current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: SP18305A ZP_02090544.1 411550 Selected-2009-11-12, from JCSG0516

Results of FFAS03 search in JCSG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .
# Score Template Links and tools%idFirst MRTFSLVLLGLAVGAALLSRSPSRPAPTPPEPAAATPTLADLETLEFWERGSYIRPISRTCLTRTPEGTRVELELYHEEVYQEQAGPELLEQAKAILEEYGVGGWAGFSGHDPNVLDGKSFRLEATLADGTRIEAHGENKFPPNYRDVMSALDDLTAAAQKNALQQYTPLast
1 -71.100SP18305A ZP_02090544.1 411550 Selected-2009-11-12  ali  100  1MRTFSLVLLGLAVGAALLSRSPSRPAPTPPEPAAATPTLADLETLEFWERGSYIRPISRTCLTRTPEGTRVELELYHEEVYQEQAGPELLEQAKAILEEYGVGGWAGFSGHDPNVLDGKSFRLEATLADGTRIEAHGENKFPPNYRDVMSALDDLTAAAQKNALQQYTP 169
2 -14.100SP17328A YP_001713578.1 406465 Purified-2010-09-29  ali follow..  11  4IGDVMRFLVLATLSGLALMGC-----------ASVQQAPNTQETIRYA-SSPCFGACPIYSVEVTPTGLIRKQYTKAIGVKEIQGSVKDYQKLADELKTYRPQTGTQSKTAQQTATDMPSYYITWIQPNGTETKLS-TGCISPANNRLNKVMEKLPEQLGIK....... 159
3 -11.700SP17738A ZP_02079225.1 410120 Selected-2009-11-12  ali follow..  1MMKKAFVIAAAVLLIVSLSSCSGGSSGPVSSGGEESPSSSQSASIG-DPSAYAQKQGFIGAAVNEDGSVTVTMTKERQQELLTDLREEIENAFEELAGGSATPYVTNITCDENQKFSGQEPHCNITVKDAATGEAITNAVYPDAIGR...................... 212
4 -11.200GS13218A YP_001302839.1 384643 Selected-2007-09-11  ali follow..  1MKLRITLFTTLL---VLLSACFTGC-KKELKDFSFSYSMESVDNYKLMVL---FDSDKTFRIEEYNYYMDNFAKKRDPKIMEGTLTDEEFASLKPILQKCNFFKMKDSYGFEEETLGDIMYQVSFTTEGKEKIRNSDTGQFSASFVKLIGFINTFLNNHKND....... 161
5 -11.200SP18215A ZP_02090562.1 411511 Selected-2009-11-12  ali follow..  11  1MERRTFLKLAALVPGLALAGCGGSKTLLSPKDPQADSPMNRLLTLNVTNMTNSAAIGGQLQDAKAGKPGDLPDLFSAHSADASALGIENLVDWNDWFTAEDMAAYVPGFVQDGII-DGKQVVFQLIFLNGSQYARFAADT-LATWDGFFEMAGAYRQWSQGK....... 198
6 -11.200SP5395A ZP_02081335.1 410111 Selected-2009-11-12  ali follow..  10  1MAVRRFAAGLLCAFLLLPAGCGQAQETKDQQPKGEQEPVTDINLVLEEKTGVTL----EIEYMAGEISDRLQLLTASRDYPDVINAGVYHNILYQAGAYLPLDELIEKYGPNIQKMDPKIYTLGAGDTQTEELTLHG--PEMDTLADFEAAIRSYMEQYPKIYGLDTVG 207
7 -11.000GS13521D YP_209863.1 384898 Purified-2008-05-17  ali follow..  11  1MNRTFIMKALWLCFCLSITGCAED-DRMTPLSADSGDTADELIPIHISLTGDNDYHSSSFNDASTRSHSPLIAEWVGVKAFSPTRTGEQPDYEGPRIASMELTE-LPRVSTRATVPAGVYFRLIVFRKSGNNYVFQSVADYASN......................... 149
8 -11.000SP17400A ZP_03460851.1 407644 Selected-2009-11-12  ali follow..  1MKKNLFMLFVVILTACVFASCSKDDDDNSGAASSLTMNGEAIKVKSIEGEYDPSTSFRAFTFWVNDASVINTGVYIQGTLSTKLENLSAGSDITSKLGLLMEYNSGDEYITDSDFRSGN--VLTLEFKNKKEVILNGTLTIPYKILE...................... 163
9 -10.900SP13360A ZP_02065746.1 408269 Purified-2013-05-28  ali follow..  10  4MKKYLSIYTLLALTCIVLQSCLFSEEEDESSANRATADVIKCQELEYYIGSNYSAGAVTLLMKFDGKQVEMASEAGAEGYKPGTIITSLYQVKSEQSTMLTFDSYNQMFSGPLGLNMNVDYEFIIMSATPDKVILQGKKY-DIPWRIQLEDIINIEKDAFLNTYR.... 195
10 -10.600SP16730I ZP_03457419.1 407546 Selected-2009-11-12  ali follow..  12  1MKK--SFLLLAGLILLAFTAC-----QNDELVNGGSGNETAV-SFSVQLPGANAPSTRAAGDGTQVNRCIMEIYLGDKERQVVPVAGNKTATFNVRLQTYDFVFWADVSGEGGIKTDRHYQT-NISLLGNYAGNDDSRDAF------TGVLLSKLVTGAFNEAVELTRP 165
11 -10.400SP16698A NP_813080.1 409156 Selected-2009-11-12  ali follow..  11  1MKKFKIEIILMGVLAMIFASCSDFFEPNNDTTLNGDRYIKEGSELYSGFLGIITK------IQAIGDKAIYLTDMRGELLEPTENTPADLYSIYNDLSGNTYADPAKYY----DVIIACNDYLQAKEYRDTHVTTVDDDDYRGLISS-TVRLKTWTYLMLAKIYGQ-AI 161
12 -10.300SP16664C ZP_02071203.1 409191 Selected-2009-11-12  ali follow..  1MKKSGLLAMAFACAGICFTGC----EDDVVINTGNSDKLDTVDGVYGYVKSAAGARELTPISVFGDKVATGHLYFELSKAAEQDVT------VTFKVDEDVLEAYNKKNGTSYKMYPADKLSLA---NGGTATIKAGEQK............................. 132
13 -10.300SP13271C ZP_03460516.1 407402 Purified-2012-10-22  ali follow..  10  1MKN-IFKLMALFAFLFCFSSCEDDEPVIPTLEVTPANLEGTWKLAEWNGASLDEGTYCYVIFNRKEQTFEMYQKFDSMYARYIT-NNPYLGYIISGVYDYGNGDWNNKYIVTDLL-ESGSMTWTSKDDESDVNKYIRCEKVPEEIIAEAKVDKD............... 157
14 -10.300SP17963A ZP_02043127.1 413567 Purified-2010-06-16  ali follow..  1MGKKIRYIAFFIGVCVLLAGC----GKKFDASGYTKAVLDVSYKNEIQKYVELTGADEKEADKIFEDNLQNNMDIMLQEFSGYELPDELEEKYRKLFSD--MMKQVKYTVAEAKEVENKNFTVDVKVE--------PMLIFNDTYQELQKQTEDYATQVSNEVMN.... 151
15 -10.200SP18599A ZP_03311628.1 410636 Purified-2010-09-29  ali follow..  14  1MKNRFLWIMCALLSLLVLTGGCNRKPASTADVPRSLSHQYKIAVAPFTDVLVAQDRQLRDVLYTSTKRSYDFLPRTRPLPDLKRLHTSERPQALPLWVEYAVLTWRDRQGSAAGVTEPAHVRLEFFLLNIKEGNIIGHSVYEVEQQGLTENLEELAREAMTKAVKD-LN 218
16 -10.200SP16804A ZP_01962060.1 407124 Purified-2010-09-29  ali follow..  13  1MKNLQLTKLGFLLFLVLLCGCSDS-DTPAEAGNSYESDVHVLNKFV-----DISEPVQKYYINPNKKSTVLSYITNSDLEELNAVNSLSASRYEKSLFRLNISQAISSHTVDYVVMCTSSQIFVDRINDDSPIELKSAGFTTLSDNLVVSLLD................ 152
17 -10.200SP18028A YP_877256.1 410264 Purified-2013-02-14  ali follow..  3RKNKLLLIIGVGVLTLVIIYLISNNMKYKKFSDFIDNNEQKISRVEMIDG--------------------------STGKTIVSTDKGKIKELINLLNNQRYKK-----SSDQHEIVGYSFGVTFYVDNKNVLQIISTGDRTGKLDKLGKWYKSLL............. 138
18 -10.100GS13271A NP_809127.1 384982 Selected-2007-09-11  ali follow..  11  1MKNIFKLMALFAF-VLCFASCDDDEKVEIPALPVTAANLNGTWQLSEWNGQALAEGTYCYITFNRRELTFEMYQKFDSMYARYIENDPYLGYVISGEYDFGNGDWNNDYIVT-DLLESGSMIWTVKDDDSDVNKYVRCEKVPESIIEEAKTNKN............... 158
19 -9.940SP16946A ZP_02038601.1 407260 Purified-2010-09-20  ali follow..  11  1MKRGKRWLIALLC-LAVIVGGIWAASAMAGRRPYKDLTAADIQSATVLLTP-----------------------------PDITLEVPDTGELAEYLSQVVIYD----RDDSYTEYAGQGALFTLHLADGSTTDILAYNPFYEPCEALNRYANGLLE............ 134
20 -9.920SP18434A ZP_02994499.1 410518 PDB-2014-04-02  ali follow..  1MKKTNKIIFIVFI--VIFIGLSYRHFTNTDKARMEISSLSSIDVFKFNSFSKFSNDKIGVIYDEEKLSKFKVIMNSLDTSEGIKKIEVPKDANIESFKYSYHIQPNLKYVEDNNVYDGYLLYILVGDSEGKYIIFSGTELSYVLDKNNTNILKEIFLNVKKQ....... 162
21 -9.920GS13521C YP_209829.1 384809 Selected-2007-09-11  ali follow..  1MNRTFIMKALWLCFCLSIAGCAED-DRMTPLSADSGNTADELIPIHISLTGDDYHSSSFNDASTRSHSPLIAEWVGVKAFSPTRTGEQPDYEGPRIASMELTEDTLPRVSTRATVPVGVYFRLIVFRKSGNNYVFQSAADYASNGTGTPVLKQGKLLTRSGTIR..... 169
22 -9.910GS13360A NP_812155.1 385301 Purified-2010-06-12  ali follow..  10  1MKKNIMIYLLMALVCFGLQSCLFQEEDDDSSANRATEEVKQYSEMEYYIGQDYALGGITLLCKFDGQRVTMASQGYEGDETIS--SLYKVVSEEATMLTFDTYNAFIHAYAKPQGGGSNDYEFIIKEASAEKIVMQGKKY-DLNWEAYINSVNDVEENAFFIQY..... 191
23 -9.870SP17870A ZP_02079267.1 410164 Purified-2010-09-20  ali follow..  14  3IKGKLIFTWICLLFALAPSSC------AAPRPLGLPFSVSQVEKIELYRFVI------------------------AQARKKTISEAGGIQWIYGVLAEAEAADNTLEPESGAQVTGGSSFEMAYISHEGKTGELKGKNINYQTKEDVSRLWDGFSDEEETPASVSELP 149
24 -9.830SP17960A ZP_02040868.1 413564 Crystal|NMR-2010-06-03  ali follow..  10  1MKKKRNPLLILLLVLAVLLVVEKSKQKEEEAKKIYVTDLGKLSEIQFDVGNG------EIQLVKEDGTWYDK------NDKDFPLAQSYPKKMEKTFRKLEADR-EDGDSLEAYGLEDPAYTVVLTDQDGNETTLYFGNVTGDSYYLTLNEKKEIY............. 156
25 -9.730GS13259A NP_809927.1 384969 Purified-2008-05-02  ali follow..  10  1MSMKKNLKYLLLLSLLSFMAC----NGDEKIDSGMVQQDGEVLQLNVRVGDFAINDVSSIRATDSGSTGTFEN------------------------DRIGIIVLDALSDNIPYRYDGNIWSFDSNNDEGKTTIYYDNKAFPYS-INIDDLKGKFLPQGDQRSKDAY.. 155
26 -9.670SP13521A YP_213699.1 407656 Selected-2009-11-12  ali follow..  1MNKLLIMIGVMTASSLWLSECTQ--EEKYPFFPEKGYDSGTVIPIKISMAENEYDSYTPENDMAPRYNAPLIAEWAGVQTLSRTRTKESPEYNGPRIASMELTE-STLTTRANTLSTGVYFRLIVFRKSGNNYVFQSAADYTSN......................... 151
27 -9.670SP17401A ZP_03460140.1 407645 Selected-2009-11-12  ali follow..  1MKTAIFRFFSFCFALLLLAACSR-----------------------------------------DGQPFLPDDTGKDDGDIPVDIVVSRSTFTGAGDGGETDTKFTPGCHIGVSVDGSAA-NVQYKYPASGSVLVAVGEKI-------------YCGEHSASTVKAYYP 116
28 -9.640SP18715A YP_194540.1 411828 Purified-2010-09-20  ali follow..  1MKKRIIGFMLTGMAILALTGCQNNKKNSSVAKQNGVGQVKK---------------------TNHSNTDNGGKFGHNASVSTALWDTSKQDKLDDFFD-----DWADSM--------NQEYD---KYDGDGQITTAAGEKFPQDFDRV..................... 111
29 -9.600TM1855 TM1855 283707 Purified-2001-11-28  ali follow..  10  1MWKRVLLFMLVVLSVFAFAEVKK-TAPNPNQETFWKELVEKWNAIEWSVIPAAGSSEEAILNAIAAGNA-ICTNIFSGFAAQLAEELDVLVAFDEEFGEEFWKLVDARKMREGWKLNGHYYVIMLFWWRGDLLKELGYDKPPRTYSEIYELAKKWVVPK.......... 178
30 -9.540SP16813A ZP_02065664.1 408151 Selected-2009-11-12  ali follow..  10  1MKSRLFLIGLLVLPFLAVVSCQNDDDDAIPVIHYIRVTDPAKADSMIVVVGEHLGGTQKVYINDQEVSFNRNYVTSTSIILTVPNELELTGQNPELKGEIRIETEHGVAAYNMHVL--TRISATYPIKPGDQMTVIGGN.............................. 159
31 -9.530SP17904A ZP_02422611.1 411275 Purified-2010-11-20  ali follow..  10  1MRKSLVVLIAVII-AAMLCGCADDVSSSVQQEDSSSRSSTKWTVTKVADDDISCEGLVLTALNSGDFPEMVKATDSTLLDTIMDFSKYGITDYCVYQQAISVE------LSEIIAVRADD-GVKAALQSRKDSLIKQFGTYPEQEKIVSSTV................. 146
32 -9.470SP13271B ZP_03460302.1 407401 Purified-2012-10-31  ali follow..  13  1MKN--ILVYLMLAATFLLSACDKDEKMLEPSYLPVTYQLAEWNGVEMSEGRYCYLVIKRKADEETGKRALEIYTNIDSDKSHLLTSTYELESIISGIYDHAAGFWNNSYLISE--LEADRMVWTVLEDAEDVSVYVRCEKVPEDIMNGTRAIK................ 162
33 -9.470SP15308E NP_812397.1 408692 Selected-2009-11-12  ali follow..  1MKK-IYTYLMMLTVSALIISCNEEWSGEQYEHYISFKAPINSDGVSRINVRYKANEATTYQV-----PLIVSGTTLNDKNYTVRIGLDP-----DTLVVLNKERYSTRIDLYYQVLPATFYSLTVEIKAGENTNIDLSEKWP--------TVEESSDGSYTPNYRKHY. 164
34 -9.440SP18295A ZP_02092618.1 411540 Selected-2009-11-12  ali follow..  15  1MKTKQRVLLALLAAAVLLGTLQAAGAAAEGSIPLSSFAAEDLEQIEYTYNGE------TYTLQYSGGSWQL------AQDPAYHLDESACNTMRTALMALNAKRSLTPQAGEDYGLDSPQLTVTVTAAGQSNTLTFGAEN............................. 140
35 -9.430GS13879A YP_001304134.1 384500 Selected-2007-09-11  ali follow..  1MMNIKYTIMAGCLLVMGLASCEMKNEILGKEDGSSEM------------------GLLNLGVAVDAKNNDVQTKADANPGTPESIPSVSATGYIVEISNSTYKTLTYDPTNASVELPVDSYTMYAHKPGGPTETYGGSTSFATDVTVTCKMENTKIQLVYSTEMQTSF. 161
36 -9.430GS13360B NP_812148.1 385099 Purified-2011-05-02  ali follow..  1MRK-IKIYGLLTCVCLMMQSCLFNEDDDESSAQRAIASVNECQELEYYTGEDGEYGGFNVLARFDGNNVIMAADFATDNYEIGEESTSLYKVESYQGTELSFDSYNELIEPSGYNSPGYDYEFVFRSVSKEKIVLTGKKH-ETNWQEKLTNIANVVSQASYVTY..... 191
37 -9.360SP17406B ZP_01961506.1 406764 Purified-2010-09-29  ali follow..  1MKS-ITKYMMYCAVLMGLTAC----------NENSIFEGELYKKVVYVLSETDLTFPVTHSLNTPVSVGYITIYAGGTRAIDQDVTVTLEKD--DLIDKYNHDNFDLDEDKYAKELDPSRYTITAVMKVGDQDPYV-DSTYPLRIAS...................... 152
38 -9.300SP18768A NP_815807.1 410821 Crystal|NMR-2013-05-16  ali follow..  10  1MKKLISLGLVCVCGISLLTACSGNNDNKDTEKSTSQSSSTV-NSKDFVASGEYSVG----------------KDIDPGDYYAVLTQLDDKSSIVLITVK----SGGEN--------NHDLYGVGVSLKKGDTLTFETADK-EKDFQEYMKNPVSSTETSKQKTVNS... 152
39 -9.300SP18297B ZP_01996251.1 410723 Selected-2009-11-12  ali follow..  15  2LRKRLMVVLSAVMTAAIFTGCASKDDSSKSDNKSAKTEQQKSDA............................................................................................................................. 46
40 -9.290GS13634A NP_812824.1 385080 Crystal|NMR-2009-03-13  ali follow..  3MKKHLTQLLLSLLFLVVTAMTCDEQDLAEPIDISCILKEVELYHWDNAGEKPKEALDNKVLKEAYMMEIRLLTDAGEKDPESYDTDHYLRHVLSDGIKKIQITAFNEEFPAGAEVTS-FRFRVVLTMESGETVERL................................. 186
41 -9.290SP16698B ZP_02065717.1 408586 Purified-2010-09-29  ali follow..  1MKRIYMLNLILGLVLMACASCTDFFEPNNDTILRGNDYMGENSELYSGFLGIVTK------MQAVGDKAIYLTDTRAELLEPTEHTPGELYSLYNDLSGNSYADPARYY----DVIISCNDFMQYKDAHETTVDMDHYRGLISSYLTLGKIYGQA.............. 161
42 -9.290GS13688A YP_001299142.1 384415 Purified-2008-11-12  ali follow..  12  1MKVNKYIIGMFVATATLFVSCNTDNEGDIYNGTTMGVTFATGTQSVSFPSTGYEGFDVEVLRAKSSEATTINLSATLVVGDKEQELPASITV-----SSVSFAAGEFKTNIHVTVGDGQNYKVKISLPEEMVTIDQTSDK............................. 139
43 -9.270SP9961B ZP_02064440.1 408430 Selected-2009-11-12  ali follow..  14  5INHILPVLLLTAASGLTTVSCNDFLDKTPDNRTE----LNTDQKIAKLLVSAYPDVSPNELFELYSDNSDDSGPTYGYYQLSEK-ECYNWEDTKEEYQDTPNSLWGGYYGA-NMALK----AIEEKGNPASLNPQRGEALVCRAYCHFM--LATIFCNAYDTHASESIP 167
44 -9.200SP17960C ZP_01994441.1 410740 Selected-2009-11-12  ali follow..  12  1MKQKKTMLIMVVVLAVLLVL-DRQKKAKEDKEKVSLVDVKSLKSFAYESGGS------KMSFTKENGEWVY------DEDDGVRLNQSTIKSTTKEITGLTAVR-SDPDEKSDYGLDSPDYTVTYAAKDGTKGTIQIGNAAGDNYSDAVYTISGTLVSDLVFDLSSL.. 172
45 -9.170SP16857A ZP_02037157.1 407190 Purified-2010-09-29  ali follow..  20  1MKRFFALLSALGL-LLALAACGPAAESPAPTDTTPPPTESMEPT............................................................................................................................. 43
46 -9.160SP17573A ZP_01959750.1 406763 Purified-2010-09-29  ali follow..  6LRKIICLLLVTCSSCSFFAGCTDDINNYEKQTAAEASNKVFISDKYASLAFNAQRTVEGKVANMDTLVAKLVVNCTSPAGGNLTVK---------TIDTLLVDVYNKKNETSYHRFASNWIRLTLTIPEGSMESATSMDGYP........................... 158
47 -9.140SP13896A ZP_02070599.1 409339 Purified-2012-11-27  ali follow..  11  1MKTKKLFGILSLLIIIGVTSCNSDTPQDNVE---------------------------NIKMKVSSEIGTYQPWGSDHFIDCMLVKEEGKNEYEALDFL-GIAGFDYS--------KGYEYTLLVKKTT---------LNPPADASNIAYELVEVLSKVGVEY...... 119
48 -9.120SP16609A NP_812513.1 409067 Selected-2009-11-12  ali follow..  11  1MKI-KYLFTGVLISMLAFMSCED-------PDDLARTGSENVTGLTITCLASDESTTYSAIVDEASNTITIQV-------YYISDTEKIQGDLTQMKVSASLPVGAKFSPSISGIRDVSGFQSTLVKEDGSKITYT................................. 124
49 -9.120SP14896A ZP_02063704.1 408333 Purified-2012-11-05  ali follow..  10  1MKK---IYLFLTAMVLVLTACEKD-VLQSFSFSYYPGLTTHSLEFEVNLMGDLLTEDKTFELYIDTEKTTATPEMYELDLHPVFHQGTPTDQITVTLKNPNDILKDKEVTLVFGIKENENFQPGFVGQRSITINFNDIASQPLWWDSTVESYLGAYDAYKLDEFIKCT. 182
50 -9.120SP15308H NP_812408.1 408695 Purified-2010-06-12  ali follow..  1MKG-IYTLLFSLIVLVMFSACNDEWKEEQFEHYISFKAPINSNGVTRINLSYSETGKTTYRL-----PILVSGSTKNDRDITVKIGIDA-----DTLRTLNIARFSSREDLWYREMPSKHYSFTVQIKAGENVGLDLVDKWPLTIED...................... 150
51 -9.110SP17404A NP_810197.1 408704 Selected-2009-11-12  ali follow..  1MKQILKILILAFAAGFIGTACENNDLNIDAGTFPETGGIGLSMGILQSDNYAMENPQINMDHASLSDQFHISLTEPASQTGNYTVK----------VDESKVLDFNSKHGTSYPLYPTEYIDLG---NSGKMTIEKGEQQ--------SNSVSIAFKYDEAIEDSVIYP 151
52 -9.100SP18103A ZP_02026693.1 411448 Purified-2010-11-20  ali follow..  10  2MKKFGRKALALSLTAVLLTGCGGKSKNEGKKGEDSTTKIGLTTGLASDTTADISIMTWSGDSKYYEDIGSMDLSTDKLTSQNVAQVYAVAKQFKKLYPNIKINKWEQEMTSSNLNYYGFQGGLPSFSINKALAESKN--NVPDTIDEYTRFFTKSDNT........... 232
53 -9.090SP17946B ZP_02091070.1 411524 Selected-2009-11-12  ali follow..  10  4LHKFAVLTLSAVLTVCLLAGCGASASSTASSAASSVASSVTASE------------AASSAASKAQATVEFTVTAADGSVSSVLLNVTDGEKLSTALAEAGIISQEEAEAGFVTTVNGETWCL---TDAAGEMTTVGVADIE........................... 139
54 -9.080SP13993A ZP_02071416.1 409313 Purified-2010-09-29  ali follow..  1MKRYMKFFIVFWGILLVCSACTDEYEANNGGMKECCEGVP-------------------FTVRAIVADFEELSNAGKSSTRTSVRDEHFKMEFVD--DSIGVFAIKDNIDNAKLVYNMSSGSWNLYWYDGVSYVAY----YP--YRKASLTGNEKLQPAKDQSTTEKH. 169
55 -9.080SP17868A ZP_02080592.1 410162 Purified-2010-09-20  ali follow..  1MKKMFICLVGMVM-AISLAGCGGQSDAQNGGSAPDSSYTSAVQVLETVIDAYTEEQKFPIGGGDSENLTAFDISKTEELDMTLGLPESEAANIDDAASMVHMMNANTFTGAAYRLKSGVQWMVVIDVDGQYVLTAYGADELIETFKTNALSALDGAKVVLDAPVVE... 193
56 -9.080SP18069A ZP_02432793.1 410331 Selected-2009-11-12  ali follow..  13  1MKKCIVLYVIICLGIFLFAGCASADTNDKTNKEKKAPAGEDAFA............................................................................................................................. 45
57 -9.070SP16822A ZP_02064639.1 408174 Purified-2010-05-06  ali follow..  1MKTILLKLILILGVCQIVYSC----SNEYSNDKLFPEEYHKILYFK--------EGKHIFSWQASENTVEEPLLVIKAGSDP---SLTATVNVRALTQQEIDENYSQPENQSYKTITPDAYSFELTFATNETSKYLYLNFDVAKIYQLIK................... 141
58 -9.040SP16538A YP_213039.1 407892 Crystal|NMR-2010-04-17  ali follow..  1MNAIKNIYAVLALIALCLSSCEMKNELEGKYNLKNDE------------------GLLTLDLVNKTQATPTTKAESTSLTDELDVNTYKVEIVDNATEAVSFASYAKLKEALPLVVPVGNYKIVAKSGVLQD-YFEGSSSIESKAEVLCKSATVKVSLNISEEFLNMF. 162
59 -9.040SP17568A NP_391174.1 406744 Purified-2013-08-01  ali follow..  18  1MHL-IRAAGAVCLAVVLIAGCRFNEDQHQAEGENTAVTQLKYSNFSLRV-SYGDGEHNRYEGIYTKNGTQEKAEIQDKLSGVNQEGEEALDEMKMILSELSVTDQMAETEVIHSVLHYDHIDLKLKLKDGSIREIK................................. 144
60 -9.030GS13310B YP_001299475.1 384379 PDB-2011-09-30  ali follow..  1MKRYLSIITILGMMLLPFSACDGILEGIYDSPAASDSNELG------FIRTDPSTHSGTIYIDATDYRRWTFIDFHTQKVDSVNVTDSEQKE-------------------------PEEWDIAVH---RYDVKTNAGAVLETGFTGF..................... 114
61 -9.010SP16855A ZP_02036100.1 407188 Selected-2009-11-12  ali follow..  13  1MNKATKLMYVLVGVLVVCMAANDTAEDRVVDDKTYLAQLEDITSLTWQRSGE------TLSFEKDEDGVWH------VSDADFPLDQSYLTALETTLSQLSAVK-PDPEEDSSYGLDTPDLTLTATAADGKSLEITVGSEVDGNYYARPAGDSQVY............. 153

FFAS is supported by the NIH grant R01-GM087218-01
1 1 7 8 9 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zhang B, Jaroszewski L, Rychlewski L, Godzik A. Similarities and differences between nonhomologous proteins with similar folds: evaluation of threading strategies. Fold Des. 1997;2(5):307-17.