFDARQSVEDLHAQIASITEELLPK... 161
3 -18.000[C] KOG3877 NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit  ali follow..  16  80.ENSKVICVEGPIAAGKSKFAKELAEELDMEYYPAVDLDL-RKLDPQLPPSCRSYDVRNFCLDPSHDIRMYMLRYSQYIDALQHVLSTGQGVVLERSPYSDFVFQGYLSRGARSVYNELRQNTIGELKPHLVIYLDLPVDAVKKQIKARNVDYEVQSKVFSDAYLSDLEQLYKQISTHAELLIYDWTAETEVVVEDIERI.......... 307
4 -18.000[F] COG2019 Archaeal adenylate kinase  ali follow..  12  1....MRSVITGVAGVGKTTVLDIVARESGIPVVN-------------YGTLMFEVAKRRGLVENRDQIRKLSRETQVLQKLAGEEIGKMENAIVDTHM-------------PFGYLPGLPEWVLRSINASVFVIIEADPAIIKRRRDNDPTRARDDEGVDSIREHQEMNRYYSIFSGATVKIVKNEEGKPEQAADEIVRVIK........ 181
5 -15.100[P] COG3709 Uncharacterized component of phosphonate metabolism  ali follow..  17  12LSPGTMIVIVGPSGAGKDTLMDYAAAQLSGRP-----VITRDAGGEN-----HDAVSMHEFNQLEDAGAFAVSWQAHIPAAVYRHLEAGDVVIAN--GSRSALPH------------------FGTAFSRLKVVIVARPDVLARRLEQRGRESRDDIL-------RRLERSSLAVAGDFDVTTVDNSGAIEDAGKTIMQVLQQ....... 192
6 -15.100[F] KOG3079 Uridylate kinase/adenylate kinase  ali follow..  13  32LMKPLVVFVLGGPGAGKGTQCARIVEKYGYTHLSAGELLRDE--DSQYGELIEKYIKEGKIVPVEITI-------SLLKREMDQTMAANA--------KNKFLIDGFPRNQ--DNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESTYLQSTKPIIDLYEEMGKVKKIDASKSVDEVFDEVVQIFDK....... 226
7 -14.100[V] COG3896 Chloramphenicol 3-O-phosphotransferase  ali follow..  16  20MPEGKLILLNGGSSAGKTSLALAFQDLAAECHIGIDLFWFALPPEQLDLARVRPEYYTWDSAVEADGL-ILDLAMHSRYRAIRAYLDNGMNVIADDVIWTREWLVDALRVFEGCRV--------------WMVGVHVSDEEGARRELERGDRHPGWNRGSARAAHADAE--YDFELDTTATPVHELARELHESYQA-PMAFNRLRKRFLS 225
8 -13.900[F] COG1428 Deoxynucleoside kinases  ali follow..  11  7....KVIVLAGMIGAGKSSYTELIANELGTKAFYESI--KDNR--------LEMFYDDPKRWAFALQIYFLNTRFRSIKAALTQNNVLDRSIYEDALFTQINFEEGNISEPEMDTYLDLLDNMMEELAPDLLIYLRGSLDTVLSRISLRGRPEQTFDNPGLLDYYKHLHSRYDSWFESSDTLVINIDEVDINKPSDAKYVMQLIHEKL.. 212
9 -13.700[R] COG4639 Predicted kinase  ali follow..  15  5IPELSLVVLIGASGAGKST-------FARKHFQPFEVISS---------DFCRGLVSNDENSQSASRDAF-----DVLHYITTKRLAAGKLTVID------------ATNVQPEDRKTLLQMAKQYHCFTVAIVFDLPEELCHERNQQRSDRQFGSHVVRRHTQMLRRSLRSLEKEGFRYVYTLKSPEEIANVAIELQPLWNN....... 174
10 -13.700[R] COG3911 Predicted ATPase  ali follow..  16  3NDFDRVFVLTGGPGSGKTTLIAALRRA----------------GFATSVVAGRGIVRDQSSIGGSDRTLFAELMLSWEMRSYQNAVEQKGPVFFDRGVPETLGYL---RLSGLPVADHVSTAAKRFRYNPRVFIAPPWPDI-------AQDEERKQTPDEAKCTYHALAEIYTELGYE-PLPLAPVETRLRFVLADA............. 180
11 -13.000[R] COG0645 Predicted kinase  ali follow..  13  2....FLAVTHGVSAVGKSQVAMRLVEALGAVRLRSDIERKRLFGEQPEHDQFAAGIYSSQASEATYAHLHQLAAK---------ILQAGYPVVID------------AAYLKQNQRQAACHIAEETGVPFLILDCQAPEAVIAGWLAQRQA-EGKDPSDATLDVIRTQQATREPLTAAETVQSKRVDTHDAASLDGLVDGIRQRL..... 182
12 -13.000[F] KOG3347 Predicted nucleotide kinase/nuclear protein involved oxidative stress response  ali follow..  13  6......ILLTGTPGVGKTTLGKELASKSGLKY-------------INVGDLAREEQLYDGYDEEYDCPIL---DEDRVVDELDNQMREGGVIVDYHGCD-----------------------FFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLP-SNKPEELENNVDQILKWIEQ.... 165
13 -12.600[F] COG0194 Guanylate kinase  ali follow..  15  43.ERGLLIVLSGPSGVGKGTVRQAIFSQEDTKFEYSISVTTRSPREGEVRDEFEQMIADNKLLEWAEYV-YYGTPVDYVEQ----TLQDGKDVFLE------IEVQGALQ--------------VRNAFPEGLFIFLAPPSLS-NRIVTRGTET-------DALIENRMKAAKAEIEMMDAYDYVVENDNVETACDKIKAIVLA....... 225
14 -12.200[H] KOG3220 Similar to bacterial dephospho-CoA kinase  ali follow..  11  2....FIVAVTGGIATGKSTISKVFERQIDADKIAREIVEPGQPCWRQIREVFGDEVLLPSKEINRAVLFEDKELRGKLNKITHPTIHR-------KIFWQVCKLLVTGHAWIVLDLPLLFETGVLMDFIHKIVCVTCDSDKQLERLIARNESEARHRVDSQMPLDKKCEKS----------FVIDNNGSVEEAESSAMSIYNLMRDS... 199
15 -11.900[F] COG1102 Cytidylate kinase  ali follow..  16  3.KGCLVITVSGLAGSGTTTLCRNLAKHYGFKHVYAGLIFRQKERGMSLEEFQKYAELHPEID-------------REVDRRQVEAAKECNVVIEGRLAGWMVK--------------------------DLKIWLDAPIRVRAERVAKREGISVEEAFMKIAEREMQNRKRYLNLYGID--LIIDTSKSPEGVFAIVKAAIDHLYEKV.. 181
16 -11.700[H] COG3172 Predicted ATPase/kinase involved in NAD metabolism  ali follow..  12  11......VAILGGESSGKSTLVNKLANIF---------------NTTSAWEYGRDYVFSHLGGDEIALQYYDKIALGHAQYIDFAVKYANKVAFIDTDFVTTQAFCKKYEGREHPFVQA----LIDEYRFDLVILLENNTP-------VADGLRSLGSSVDRKEFQNLLVEMLEENNIE-RVEEEDYDSRFLRCVELVREMMGE....... 185
17 -10.600[F] COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases)  ali follow..  14  3......IAITGTPGVGKTTVAKLLAKKLNYEYVSLKDFALEKGCGRRVNDEV-------------------EVEIDELAYFIERELKGKNAV--------------------------LDGHLSHLMPVDLVVVLRAHPKLIGERLRERGYDREKIGENVEAELVDAVLIEAIEEHENV-IEVDTTNKSPEDVVEEIVSLINSGIK.... 156
18 -10.400[F] COG4088 Predicted nucleotide kinase  ali follow..  11  3.....LIIVSGYPSSGKTTRSNELKKALEDR-IHQNIDNTKDYRVIIINDESLNIEKETYRESKNEKAARGL-----LYSAVQRELSKSTFVI----CDALNYIKGF---------YQLYCESKSMYTTHCVIHVAVPQDLCRKFNSNKEQP.......................................................... 131
19 -10.100[F] COG0572 Uridine kinase  ali follow..  14  5AHQCVIIGIAGASASGKSLIASTLYRELREQVGDQHIGVIPEDG-----EERVKTNYDHPSAMDHNLLL------EHLQA-----LKAGKPVELPLY-----SYTEHTRKKETVHLEPKKVIILEGIL-NFSIFVDTPLDICLMRRMKRDVNERGRS--------DSVMAQYQKTVRPMFLQFIEPSKQYADI................. 189
20 -10.000[S] COG4185 Uncharacterized protein conserved in bacteria  ali follow..  16  9LEQPVFLIVAGPNGSGKSSVYANADLELEGRSVWI-------------PDLLAGRISEVENKPLPEANLVAV---QRIEAWIQSSISVHKTIGVETVLSTD------------KYRRLVEAAEAVGFAIWLFYTVLDSPERSIERIKLRVAKGGHDVPADKVRYARSLDQLPWFLERADRAWIWDNSGATPKLIGEKQD........... 183
21 -9.980[H] COG0237 Dephospho-CoA kinase  ali follow..  3....LVIGLTGGIASGKSTVANMLIEKIDADIIAKQAVEKGMPAYRQIIDEFGEDILLSNGDIDRKKLFTNEQKRLALNAIVHPAVRQ-------EMLNRRDEAVANREAFVVLDIPLLFESKLESLV-DKIIVVSVTKELQLERLMKRNEEEAVSRIRSQMPLEEKTARA----------QVIDNSGTLEETKRQLDEIMNSW...... 196
22 -9.870[F] KOG0707 Guanylate kinase  ali follow..  14  134GNAEKPIVISGPSGVGKGTLISMLMKEFPSMFGFSVSHTTRSPRSMEMKKVMEKEIKDGKFLEFASVHLYGTSI-----ESVEAVTDSGKRCILD------IDVQGARS--------------VRASSLDAIFIFVCPP--SMKELEDRLRARGTETEEQIQKRLRNAEAEIKEGISSGIFGLILYNDNLEECYKKLKVNHLLLIAQ... 324
23 -9.870[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali follow..  16  1MKRPLIIGVGGPVGAGKTMLIERLTRYLSTKGYSMAAITN-ETGGCPHTAIREDASMNFAAIEEMCDLLFLESGGDNLSATFSPDLVDFSIYIIDVAQGEKIPRKG-GQGMIKSDLFIINK-------------VDLAPYVGANVEVMKADTLKSRGNKDFFVTNLKTDEGLKSVAD................................. 193
24 -9.790[G] KOG3354 Gluconate kinase  ali follow..  13  17......FVVIGPAGSGKTTMAKAVSEKLGFEYIEGDDLIEKMSQGHPLNDNDR----------------WLHNCGGACAMELDKESIKGVVLTCSAL---KRSYRDILRSSLEHRPAILR------------IYLAASRETLIKRTTSRKNH------MKADMVESQLAILEAPTADEKDVITISVENGKEQSEEECLDIVHKMVNE... 189
25 -9.590[F] KOG3078 Adenylate kinase  ali follow..  13  13.PKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATDMLRAMVASGSELGKKLKATMDAGKL----------------VSDEMVVELIEKNLETPL--CKNGFLLDGFPRTVRQAEMLD-DLMEKRKEKLDSVIEFSIPDSLLIRRITGRLGEPLIRRSDDNEKALKIRLQAYHTQTTPGIHSAIDASQTPDVVFASILAAFSK....... 229
26 -9.550[R] KOG3062 RNA polymerase II elongator associated protein  ali follow..  11  3.....LVVITGLPASGKSTRARQLRDHFVERGRKVHLI----------ENEAVPKAGFGKNSHTGDSQKEKVVRSD-LKSEASRHLNQEDLVI----LDAGNYIKGYRY--------ELYCMSKVSRTTQCTVFTCIPQEEAWTFNSQRTAPDELPGDSERVQPVDNSDVPYTRETFDALCQRYEEPQSNNRWDSPLVVV.......... 175
27 -9.360[F] COG0563 Adenylate kinase and related kinases  ali follow..  13  3......LILMGLPGAGKGTQAEKIIEKYGIPHISTDMFRAAMKNETELGLKAKSYM----------------DAGELVPDEVTIGIVRDRLSQDD--CQNGFLLDGFPRTVAQAEALE-DILASLDKKLDYVINIDVPEQLLMDRLTGRRGSELIQRDDDKPETVKKRLEVNQKQAQPGYLQNINGDQDISRVFEDINELLKGL...... 215
28 -9.310[L] KOG2134 Polynucleotide kinase 3` phosphatase  ali follow..  13  11KAKQIVVLLIGPPGSGKSTFCDTAM----------------RSSHRPWSRICQDIVNNGKAGTKAQCLKMATD-----------SLREGKSVFIDR-CNLDREQRSEFIKLGGPEF------------EVHAVVLELPAQVCISRSVKRTGHEGNLQGGRAAAVVNKMLQSKELPKVNEGFSRIMFCYSDADVDNAVNMY.......... 170
29 -9.250[S] COG2326 Uncharacterized conserved protein  ali follow..  16  60....IVIVFEGRDAAGKGGVIKRITERVSPR--VFRVVALPAP------------------TDREKTQIYMQRYIQQF-----PA--AGEVVIFDR---SWYNRPGVERVMGLEIAPRFEAAMIESGIVLLKYFLDVSEEEQDRRFRQRINDPLRQWKLSPMDVESYRRWWDYTRAYDEMIRMTDTDDAPWWIVPS.............. 231
30 -9.250[R] COG4619 ABC-type uncharacterized transport system, ATPase component  ali follow..  11  30LRAGEFKLITGPSGCGKSTLLKIVAS-LISPTSGTLLFEGEDVSTLKPEIYRQQVTLFGDTVYDNLIFPWQIRNRQPDPAIFLDFLER--FALPDSILTKNIAELSGGEKQRISLIRNL-------FMPKV-LLLDEITSALDESNKHNVNEMIHRYVREQNIAVLWVTHDKDEINHADKVITLQPHA...................... 214
31 -9.210[E] COG0703 Shikimate kinase  ali follow..  13  68MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRTG----------ADVGWVFDLEGE-----EGFRDREEKVINELTEKQGIVLA----------TGGGSVKSRETRNRLSA--------GVVVYLETTIEKQLARTQRDKKRPLLHVETPPREVLEALANEYEEIAD---VTIRTDDQSAKVVANQIIHMLES....... 239
32 -9.040[C] COG3954 Phosphoribulokinase  ali follow..  10  3.AKHPVIAVTGSSGAGTTTTSLAFRKIFAQLNLHAAEVEGDSFHRYTRPEMDMAIRKARDAGRHISYFGPEANDFSLLEHTFI-EYGQTGKGQSRKYLHTYWNQVPGTFTPWQPLPEPTDVLFYEGLHGDLLVGVVPIVNLEWIQKLIRDTSERGHSREAVMDSVVRSMDDYINYITPQF.............................. 198

FFAS is supported by the NIH grant R01-GM087218-01
8 5 9 5 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ma H, Xiong H, Liu T, Zhang L, Godzik A., Zhang Z. Aggregate formation and synaptic abnormality induced by DSCR1. J Neurochem. 2004 Mar;88(6):1485-96.